COMPOSITIONS AND METHODS FOR INHIBITING DHHC-TYPE PALMITOYLTRANSFERASES FOR CANCER TREATMENT
20210032298 ยท 2021-02-04
Assignee
Inventors
Cpc classification
G01N2800/56
PHYSICS
A61K45/06
HUMAN NECESSITIES
A61K31/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present invention relates to compositions and methods for inhibiting DHHC3 palmitoyltransferase for treating cancer. Described herein, are methods of inhibiting expression or activity of programmed death-ligand 1 (PD-L1) in a cell of a subject, e.g., a human subject, in need thereof are carried out by administering to the subject an effective amount of a palmitoyltransferase inhibitor, thereby inhibiting the expression or activity of PD-L1 in the subject. The palmitoyltransferase comprises an Asp-His-His-Cys motif (DHHC)-type protein. Exemplary DHHC-type proteins include DHHC3, DHHC5, DHHC7, and DHHC17.
Claims
1. A method of inhibiting expression or activity of programmed death-ligand 1 (PD-L1) in a cell of a subject in need thereof comprising: administering to the subject an effective amount of a palmitoyltransferase inhibitor, thereby inhibiting the expression or activity of PD-L1 in the subject.
2. The method of claim 1, wherein the palmitoyltransferase comprises an Asp-His-His-Cys motif (DHHC)-type protein.
3. The method of claim 2, wherein the DHHC-type protein comprises DHHC3, DHHC5, DHHC7, or DHHC17.
4. The method of claim 3, wherein the DHHC-type protein comprises DHHC3.
5. The method of claim 1, wherein the palmitoyltransferase inhibitor decreases DHHC3-dependent palmitoylation of chemokine-like factor (CKLF)-like MARVEL transmembrane domain containing family member 6 (CMTM6).
6. The method of claim 1, wherein the subject has been diagnosed with cancer or is at risk of developing cancer.
7. The method of claim 6, wherein the cancer is breast carcinoma, thyroid carcinoma, skin cutaneous melanoma, uterine corpus endometrial carcinoma, sarcoma, bladder urothelial carcinoma, papillary thyroid carcinoma, colon cancer, or prostate cancer.
8. The method of claim 7, wherein the breast cancer is selected from the group consisting of ductal carcinoma in situ, invasive ductal carcinoma, triple negative breast cancer, inflammatory breast cancer, metastatic breast cancer, medullary carcinoma, tubular carcinoma, mucinous carcinoma, human epidermal growth factor receptor 2 (HER2)+ breast cancer, and estrogen receptor (ER)+ breast cancer.
9. The method of claim 1, wherein the palmitoyltransferase inhibitor inhibits tumor growth and/or tumor metastasis of a tumor in the subject.
10. The method of claim 1, wherein the palmitoyltransferase inhibitor is administered orally, intramuscularly, subcutaneously or intravenously.
11. The method of claim 1, wherein the palmitoyltransferase inhibitor comprises a small molecule inhibitor, ribonucleic acid interference (RNAi), an antibody, an antibody fragment, an antibody drug conjugate, an aptamer, a chimeric antigen receptor (CAR), or any combination thereof.
12. The method of claim 1, wherein the palmitoyltransferase inhibitor comprises 1-Benzyl-4-(5-chloro-2-nitro-benzyl)-piperazine; 11-Methyl-4-(4-nitro-benzyl) 1,2,3,3a,4,5,6,7-octahydro-[1,4]diazepino[3,2,1-jk]carbanzole; {2-[2-(4-Chloro-phenyl)-1,3a,8-triaza-cyclopenta[a]inden-1-yl]ethyl}-diethyl-amine; 2-(2-Hydroxy-5-nitro-benzylidene)-benzo[b]thiophen-3-one; and 2 Bromopalmitate.
13. The method of claim 1, wherein the PD-L1 activity comprises reducing the infiltration or activity of tumor-specific cytotoxic lymphocytes (CTLs).
14. The method of claim 1, wherein infiltration or activity of tumor-specific cytotoxic lymphocytes (CTLs) is increased as compared to infiltration of activity of tumor-specific CTLs in the absence of the palmitoyltransferase inhibitor.
15. The method of claim 1, wherein infiltration or activity of natural killer (NK) cells or M1-like macrophages is increased as compared to infiltration or activity of NK cells or M1-like macrophages in the absence of the palmitoyltransferase inhibitor.
16. The method of claim 1, further comprising administering a PD-L1 inhibitor prior to, simultaneously with, or after administration of the palmitoyltransferase inhibitor, wherein the PD-L1 inhibitor comprises atezolizumab, avelumab, or durvalumab.
17. The method of claim 1, further comprising administering a chemotherapeutic agent prior to, simultaneously with, or after administration of the palmitoyltransferase inhibitor, wherein the chemotherapeutic agent is selected from the group consisting of camptothecin, 5-fluorouracil, cyclophosphamide, methotrexate, doxorubicin, paclitaxel, docetaxel, and epirubicin.
18. The method of claim 1, wherein the palmitoyltransferase inhibitor increases oxidative stress and/or tumor cellular senescence as compared to oxidative stress and/or tumor cellular senescence in the absence of the palmitoyltransferase inhibitor.
19. The method of claim 1, wherein the subject is a human.
20. The method of claim 5, wherein the palmitoyltransferase inhibitor decreases DHHC3-dependent palmitoylation of CMTM6 at an amino acid selected from the group consisting of C90, C76, C65, C52, and C55.
21. A method of inhibiting intrinsic or acquired resistance to chemotherapy or increasing the potency of chemotherapy in a cell of a subject in need thereof comprising administering to the subject an effective amount of a palmitoyltransferase inhibitor, wherein the palmitoyltransferase comprises DHHC3, thereby inhibiting intrinsic or acquired resistance to chemotherapy or increasing the potency of chemotherapy in a cell of a subject.
22. The method of claim 21, further comprising administering an oxidative stress-dependent anti-cancer agent selected from the group consisting of camptothecin and 5-Fluorouracil.
23. The method of claim 21, further comprising administering a chemotherapeutic agent selected from the group consisting of cyclophosphamide, methotrexate, doxorubicin, paclitaxel, docetaxel, and epirubicin.
24. A method of inhibiting a tumor or enhancing anti-tumor immunity in a subject comprising administering to the subject an inhibitor of a DHHC-type palmitoyltransferase; or a method of determining the prognosis of a subject that has been diagnosed with breast cancer or prostate cancer comprising: obtaining a test sample from a subject with breast cancer or prostate cancer; determining an expression level of palmitoyltransferase, DHHC3, in the test sample; comparing the expression level of palmitoyltransferase, DHHC3, in the test sample with the expression level of palmitoyltransferase, DHHC3, in a reference sample; and determining that survival of the subject is shorted if the expression level of the palmitoyltransferase, DHHC3, in the test sample is higher as compared to the level of palmitoyltransferase, DHHC3, in the reference sample; or a method of increasing the immunogenicity of a tumor cell or increasing the effectiveness of an effector T cell in a subject comprising: administering to the subject an effective amount of a palmitoyltransferase inhibitor, thereby increasing the immunogenicity of a tumor cell or increasing the effectiveness of an effector T cell in a subject.
25. The method of claim 24, further comprising administering a PD-L1 inhibitor, wherein the PD-L1 inhibitor comprises atezolizumab, avelumab, or durvalumab.
26. The method of claim 24, further comprising administering a chemotherapeutic agent selected from the group consisting of camptothecin, gefitinib, 5-fluorouracil, cyclophosphamide, methotrexate, doxorubicin, paclitaxel, docetaxel, and epirubicin.
27. (canceled)
28. The method of claim 27, further comprising determining that the breast cancer or prostate cancer is likely to metastasize if the expression level of the palmitoyltransferase, DHHC3, in the test sample is higher as compared to the level of palmitoyltransferase, DHHC3, in the reference sample.
29. (canceled)
30. The method of claim 29, wherein the effector T cell comprises a CD4+ T cell or a CD8+ T cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
DETAILED DESCRIPTION OF THE INVENTION
[0090] The present invention is based upon the surprising discovery that inhibition of a palmitoyltransferase, DHHC3 (a protein with an Asp-His-His-Cys motif), results in decreased expression of programmed death-ligand 1 (PD-L1), thereby enabling killer T cells to better attack cancer cells, e.g., breast cancer cells.
[0091] As described in detail below, the appearance of PD-L1 on tumor cells is dependent upon the expression of a cell surface protein, chemokine-like factor Superfamily Member 6 (CMTM6; also known as chemokine-like factor (CKLF)-like MARVEL transmembrane domain containing family member 6). However, prior to the invention described herein, little was known regarding the properties of CMTM6, including the factors that regulate its expression and function. As described herein, an enzyme, called DHHC3, is required to add a single molecule of lipid/fatty acid to modify the structure of CMTM6. When DHHC3 is removed from breast cancer cells, CMTM6 is no longer modified with the fatty acid, and consequently can no longer support the appearance of PD-L1 on breast cancer cells. Thus, as described in detail below, removal of DHHC3, which disrupts CMTM6, and causes loss of PD-L1, unleashes an enhanced anti-tumor response by killer T cells. Also, removal of DHHC3 not only activates adaptive immunity by diminishing PD-L1, but it also activates clearance of tumor cells by the innate immune system.
[0092] As described herein, DHHC3 inhibition in breast and prostate tumor cells reduces growth and metastasis of tumors. Specifically, described herein is the inhibition of DHHC3 for cancer treatment through enhancing tumor cell clearance. The results presented herein provide an indirect way to regulate PD-L1 through ablation of an enzyme, DHHC3, which reduces CMTM6 palmitoylation, and makes it unable to support expression of PD-L1. Also described herein is the utilization of DHHC3 expression as an indicator of patient survival in breast cancer. As described herein, elevated DHHC3 expression is a biomarker for poor patient outcome in several cancers.
[0093] As described in detail below, DHHC-type protein acyltransferases regulate the localization, stability and/or activity of their substrates. Experiments described herein show that the protein palmitoyltransferase, DHHC3, is upregulated in malignant and metastatic human breast cancer. As described in the Examples below, elevated expression of DHHC3 correlated with diminished patient survival in breast cancer and six other human cancer types. Moreover, ZDHHC3 ablation in human MDA-MB-231 mammary tumor cell xenografts reduced the sizes of both the primary tumor and metastatic lung colonies. Gene array data and fluorescence dye assays documented increased oxidative stress and senescence in ZDHHC3-ablated cells. As described in the Examples below, ZDHHC3-ablated tumors also showed enhanced recruitment of innate immune cells (anti-tumor macrophages, natural killer cells) associated with clearance of senescent tumors. These anti-tumor effects were reversed upon reconstitution with wildtype, but not enzyme-active site-deficient DHHC3. Finally, as described herein, concomitant ablation of the upregulated oxidative stress protein TXNIP substantially negated the effects of ZDHHC3 depletion on oxidative stress and senescence. Diminished DHHC3-dependent palmitoylation of ERGIC3 protein likely played a key role in TXNIP upregulation. In conclusion, the results presented herein demonstrate that DHHC3-mediated protein palmitoylation supports breast tumor growth by modulating cellular oxidative stress and senescence.
[0094] Post-translational palmitoylation affects protein localization, stability, molecular interactions and functions (Mitchell et al., 2006 J Lipid Res, 47:1118-27; Linder M E and Deschenes, R J. 2007 Nat Rev Mol Cell Biol, 8:74-84). Protein palmitoylation is typically mediated by protein acyl transferases (PATs), containing conserved DHHC (Asp-His-His-Cys) motifs needed for enzymatic activity (Mitchell et al., 2006 J Lipid Res, 47:1118-27; Politis et al., 2005 J Biol Chem, 280:10156-63). Among 23 mammalian DHHC enzymes, only DHHC17 (HIP-14) and DHHC5 were so far suggested to affect tumor xenograft growth (Ducker et al., 2004 Oncogene, 23:9230-7; Tian et al., 2015 Mol Cancer Res, 13:784-94), but mechanistic details were lacking prior to the invention described herein. Golgi-resident enzyme DHHC3 (GODZ), is upregulated in breast, prostate and colon carcinomas (Lukk et al., 2010 Nat Biotechnol, 28:322-4), but prior to the invention described herein, a possible role in cancer had not been previously addressed.
[0095] Moderate oxidative stress levels can promote early cancer stages, but excess levels limit tumor growth (Trachootham et al., 2009 Nat Rev Drug Discov, 8:579-91; Gorrini et al., 2013 Nat Rev Drug Discov, 12:931-47). One major consequence of tumor cell oxidative stress is senescence (Hwang et al., 2013 Free Radic Biol Med, 61:95-110; Mahmood et al., 2013 Antioxid Redox Signal, 19:1266-303), leading to clearance by the innate immune system (Perez-Mancera et al., 2014 Nat Rev Cancer, 14:547-58; Ben-Porath I and Weinberg R A, 2005 Int J Biochem Cell Biol, 37:961-76). The results presented herein show DHHC3 upregulation in human breast cancer, elevated ZDHHC3 expression correlating with reduced survival in multiple human cancers, and DHHC3 actively supporting breast tumor xenograft growth. Furthermore, as described in the Examples below, ZDHHC3-ablation upregulates tumor cell oxidative stress, senescence, and infiltration by innate immune cells, leading to diminished in vivo tumor growth.
Palmitoylation and DHHC
[0096] Protein acyltransferases (PATs) catalyze the addition of palmitate. Protein palmitoylation refers to the process of posttranslational attachment of long-chain fatty acids, e.g., palmitate, to residues, e.g., cysteine residues, in proteins, e.g., via a thioester linkage. The effects of protein palmitoylation are diverse and include effects on protein localization, trafficking, and stability. Because the bond between palmitic acid and protein is often a thioester bond, palmitoylation is potentially reversible. A family of integral membrane enzymes that typically reside on the cytoplasmic/luminal face of cell membranes mediate palmitate addition to substrate proteins that can span cell membranes or reside within the cytoplasm. Included in this family of proteins are those that share a conserved DHHC (Asp-His-His-Cys) cysteine-rich domain.
[0097] DHHC (a protein with a conserved Asp-His-His-Cys motif in its sequence; also known as zinc finger DHHC domain-containing protein (ZDHHC) or Golgi-specific DHHC zinc finger protein (GODZ)) is a palmitoyltransferase. The DHHC domain is a protein domain that acts as an enzyme, which adds a palmitoyl chemical group to proteins to anchor them to cell membranes or to modify their distribution and/or functions within membranes. In mammals, 23 members of the DHHC family have been identified (see, e.g., Sharma C and Hemler M 2017, Oncoscience, 1-2, incorporated herein by reference). Protein acyltransferase activity is dependent upon the DHHC domain and mutation of the cysteine of the DHHC motif abolishes catalytic activity of the enzyme. Human proteins containing this DHHC domain include ZDHHC1, ZDHHC2, ZDHHC3, ZDHHC4, ZDHHC5, ZDHHC6, ZDHHC7, ZDHHC8, ZDHHC9, ZDHHC11, ZDHHC11B, ZDHHC12, ZDHHC13, ZDHHC14, ZDHHC15, ZDHHC16, ZDHHC17, ZDHHC18, ZDHHC19, ZDHHC20, ZDHHC21, ZDHHC22, ZDHHC23, and ZDHHC24.
[0098] Recently, five chemical classes of small molecules that inhibit cellular processes associated with palmitoylation were identified (Ducker et al., 2006 Mol Cancer Ther, 5: 1647-1659, incorporated herein by reference). These inhibitors include 1-Benzyl-4-(5-chloro-2-nitro-benzyl)-piperazine; 11-Methyl-4-(4-nitro-benzyl)-1,2,3,3a,4,5,6,7-octahydro-[1,4]diazepino[3,2,1-jk]carbanzole; {2-[2-(4-Chloro-phenyl)-1,3a,8-triaza-cyclopenta[a]inden-1-yl]ethyl}-diethyl-amine; 2-(2-Hydroxy-5-nitro-benzylidene)-benzo[b]thiophen-3-one; and 2 Bromopalmitate. Of the 5 classes studied, 2-(2-hydroxy-5-nitro-benzylidene)-benzo[b]thiophen-3-one, and 2-bromopalmitate (2BP) inhibited the palmitoyltransferase activity of all DHHC proteins tested (Jennings et al., 2008 Journal of Lipid Research, 50: 233-242, incorporated herein by reference).
[0099] An exemplary human DHHC3 amino acid sequence is set forth below (SEQ ID NO: 1; GenBank Accession No: NP_001336309, Version NP_001336309.1, incorporated herein by reference):
TABLE-US-00001 1 mmlipthhfrnierkpeylqpekcvpppypgpvgtmwfirdgcgiacaivtwflvlyaef 61 vvlfvmlipsrdyvysiingivfnllaflalashcramltdpgavpkgnatkefieslql 121 kpgqvvykcpkccsikpdrahhcsvckrcirkmdhhcpwvnncvgennqkyfvlftmyia 181 lislhalimvgfhflhcfeedwtkcssfsppttvillillcfegllfliftsvmfgtqvh 241 sictdetgieqlkkeerrwakktkwmnmkavfghpfslgwaspfatpdqgkadpyqyvv
[0100] An exemplary human DHHC3 nucleic acid sequence is set forth below (SEQ ID NO: 2; GenBank Accession No: NM_001349380, Version NM_001349380.1, incorporated herein by reference):
TABLE-US-00002 1 agcgcgtcatcaacctgcgcggcggccgctcctgcagccgcggccgccgccactgccggg 61 agagctcgatgggcttctcctgcgcgccgcccggtgtctggccgagtccagagagccgcg 121 gcgcctcgttccgaggagccatcgccgaagcccgaggccgggtcccgggttggggactgc 181 aggggaaggcagcggcggcggcggcgggagccccaccggggtctgggactggggaactgc 241 ctccggcttcacggggcacctaaaaggaagacagcttgcagggttggactttgccttcca 301 gggaaactgaaagaggtgaagccggaaggatttcctccctaatgaaggcacagatgccag 361 tatggacagaatagcttatgatgcttatccccacccaccacttccgaaacattgagcgga 421 aaccagaatacctccagccagagaagtgtgtcccacccccctaccctggtcctgtgggaa 481 ccatgtggtttatccgtgacggctgtggcatcgcctgtgccatcgttacctggtttctgg 541 tcctctatgcggagttcgtggtcctctttgtcatgctgattccatctcgagactacgtgt 601 atagcatcatcaacggaattgtgttcaacctgctggccttcttggccctggcctcccact 661 gccgggccatgctgacggaccccggggcagtgcccaaaggaaatgccactaaagaattca 721 tcgagagtttacagttgaagcctgggcaggtggtgtacaagtgccccaaatgctgcagca 781 tcaagcccgaccgagcccaccactgcagtgtttgtaagcggtgcattcggaagatggacc 841 accactgtccctgggtcaacaactgtgtaggcgagaacaaccagaagtacttcgtcctgt 901 ttacaatgtacatagctctcatttccttgcacgccctcatcatggtgggattccacttcc 961 tgcattgctttgaagaagattggacaaagtgcagctccttctctccacccaccacagtga 1021 ttctccttatcctgctgtgctttgagggcctgctcttcctcattttcacatcagtgatgt 1081 ttgggacccaggtgcactccatctgcacagatgagacgggaatagaacaattgaaaaagg 1141 aagagagaagatgggctaaaaaaacaaaatggatgaacatgaaagccgtttttggccacc 1201 ccttctctctaggctgggccagcccctttgccacgccagaccaagggaaggcagacccgt 1261 accagtatgtggtctgaaggaccccgaccggcatggccactcagacacaagtccacacca 1321 cagcactaccgtcccatccgttctcatgaatgtttaaatcgaaaaagcaaaacaactact 1381 cttaaaactttttttatgtctcaagtaaaatggctgagcattgcagagaaaaaaaaaagt 1441 ccccacattttattttttaaaaaccatcctttcgatttcttttggtgaccgaagctgctc 1501 tcttttccttttaaaatcacttctctggcctctggtttctctctgctgtctgtctggcat 1561 gactaatgtagagggcgctgtctcgcgctgtgcccattctactaactgagtgagacatga 1621 cgctgtgcgtggatggaatagtctggacacctggtgggggatgcatgggaaagccaggag 1681 ggccctgacctcccactgcccaggaggcagtggcgggctccccgatgggacataaaacct 1741 caccgaagatggatgcttaccccttgaggcctgagaagggcaggatcagaagggaccttg 1801 gcacagcgacctcatcccccaagtggacacggtttgcctgctaactcgcaaagcaattgc 1861 ctgccttgtactttatgggcttggggtgtgtagaatgattttgcgggggagtggggagaa 1921 agatgaaagaggtcttatttgtattctgaatcagcaattatattccctgtgattatttgg 1981 aagagtgtgtaggaaagacgtttttccagttcaaaatgccttatacaatcaagaggaaaa 2041 aaaattacacaatttcaggcaagctacgttttcctttgtttcatctgcttcctctctcac 2101 caccccatctccctctcttccccagcaagatgtcaattaagcagtgtgaattctgactgc 2161 aataggcaccagtgcccaacacatacagccccaccatcatccccttctcattttataaac 2221 ctcaaagtggattcactttctgatagttaacccccataaatgtgcacgtacctgtgtctt 2281 atctatattttaacctgggagactgttgtcctggcatggagatgaccatgatgctggggt 2341 tacctcacagtccccaccctttcaaagttgacatatggccatcccattggccagaatcca 2401 cagacacacctaagcctgtggcactgggacagaatagattttccatttgagaggcacttc 2461 ctgtgtcagtcttgtttgaaggaggtggtgatggtggatagaggtgaaggaggtagggag 2521 tgccctccaagtgcaaaaataacaaatatgattattgaccatcggggaattctcacacat 2581 tgatttgttttttaagcaattgccagaaacccccttttttagcttttgcttggggtgggg 2641 gtaggagttaaggtttattcaatcctgtcctgggtagggcgaaagttaatctagccatgt 2701 gatttttcagaaaagtaagtggaacatgctgccacttttcaattctgtcagtgcttccac 2761 atggaaacaaaatgcaataaaatttttccaaaacctgttctgatttagctctctcttgag 2821 gtgttacccttagtgggaggccgactatccacaatctacttgagttttctctggttgggt 2881 gtttgtttcattgctctgtctcttgaatgaggatactttattttttttgttttaaaatgc 2941 atttatggtccctctcttgaaccagcttgccccaccaggcctctttcctttgctttctgc 3001 agcctgaatcaattcctttgtgctgatgggctctcctaagagctttcctgagtcagttaa 3061 ctttacctcgtgtctacggtgctattcatgcgatacgggcgaggctgagatgctaagatt 3121 aaaaagaaaagaatgctgttttagatcaagttgatagcatttgttttccatatgcttttt 3181 taaaattttttcataacatacagctcagttaggtgtatgaaagaagtgttattgtattaa 3241 ataactagagcagggctacagctctggccctcccctagggggaagagattggtaatactc 3301 catcttccagggcattttttaaagtgagccaggttagctcttttcccctggcatttctca 3361 ggaatgcagtagatagtgctgaagatgcactgacttttttttagtcctaaaaatagaaac 3421 tcctcctttaaagctgtgcatactatgcttatctttccaatagagtggggttccttcaga 3481 tatcctataggattctgcctctggttttgtataggccttggctagaaagagtcaatgttt 3541 ctgagctctcaaaccagttgctctcagaagataggaataccccaaggttcctggcatttt 3601 tcctatttcatttttgttcagactgatattttgccaagagcacaatgactgaggaatgta 3661 gccatcatttgcagggtagtgattggttcccagcctggcttccacacaggacaggaaggg 3721 aaagcatccctgagctctcctcagtatttccggatgtaatgaaagaggacatctttctac 3781 acaaagtcagccccaacttttggcttggtcacaggagttctgatagtactgtttggtgca 3841 ctcatgggaaattgaaccagtcgtagccacagtctttcagagcctgggctctggggagtg 3901 gaagtgaaaaataaagatgtggcttgttggattgtgatccccagcttgctttccttctgt 3961 caactctgtcaggtttgtgttcatagcaactagactgaatatgcaaaaggcttagatcca 4021 agcaaatctataatctatgcatatttgcatgggcttggtaatatcatgtacacaaaacac 4081 atttgggtagaagtgcatgtgctaaatctccttttagtcccaccattttgtcttcttcat 4141 actgtacttcctcttttttgtttgagacaaggtcttgctctgtcacccaggctggaatgc 4201 agtggcacaattagagctcactgcagccttgaactcctgggctcaagtgattcttgtgcc 4261 ttggcctcctgaatatccagggctacaggcacgtactaccatgcctggctaatttttttg 4321 ttttttaatagagtcagggtctcactgtgttgccctagctagtctcaaatgcccggcctc 4381 cagcaattttcctgccttagcctcccaaagtcctgggattacaggcgtgagccactgggc 4441 ccagccctgtacttcttgaaaaagccccaagtattagcttttgctcatctggctaggcca 4501 cttaaatagttagaatccaccgtcccctaatgcagaaaccgtttaggtgaggtaaattaa 4561 caaacattttaagccgggcgcggacacttctcactgtggacatccctcacgcctgtaatc 4621 ccagcactttgggaggccgaggcgggcagatcacgaggtcaagagatcgagatcatcctg 4681 gctaacacggtgaaaccctgtctctactaaaaatataaaaaaattagctgggcgtggtgg 4741 caggcgtctgtagtcccagctacttgggaggctgaggcaggagaatggcgtgaacccggg 4801 aagtggagcttgcagtgagccaagatcgcaccactgcactccagcctgggcgacagagtg 4861 agactccgtctcaaaaaaaaaaaacaaacattttaaacatgtatgtgaggttggcattac 4921 acagaaactcctctccgggtgggctgggatgggctttctcagccaggctaatgggtttta 4981 aatttctctcttttcaagacttgcagtgcatcagcttaaagggtgagccagccagtagag 5041 gggaaggcgccccacctagaaggtgcccttagatatcaaagaaatgtgaaaagagaaaga 5101 ttttgctagaatcctcctcaaaggtgttcttgaggttgccagaccagcaacgtcaacatc 5161 agcatcacctgagaacttgttagaaatgcacattctcggtccccaccccaggctaccgaa 5221 ccagaaaccgagcggggcccagcagcccgtgtcttaacagccctccaggtgattctgact 5281 atcaagtttgagaatccagttggggctagcaggagtcccccctcaggtggtccctgatgc 5341 ctgctggtgatatgggtcttgtgtgctgctgggctcagcatagtgcagttggggtgtgct 5401 gattgtgagacaggcacgtgttccctccgcggagaagccactgagactgccttccctcat 5461 aagctgcggcctccccaacaaacaactgccaagacatcaaagaaagtctgtatgaagcag 5521 atccaaattattagcctgcccaccactccttgtgcatctcatcagtggaacccatctcta 5581 gaccaagggccctttgggtgaagaagcagcccggaagggaaagagaaaagagtagaacca 5641 agggacctccagatgggagcggcggccggtgagtagtctagagccaggggcattgtagca 5701 gcctggatacatgacctgaacacgtcttgacctttgctttctacgtgtgggtttcaacac 5761 ccatgtggctttttcttgtattctttaaatatgtatctggcttaggatcacctcatagaa 5821 gagaaagaattcacagtgaagcagaaacaagccactgaccagcgtactcccaacctgaac 5881 cttctttttctcaccctctccctcaagtaaacatcttgctgacttgagcagtgtgattgc 5941 cgtagcaaagcagagtggcccccagggatcccgctctgttgggcccacaggaggagccga 6001 tgaagctgatccaaggagtgaggacaagcgctgcagagggacgttcgctaaaagccttct 6061 aggggccgcacatgctctaacacggacataaggatgccctgaatttctgcagctgaggcc 6121 atatagtctggtgaccaagtatttgggtcctggcttcagtctttggttgaaatgtctgct 6181 tggctacttattaccgcacctactaccaaaatatgaccttgagcagtaacttctttaagc 6241 ctcagttttttcatctgaaaacgggaatgataatctaaatcacaaagttaatggaaggat 6301 taaatgagggtgatgaataggaatgtatagcgtctggccctggtatggctttataaatgt 6361 tagctgtgttggagctgtgcttttcaaaccattggtcacagccattcatggtttgcaacc 6421 agcatgtttttcaagaaaaatgtttaatgcattacatattgcaggataagtattgtttta 6481 tgaagcttagggagttgtgtgtatatgtgttctggaatgcaacagaaaaatgtttcctct 6541 tgtgggttacaatatagaggtatgaaatctctgatgaggagagacagtgttatctggccc 6601 gctatgaagagacacatttgcataggctgctccctgaggctctggctttctacatctgat 6661 gatacagggagcagggaacagcctgttctcgttctgtggggctcagctgagtctgttctg 6721 cacagactcttccttcctcgggagccttagtcctaatacattcattttggagtgttggtg 6781 agtttgttcacagatcacagctcatgtgtcacccagactgacctgggccaaaaggcccat 6841 cacacaccctgcaagagcttctggtgtcgactatgacccccttaccaggcatcaaccatt 6901 tttgttcgttctcttgagcctgaagctactattactgctcctctgcaaacctcaagctta 6961 agaactttgcctgcaggatccctttaaatccacacaaaactcaaaattgagtcctaccag 7021 gaaaaagcagccctcagcccatttttatacatcggatttgtttgcaatattttctttcta 7081 gactcaaaagtcaacactccctgaaagtttgtcgactttactgctgaagacctctggtag 7141 acaggccaggctctgtctggaatactttatgaggttggtgaggaggttgagtataatcca 7201 agagtgcctatctgggagcatgccacatgaatggcaaataatcatcctgtgggctcttgg 7261 cttcattccccttctctctgactgagctcagcctgggcacagtggtgatttgcagtagaa 7321 ctggaaacctgttgggcagaaaaaaagacactagttctggttccagttctgatacataac 7381 aagctagatgagccttggccaccgtcatggcctcttggaacttctgtttcttccccatct 7441 gccaatcatcaatactcatacccacctcctcacaaggaggccataaaaacctatggtcat 7501 ggctttgagtccaagtcagtgtggatgcagccagtctgtcatttttgggtgtttcctctg 7561 tagccgggtctgccatatggtgatgtcccagctctcgtgctatgaagttaaagcctcttt 7621 ctcaacaggctgcagatgatcacccaggaagagaatgcagaatgcccaaagcaaaccatc 7681 tcagctggtcactgcttctgtgccaagaagggaggcctggcgaggggccagtcaggaagc 7741 agcatggcatcacatgctcatgacccacatgaaggtccctttagacttgtgtcaacaaga 7801 tccattttctgaaacaactatttttgttctgattataaaagtaacattggctcattggta 7861 aaacttggattgtgtgagaagtctacagaaataaatacaaatcctctagaattccatccc 7921 caaaagtaaccactcagacaaatgttctaatgtcatgtaaaaccatattaaaccatcttt 7981 tctagctgcatagtgttatagaatcatttgcttaaccatcattattgggcatttctcatt 8041 tccagctttgcattattataattcagtgttcaagtttgtattgcataaatctttgtctca 8101 gattattgattatttttaaactttttgtgaaatcagacttacaaaaatgtgacaaaaaca 8161 gtacaaagagttcccatgtacctttcagtcagtctcaccaaaggtaaacattttatacaa 8221 ccataatacaaatataaaaccctggacattggcaacaccatacccttaactaatgtatgt 8281 accttattcacatttctccagttgtcccattaacacccttttctgttccaggatcccaca 8341 ctgcatcatttgcgatgtctccttagtctcctccagtttgtgacagttcctcagtcttcc 8401 tttgtctttcatgaccttgaccctttttaaaaatcgaggtgaaattcctgtaacacaaaa 8461 ttagccattttaaagtgtacatttaatgcattcacaatgttttgtaaccaccaggtctgt 8521 ctggttccaaaatcttttcatcaatctttgacccttttgaagattgtagggcaggtattc 8581 tgtaggctgtccttcagattgtgtttttgatgtttttctcatgattagattgaggttagg 8641 catttggggcaggagcactgctgaagcaatgtgtcctcgttgcaccgtatcaggaggcat 8701 atggtgttgatacgtttcattattgtgatgttaactttgatcattgggtgaaggtggtac 8761 gtgcaatgtttcttccctgctattaaggtactgtttttccctttgtaattgataagtatc 8821 ttatgaggatatacttttgagatccaatttttttaacttagaatttattcaaaagtcaag 8881 aatcttaaatctctgaaatggcgtgggaagaaaaagtgctagatacacagagatctttct 8941 tgagtcatgtgaaggagcagtgcccaagcccagcaaacccacagcaaattcccttggctt 9001 ccagaagagatggagaaagcagtgcccccagtggagggtcaaaggcctctgtgcagggtg 9061 ttgtgggcctggagagctggcctggccatgtctttacctcctctgggcatctccccaccc 9121 caacaccctttctgtggcctggtggctgagttgcagccgacacccagaggcaggtgagtt 9181 gacagcttggaagaggctgcagggtggatctgctgcatgagcaggcctgagcccagcctt 9241 acctccccacagtggtcctgtgtgccctccggctgcctaatgcatgttggcacttgctgt 9301 acgagcacccgcttcttcacctcgcatgctgtttgtgtcctgcactccttccttaacccc 9361 atcgtccttctgctgtgtttgcagcccctatctaccctggtgggagtggccaaaaatatt 9421 taggaggggatcaccagtttgtagtggcctcagaggatgtgtggtcccccttatgcctca 9481 gccactcatcagcctagcccctgcccatcatctggcattgcacttgtggaaggaaagaag 9541 gggagggctgggtggtgggtggagaacacgtcagtccaccaggcgggccctgcttgctgt 9601 gttcctccacgctgctgtccacccacaccccagcagtcctctgagggacctcccgggggt 9661 gacctgggccacaacagactgcccactcagaccccatcttacccatgccgtggacacccc 9721 gcccccccccccgccactgctatgctatagctgggggtgtctatgtgagctgtacagccc 9781 agcaccacgctgacgatgttcttcatccccttctccctgcagggcatcgagcgcctcaaa 9841 cgaaagaaccagcccagggagcacatggggagctggcagtcagtaaaggagacctttggt 9901 ggggacttctccctgaactggttcaaccccttctccagaccgtgtcagccagagatcccc 9961 agtgacaaagacatggtgcggcaggtgacatcgctgtcagacaccgaaacaatggaggat 10021 ccatcagaggagacaaaggacgaggactctgtggaggtgacagatgaatagatgctgctg 10081 tggggagagaagcaaacactaaaaagtgctgtcaaccttcatcctggggttttggctaaa 10141 ggggcttatgggcatggtgcgctcccagcacccccagtgcttcccttagccactcgcttg 10201 gccttgccatttcccctccttcttctctccatgttgggccaggtctgggggtcgggagta 10261 ggctggggacatcagaggaggatgggggctttctcagagttcatctaagaagagtctgca 10321 ctgagacggctcatcaagaaccgttctccaagactgggtggctttcacattctccgccca 10381 gcaaagggagcttttgaacagggcatcccaggggcagaaaagagcttgcctttggctttc 10441 cccaggatttctgtcttctcttgggaaggctgggcccctggctcctggctttgagaagta 10501 aggttgtgacagaaggaccgggcagggcttgccttggggacctgggttgggacactgaca 10561 tcaggggagactagcctggaaagactgcagagctgccagctactccctggaaagggcttc 10621 cccatgctgcctgccgaaattaggaggtagaggtggctgccacatctacctgcaagggcc 10681 aggcatggttcaaagaggaccctgcattaagctctacacacacatgtgcaggacatgtcc 10741 agcatggacagagccagagttaagacagtagcaccgaaaatgagcccccattccacagac 10801 actggagtcttcactgagcgagacagctgggagctgtcctgcctgtggctacatatctag 10861 ccattcacagatgtggatatgggaaggacctctttggagctactggggactccctaacca 10921 ctcgcatgagaacttaattgaatgttacctcttggagggagtctaataacacatgtaggt 10981 agaactgaccataaaccctgcctgtgtgtttgaaaaggccagttctcccaaattggtgcc 11041 catcttgtctctgaaaagatgggtgatggccagggtctgctgattgatgaatcagatgaa 11101 tcaggaagatagacaaacacacacacacacacacacaccccaccaggatgagtctgccct 11161 ctattcaccccatttgaagcctgtggtgtctgtgaccactgctgaaggtctgagcagcgt 11221 tctggtgctcctaaaccccattccagtggttgctgaagcagcatcttctgcacaaagccc 11281 aacagaagggttcttatccccgtttggtataagaagtggattcaccacccactccctcca 11341 cgtgcctttgttcctctctttggcccatttccccagcgtctactggcgtcaggattggca 11401 ggagcacaggcactcagcagagcatgcccctgcaagacctcagtgttagggccccccttc 11461 cagctccaggcaaaagggcatgagtcctggccccaaggggcctgtggctgcagttcagag 11521 gagaagaaggtcagtgtttggaggtgcagcctcaggatgctgagaaaggaaactggcgac 11581 cgtgagaaagaaaagagccaagcagcatcctggttcttggacagcatctttggacactct 11641 gtgaagggcaacgatcctgccagagaccgtctctctacaactgatgacccactagggcct 11701 ggggttaattgctcaaagggcccagtgttcacaaagccacctctgccctaacccttgcca 11761 gagctctccaactatgacccacgagaggggtgatggtgggattctaacatcaacagagca 11821 accagaaagacattgggcctcccacactcaggctgcaggcccactttcttggtccttatc 11881 agctttaatatttattaatgacgacataggagcccgagtcagctgtaaaggccattaact 11941 tgcaatctggacaggaagttgacgctcaccactttgggtaagagctgctctgactgtagg 12001 gccccctatttgttgtcctaacccagaagcagctctgggctgccaggatggtggatggaa 12061 taccagagagttcacactagggaggaagcaatgcctgccccctggagtctcctagggggc 12121 agcagttagaataagggaagaggatttgctggtcactgtttgctgacatgggtttccatg 12181 gtgagttcaggcctgaggacagcagtgtctgcaaaaccacatggcccttgagaaatgtcc 12241 ttgcacattgggcttcaaactcctcttctagggaatccatcttggcctgaaagcagaggt 12301 acaacaccagccccaaaggcaattctgttttcagattggttgctctggaaaggaaggctg 12361 gggtgagggggcattttacttgcacagaggctgaccctgcctcccctcttcactgacccc 12421 atctccaaggtagacctcagccatgtcagtccctgttctgggaggtgctgggctgggcca 12481 cagccagggttatgtaggtaattaacctgtccaaccctgagcctcgcctccccacaccag 12541 caacacagtggtctctctgtggtgaccattcacagcataacattctgcttagcctcagac 12601 tgaaagcattgcaactgatgtcaaaaccagatgagatcttacagggagagagattgggtg 12661 caatttgcctctttctttgaataaaaagctctttgctcaccctca
[0101] An exemplary human CMTM6 amino acid sequence is set forth below (SEQ ID NO: 3; GenBank Accession No: NP_060271, Version NP_060271.1, incorporated herein by reference):
TABLE-US-00003 1 mengavysptteedpgpargprsglaayffmgrlpllrrvlkglqlllsllaficeevvs 61 qctlcgglyffefvscsafllsllilivyctpfyervdttkvkssdfyitlgtgcvflla 121 siifvsthdrtsaeiaaivfgfiasfmflldfitmlyekrqesqlrkpenttraealtep 181 ma
[0102] An exemplary human CMTM6 nucleic acid sequence is set forth below (SEQ ID NO: 4; GenBank Accession No: NM_017801, Version NM_017801.2, incorporated herein by reference):
TABLE-US-00004 1 agggggcggggcgggccaagggcgggggcgggaaggggcggagtcaggcggaagccgggg 61 agaaggcccaggaagtgacggccgcctcccggctaccggggacttctggagtccgagaag 121 tcaacggcgcggttgctgcggccgccgcgctccccggcccgaggcgatggagaacggagc 181 ggtgtacagccccactacggaggaggacccgggccccgccagaggcccccggagcggcct 241 cgctgcctactttttcatgggccggctcccattgctccggcgcgttctcaagggcttgca 301 gctgttgctgtctctgctggccttcatctgtgaagaagttgtatcacaatgtactttatg 361 tggaggactttatttttttgagtttgtaagctgcagtgcctttcttctgagtctccttat 421 actgattgtgtattgcactccattttatgagagagttgataccacaaaagtaaaatcatc 481 ggatttttatattactttgggaacaggatgtgtgtttttgttggcatccatcatttttgt 541 ttccacacatgacaggacttcagctgagattgctgcaattgtgtttggatttatagcaag 601 ttttatgttcctacttgactttatcactatgctgtatgaaaaacgacaggagtcccagct 661 gagaaaacctgaaaataccactagggctgaagccctcactgagccacttaatgcctaaag 721 actctggggagcagatgttacctaaggtagtgaccctgcattgtggtgcctgagccctgg 781 cagaagctcttgtaaaatttgttaattgtttaaaccacttcttttggagagcaaggggaa 841 ggtcaagaaggcagttttatcaatattgtgtcagtcaccacaaagtaggccagataagtt 901 aaaaaaaatttttttttaaataataattgaaacttatctcaaatggagattttggtggga 961 ggaggagaaaacaattgtttttaaatcacacagctcaacggttgataaatgattctgtca 1021 ttctgttacaggtcattcttttactaggcttagcttccaaattatgctttatagctgtat 1081 aaacatcgtgattatattcatctacttagaaattgttttatttttaaattaatttgctta 1141 gctgtttgttttgatgcttagattatgttctgttaatgggaatttaacatatttaagaaa 1201 ccaatatttaaaatgttggtctaggtttttttccttaacatatattaccaggctttactg 1261 tatttcactcagccttaaatgttataatatttttggataacggttattaattctttgaga 1321 ccttcgtatagcctataaaatgtatgggagatgttggtattttatgtgtataaaagcaac 1381 aatatcagcaacttcgtgtttatactgcaccttggttgttgatgtcaagtaaaaaaaaga 1441 ttgttttgtaacacataaaaaaatggaagaaactgataccacacctaaggaccaaagata 1501 agaaagactttttgcccaagacagtgaaagtaattataaaaacaagctttgaccacttac 1561 caagtatctgaagagatgagttcatactatgatttagaaagtggttcaattcccctgttg 1621 gcatatgattatttttactaaaattaatacagctctgtgggtcttccttagtgttttctt 1681 tgaagccaatctgttttttttaggacaccagcctttggtttttcatctgttcgagatgcc 1741 tcttctctgtctccttatcagatagaaatggagtcatgtgctgctgcttcatctagcaga 1801 ggttggcctctggctctgacactttttgtcagttgtctttaggtggtcctgaatcttggg 1861 cccttttgattgtgaatactgtgtagcaggatcttgagagtccttgttcttacataggca 1921 ttgctctagtttgtctttggcaaaaaaaaaaaaaaaaaaaagtaaatatccagggaaccc 1981 tgcccagactaatactgttggtggcataagagaatcaagccattctcaagagataacttc 2041 ataaccagaattgtctgttggctagcagctgtcacagataggcagggcacttgggatatg 2101 acctttctgtccaggtgattcacagactagacctttcttatcctcctcctagagttttga 2161 cttgggactctagtgttaagatgatgagcccgtgcatcaggtccttctgcactttggtgg 2221 aagtctcccagggtaggtttcctatttgaaacagtggaatcatgtttccagtgataaagt 2281 ttaatgacctcatccttttttttttttctcatctgccatttgtgtgtcttagatgggttt 2341 taattgcatgaatgtggctaatgtggttctcagaaattggtcagtatggcccaacatagc 2401 ttctgctctgtcttactgactcaatacctttaggatttgtatcagagtttggatactagt 2461 gttagtggtggtgtcaccactacttaattgggagataatgaaaccaatcatggatgctgt 2521 ttttattgggcatgtcatctaagagaggagaaatagctgggttttgggtctaattatgaa 2581 taaggactgattcagaaaacgagtttatggtaggtagactaaagtttcacatcagactgt 2641 accattgtgatttagacctatctaaaattcagagcatatcatctgggctacctcagggtc 2701 accacccatgtattgggcttagtcaggattgacagatacattctcagctggcctgtcata 2761 taaaacatactgtcattgagcttaagctccgcttgttctgaggtttcacctccatgtgtt 2821 tcattggtgcaaaagtggatctcttagttggtcacttaattctttctttttcagaaagat 2881 agtatgttcactggtatatttggtcactcttagaaccttccttcacattgttttttatgg 2941 gacccatgaatggttagcctttcttttctattgtagaaggaaataaataggagtaaaaag 3001 accattgtagtaaataagttcaaggggaacttgggaccagaaaccactgttatgtacaaa 3061 aaaatggcaaattcaataaactcaaatttaaaataatttttaaattaacagttatgataa 3121 attttatattttatacaaatagattgcttagaatggttctcaagaattataagagaaatg 3181 aactcacagtacaaaaattttataattactatacttgtgttttgtttgggggctgggaaa 3241 tgtatttttacattgtagccaatcattttatatttgtcaatttaaatcttatgggtcttt 3301 tttttttatctctcttgatgtcagattttatagtctttttaaataaatccatttaattaa 3361 aacgttaaaaaaaaaaaaaaaaaa
[0103] An exemplary human PD-L1 amino acid sequence is set forth below (SEQ ID NO: 5; GenBank Accession No: AAP13470, Version AAP13470.1, incorporated herein by reference):
TABLE-US-00005 1 mrifavfifmtywhllnaftvtvpkdlyvveygsnmtieckfpvekqldlaalivyweme 61 dkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisygg 121 adykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgktt 181 ttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerth 241 lvilgaillclgvaltfifrlrkgrmmdvkkcgiqdtnskkqsdthleet
[0104] An exemplary human PD-L1 nucleic acid sequence is set forth below (SEQ ID NO: 6; GenBank Accession No: AY254342, Version AY254342.1, incorporated herein by reference):
TABLE-US-00006 1 atgaggatatttgctgtctttatattcatgacctactggcatttgctgaacgcatttact 61 gtcacggttcccaaggacctatatgtggtagagtatggtagcaatatgacaattgaatgc 121 aaattcccagtagaaaaacaattagacctggctgcactaattgtctattgggaaatggag 181 gataagaacattattcaatttgtgcatggagaggaagacctgaaggttcagcatagtagc 241 tacagacagagggcccggctgttgaaggaccagctctccctgggaaatgctgcacttcag 301 atcacagatgtgaaattgcaggatgcaggggtgtaccgctgcatgatcagctatggtggt 361 gccgactacaagcgaattactgtgaaagtcaatgccccatacaacaaaatcaaccaaaga 421 attttggttgtggatccagtcacctctgaacatgaactgacatgtcaggctgagggctac 481 cccaaggccgaagtcatctggacaagcagtgaccatcaagtcctgagtggtaagaccacc 541 accaccaattccaagagagaggagaagcttttcaatgtgaccagcacactgagaatcaac 601 acaacaactaatgagattttctactgcacttttaggagattagatcctgaggaaaaccat 661 acagctgaattggtcatcccagaactacctctggcacatcctccaaatgaaaggactcac 721 ttggtaattctgggagccatcttattatgccttggtgtagcactgacattcatcttccgt 781 ttaagaaaagggagaatgatggatgtgaaaaaatgtggcatccaagatacaaactcaaag 841 aagcaaagtgatacacatttggaggagacgtaa
DHHC3 Regulation of Adaptive Immunity
[0105] PD-L1, a molecule of some significance in the immune checkpoint blockade arena, appears on the surface of many cancer cells and triggers the inactivation of anti-cancer T cells. It was recently identified that a membrane protein called CMTM6 is needed for continued expression of PD-L1 (Burr et al., 2017 Nature, 549:101-105, incorporated herein by reference; Mezzadra et al., 2017 Nature, 549: 106-110, incorporated herein by reference). As described herein, knockdown of the protein acyltransferase DHHC3 also causes a marked decrease in PD-L1 expression. Notably, as described in detail below, palmitoylation of CMTM6 is largely dependent on DHHC3 being present. These results indicate that DHHC3 ablation causes a deficiency in CMTM6 palmitoylation, which renders it unable to support expression of PD-L1.
DHHC3 Regulation of Innate Immunity
[0106] When DHHC3 is ablated from breast and prostate tumor cells, in vivo growth and metastasis are markedly diminished in xenograft models (i.e. using immunocompromised mice). Available evidence (Sharma et al., 2017 Cancer Research, 77(24): 6880-6890) indicates that decreased in vivo growth is due to increased oxidative stress, leading to elevated senescence in tumor cells, which leads to clearance by the innate immune system.
[0107] The results presented herein provide an alternative approach towards diminishing PD-L1 expression, which is known to enhance anti-tumor immunity. Targeting of DHHC3 may combine the effects of enhancing adaptive immunity (i.e. through diminished expression of PD-L1) with effects of enhancing clearance of senescent tumor cells by the innate immune system.
[0108] DHHC3 knockout mice are relatively normal, indicating that the enzyme may not be needed for normal physiological processes. DHHC3 is an enzyme, and as described herein, can be inhibited by small molecules. As described herein, targeting of DHHC3 enhances anti-tumor immunity. Elevated DHHC3 expression may be a biomarker for poor patient outcome in several cancers. Accordingly, DHHC3 expression informs a method to overcome the immune checkpoint blockade.
DHHC3 Regulates Breast Tumor Growth
[0109] Included herein is evidence for DHHC3 having a key role in human breast cancer. Also, data are provided suggesting that DHHC3 enables tumor expansion in vivo, by a mechanism requiring an active enzyme palmitoylation site, and involving down-modulation of oxidative stress and senescence in cancer cells. Prior to the invention described herein, DHHC3 was not known to function in breast cancer or other cancers. Furthermore, neither DHHC3, nor other mammalian DHHC enzymes were known to control oxidative stress or senescence.
[0110] As described herein, elevated ZDHHC3 gene expression correlates with significantly reduced human breast cancer patient survival. Furthermore, DHHC3 protein levels were elevated in malignant breast cancer, and even more in metastatic breast cancer. These results, combined with ZDHHC3 ablation effects on ectopic and orthotopic tumor xenograft size and metastatic lung colony size, strongly indicate a surprising pro-breast tumor growth role for DHHC3.
[0111] Notably, ZDHHC3 gene upregulation correlated with reduced patient survival in six other human cancers. Also, DHHC3 protein expression was elevated in most breast cancer subtypes, and in prostate and colon cancers (Lukk et al., 2010 Nat Biotechnol, 28:322-4). In addition, ZDHHC3 ablation reduced prostate cancer xenograft growth. Hence, DHHC3 contributes to growth of multiple cancer types. Upregulation of ZDHHC7, closest homologue to ZDHHC3, correlated with reduced patient survival in 2/7 human cancers. By contrast, upregulation of other potentially oncogenic DHHC enzymes (i.e. ZDHHC5 (Ducker et al., 2004 Oncogene, 23:9230-7) and ZDHHC17 (Tian et al., 2015 Mol Cancer Res, 13:784-94)) was, with one exception, not significantly correlated with reduced human survival in the same seven cancers. Other DHHC-type enzymes have been suggested to show cancer expression correlations, or palmitoylate cancer-related substrates (Greaves J and Chamberlain L H, 2014 J Pathol, 233:4-6; Yeste-Velasco et al., 2015 Biochim Biophys Acta, 1856:107-20), but prior to the invention described herein, definitive cancer links remained to be established.
The Role of DHHC3 in Oxidative Stress
[0112] ZDHHC3 ablation minimally affected cell proliferation or soft agar growth in vitro, or cell proliferation, angiogenesis, or apoptosis in vivo. However, unbiased DNA array analysis results (for 12/52 genes with significantly altered expression) strongly suggested oxidative stress upregulation in ZDHHC3-ablated tumors. Upregulation of six genes (GTF2i, TXNIP, AVIL, FKBP11, SETD6 and SETX) and downregulation of six other genes (S100A4, PDE4B, HNMT, NUDT2, AKR1C1 and GSTZ1) is consistent with increased oxidative stress in ZDHHC3-ablated MDA-MB-231 xenograft tumor cells. Upregulation of TXNIP is particularly notable. TXNIP (thioredoxin inhibitory protein) binds to, and inhibits antioxidant function of thioredoxin protein TRX-1, thus enhancing oxidative stress (Cadenas et al., 2010 Breast Cancer Res, 12:R44; Mahmood et al., 2013 Antioxid Redox Signal, 19:1266-303).
[0113] Increased oxidative stress in ZDHHC3-ablated cells was confirmed, in multiple cell types, by measuring increased reactive oxygen species (ROS) levels. Both direct and indirect effects of oxidative stress were substantially reversed by oxidative stress inhibitors (N-acetyl cysteine (NAC), -lipoic acid (-LA), atorvastatin) or by knockdown of TXNIP, a major oxidative stress-inducing gene upregulated in ZDHHC3-ablated cells. Increased oxidative stress was further confirmed by typical downstream oxidative stress-dependent events, such as induced senescence (next section), and diminished phosphatase activity (Tanner et al., 2011 Antioxid Redox Signal, 15:77-97). The latter is manifested as a) increased tyrosine phosphorylation (of FAK and STAT3), and b) diminished time-dependent loss of tyrosine phosphorylation (of FAK).
[0114] Elevated FAK and STAT3 tyrosine phosphorylation may also contribute to deficiencies seen in ZDHHC3-ablated tumor cells. FAK hyper-phosphorylation caused by diminished tyrosine phosphatase activity may interfere with FAK turnover, resulting in diminished FAK function (Yu et al., 1998 J Biol Chem, 273:21125-31; Manes et al., 1999 Mol Cell Biol, 19:3125-35), which would adversely affect tumor cell invasion and dissemination. Regarding STAT3, elevated tyrosine phosphorylation is not only oncogenic, but also may be suppressive by multiple potential mechanisms ((Zhang et al., 2016 Clin Cancer Res, 22:691-703) and references within), including induction of cell senescence (Leung et al., 2017 Mol Cell Biol, 37; Lee et al., 2014 Cell Death Dis, 5:e1537).
[0115] Although the transcription factor, NRF2, has been termed the master regulator of antioxidant responses (Gorrini et al., 2013 Nat Rev Drug Discov, 12:931-47), NRF2 expression was only slightly upregulated (1.2-fold) in ZDHHC3-ablated cells. Furthermore, expression levels of 22 different redox-related genes known to be controlled by NRF2 (Gorrini et al., 2013 Nat Rev Drug Discov, 12:931-47) were only minimally altered in ZDHHC3-ablated cells. Hence, NRF2 does not appear to play a role in DHHC3-regulated redox-related events.
Elevated Oxidative Stress Leads to Senescence
[0116] Increased oxidative stress, coupled with other tumor microenvironment stresses, can limit tumor survival by triggering apoptosis (Ueda et al. 1998 J Immunol, 161:6689-95). However, instead of increased apoptosis in DHHC3-ablated tumors, oxidative stress-dependent induction of senescence was observed (Panieri et al., 2013 Free Radic Biol Med, 57:176-87; Dasari et al., 2006 Cancer Res, 66:10805-14). Evidence for increased senescence includes 10 upregulated senescence-linked genes (PIP5K1b, COL6A3, TXNIP, AMY1A, RSRP1, ITSN2, KLHL28, ATM, TRIM38, and COL13A1) and downregulation of 8 genes typically diminished during senescence (BCL2A1, ANAPC15, PF4, HePTP, CDKN3, CENPN, LIPA, HCLS1). Also significantly altered were CDKN2A, PAI-1, HLA-DRB4, TJP1, RBBP6, IGFBP7, Smurf2, Ask1, THBS1, CBX1, GRP170, CDKN2C and CCNA2 genes (Table 4), which either support senescence or are senescence markers. Additional genes (Esm1, PDGFB, MAPKAPK2, PDGFC, TP53, and FGF5) showed altered expression (Table 4), not quite meeting criteria for inclusion in Table 3, but nonetheless consistent with enhanced senescence.
[0117] Multiple ZDHHC3-ablated cell lines showed increased -galactosidase activity, indicative of senescence (Debacq-Chainiaux et al., 2009 Nat Protoc, 4:1798-806). Selective upregulation of specific chemokine proteins (MCP-1, GRO, CXCL16, IL-8), characteristic of SASP (senescence-activated secreted protein) responses was also demonstrated (Coppe et al, 2008 PLoS Biol, 6:2853-68). Increased senescence, measured by -galactosidase activity and/or SASP marker MCP-1, was substantially reversed by oxidative stress inhibitors (NAC, -LA, atorvastatin). Senescence in ZDHHC3-ablated cells was also substantially reversed upon knockdown of TXNIP, which supports both oxidative stress and senescence (Mahmood et al., 2013 Antioxid Redox Signal, 19:1266-303; Riahi et al., 2015 J Cell Mol Med, 19:1887-99). These results further reinforce a mechanism of ZDHHC3 ablation.fwdarw.diminished palmitoylation of key substrates.fwdarw.TXNIP upregulation.fwdarw.oxidative stress.fwdarw.senescence (see summary scheme in
[0118] Consistent with an SASP response (Xue W et al., 2007 Nature, 445:656-60), increased recruitment of anti-tumor M1-like macrophages and NK cells was observed. Furthermore, it was confirmed that conditioned media from ZDHHC3-ablated MDA-MB-231 cells (containing SASP elements MCP-1 and IL8) indeed can recruit anti-tumor M1-like macrophages in an in vitro model system. These results are consistent with SASP-dependent clearance of ZDHHC3-ablated tumors by innate immune cells. Diminished recruitment of pro-tumor M2-like macrophages (Mantovani A and Sica A, 2010 Curr Opin Immunol, 22:231-7) may further reduce in vivo growth of DHHC3-ablated tumors.
Reconstitution and a Requirement for the DHHC3 Active Site
[0119] Reconstitution with wild type ZDHHC3 reversed ZDHHC3 knockdown effects on TXNIP protein levels, oxidative stress, senescence and in vivo tumor growth. These results, plus similar results obtained using multiple RNAi targeting sequences, effectively rule out off-target shRNA/siRNA effects. A conserved DHHC motif is required for palmitoyl transferase activity of DHHC3 and other DHHC enzymes (Mitchell et al., 2006 J Lipid Res, 47:1118-27). Hence, ZDHHC3-ablated cells were reconstituted with two DHHC active site disabled mutants. Both mutants failed to reverse ZDHHC3 ablation effects on oxidative stress, senescence, TXNIP expression or related events. Furthermore, the D3c/s mutant failed to restore tumor growth in vivo. Hence, DHHC3 palmitoylation activity is needed for reconstituted functions. Although overexpressed DHHC3/GODZ was claimed previously to mediate Ca.sup.2+ transport (Hines et al., 2010 J Biol Chem, 285:4621-8), ZDHHC3 ablation did not alter calcium levels in the cells.
DHHC3 Palmitoylation Activity
[0120] The requirement for the DHHC3 palmitoylation active site focused attention on potentially important DHHC3 substrates. Among 50 putative protein substrates palmitoylated by DHHC3 (manuscript in preparation), ERGIC3 was focused on, because disruption of ERGIC3 is a known trigger of ER stress (Hong et al., 2016 Oncotarget, 7:65335-47), which leads to upregulation of TXNIP (Oslowski et al., 2012 Cell Metab, 16:265-73). It was confirmed that ERGIC3 ablation upregulates TXNIP, and that ZDHHC3 ablation markedly diminishes ERGIC3 palmitoylation, stimulates ER stress and considerably alters ERGIC3 subcellular distribution. Hence, diminished ERGIC3 palmitoylation and altered ERGIC3 distribution (and presumably also function) appear to be key mechanistic consequences of DHHC3 ablation (
[0121] Although GABA(A) receptor (Keller et al., 2004 J Neurosci, 24:5881-91), integrin 6 and p4 subunits (Sharma et al., 2012 Cell Mol Life Sci, 69:2233-44), G protein a subunit (Tsutsumi et al., 2009 Mol Cell Biol, 29:435-47), regulator of G-protein signaling 4 (RGS4) (Wang et al., 2010 FEBS Lett, 584:4570-4) and phosphatidylinositol 4-kinase II (PI4KII) (Lu D et al., 2012 J Biol Chem, 287:21856-65) are reported to be DHHC3 substrates, it's unclear that diminished palmitoylation of these few proteins would cause diminished in vivo tumor growth, oxidative stress and/or senescence. Ablation of ZDHHC3 diminished 64 integrin palmitoylation, and partially reduced integrin expression (Sharma et al., 2012 Cell Mol Life Sci, 69:2233-44). However, this may not be relevant to current results because 64 ablation in MDA-MB-231 cells did not diminish oxidative stress, senescence or TXNIP expression.
[0122] Taken together, the results presented herein demonstrate that DHHC3 promotes in vivo breast tumor growth, by a mechanism involving palmitoylation of key substrate proteins such as ERGIC3. ZDHHC3 ablation not only diminishes in vivo breast tumor growth, but also promotes oxidative stress and senescence. This may explain reduced tumor growth because oxidative stress can diminish tumor growth and/or metastasis (Trachootham et al., 2009 Nat Rev Drug Discov, 8:579-91; Gorrini et al., 2013 Nat Rev Drug Discov, 12:931-47; Woditschka et al., 2014 J Natl Cancer Inst, 106) and senescence can lead to tumor clearance by immune cells (Perez-Mancera et al., 2014 Nat Rev Cancer, 14:547-58; Ben-Porath I and Weinberg R A, 2005 Int J Biochem Cell Biol, 37:961-7648). As a key supporter of breast tumor growth, the results presented herein indicate that DHHC3 is a useful cancer target. Furthermore, targeting DHHC3, which enhances oxidative stress, markedly improves sensitivity to a variety of oxidative stress-dependent anti-cancer drug types (Trachootham et al., 2009 Nat Rev Drug Discov, 8:579-91; Kim et al., 2016 Exp Mol Med, 48:e269).
Solutions to Overarching Challenges
[0123] Described herein is the identification of drivers of breast cancer growth, and methods of inhibiting breast cancer. Also described herein are revolutionized treatment regimens that are more effective, less toxic, and positively impact survival. Breast cancer growth is at least partly driven by the capability of tumor cells to express PD-L1, which triggers inhibition of the adaptive immune system. Described herein is a methodology to inhibit PD-L1 (indirectly by removing DHHC3), which enables re-activation of adaptive immunity, thereby resulting in diminished tumor growth. Removal of DHHC3 also activates innate immune cells, which further contribute to diminished tumor growth. Thus, as described herein, targeting DHHC3 is an effective means for treatment of breast cancer.
[0124] Accordingly, the results presented herein suggest that the presence of the DHHC3 enzyme, elevated in multiple types of breast cancer, contributes to the inhibition of both adaptive immunity and innate immunity. As described in detail herein, removal of DHHC3 unleashes both adaptive and innate anti-breast tumor immunity, leading to substantially reduced breast tumor growth. Because DHHC3 expression is elevated in breast cancer and some other cancers, but not needed for the survival of normal cells or mice, and not elevated in non-cancerous tissue, it appears that targeting of DHHC3 has minimal side effects.
[0125] The results presented herein describe whether DHHC3 ablation causes loss of PD-L1 expression by a mechanism involving loss of CMTM6 palmitoylation. Also, described herein is a determination of whether there exists a positive correlation between DHHC3 expression and elevated PD-L1 in human breast cancer tissue samples, which would further emphasize the relevance of the DHHC3-CMTM6-PD-L1 link identified herein. The results demonstrate clearly that DHHC3 ablation markedly enhances adaptive immunity, leading to diminished breast cancer growth in vivo. Also, the results confirm that DHHC3 ablation is acting almost entirely through a mechanism involving loss of CMTM6 palmitoylation, to cause diminished PD-L1 expression. Finally, the results demonstrate that benefits of DHHC3 ablation are most obvious when both adaptive and innate immunity are enhanced. These results all point to the therapeutic benefits of targeting DHHC3.
[0126] The unexpected results presented herein support the idea that targeting a single molecule (i.e., DHHC3) markedly enhances both adaptive and innate anti-breast cancer immunity. The results motivate the development of specific tools for use in targeting DHHC3. As described herein, DHHC3 is targeted using an RNAi strategy, as the potential for localized RNAi delivery is progressing rapidly. In addition, DHHC3 is also amenable to small molecule inhibition. Targeting of DHHC3 markedly inhibits aggressive and metastatic breast cancer either as a single agent, or in combination which other anti-cancer agents. As such, described herein are methods of early determination of which breast cancers are more likely to be aggressive and/or metastatic, and therefore in need of more aggressive treatment. Finally, as described herein, DHHC3 ablation disables antioxidant protections and enhances the potency of various chemotherapeutic agents.
Breast Cancer
[0127] Breast cancer develops in breast tissue. Signs of breast cancer include a lump in the breast, a dimpling of the skin, a change in breast shape, fluid exuding from the breast nipple, and/or a red, scaly patch of skin. Risk factors for developing breast cancer include being female, obesity, lack of physical exercise, drinking alcohol, hormone replacement therapy during menopause, ionizing radiation, early age at first menstruation, having children late or not at all, older age, and family history. About 5-10% of cases are due to inherited genes, including, e.g., breast cancer 1 (BRCA1) and BRCA2.
[0128] The most common types of breast cancer are ductal carcinoma, invasive ductal carcinoma, and invasive lobular carcinoma. Breast cancer most commonly develops in cells from the lining of milk ducts (i.e., in situ or invasive ductal carcinomas) and the lobules that supply the ducts with milk (i.e., in situ or invasive lobular carcinomas). Less common breast cancers include sarcomas, phyllodes tumors of the breast, Paget disease of the nipple, and angiosarcomas. Ductal carcinoma in situ (DCIS) is a non-invasive breast cancer where abnormal cells have not spread beyond the lining of the breast milk duct. By contrast, with invasive ductal carcinoma, abnormal cells that originated in the lining of the breast milk duct have invaded surrounding tissue. Triple negative breast cancer refers to tumor cells that are negative for progesterone, estrogen, and HER2/neu receptors. Inflammatory breast cancer often affects the skin and may not develop a tumor. Metastatic breast cancer refers to cancer that has spread beyond the breast, e.g., into lungs, bones, or brain. Other, less common, types of breast cancer include medullary carcinoma, tubular carcinoma, and mucinous carcinoma.
[0129] The diagnosis of breast cancer is confirmed by taking a biopsy of the concerning lump or tissue. Once the diagnosis is made, further tests are performed to determine if the cancer has spread beyond the breast. Treatment of breast cancer includes surgery, radiation therapy, chemotherapy, hormone therapy, targeted therapy. For example, chemotherapy may be used before surgery (neoadjuvant chemotherapy), after surgery (adjuvant chemotherapy), or for advanced breast cancer. The most common drugs for neoadjuvant and adjuvant chemotherapy include anthracyclines, such as doxorubicin and epirubicin, taxes, such as paclitaxel and docetaxel, 5-fluorouracil (5-Fu), cyclophosphamide, and carboplatin, or combinations thereof. Chemotherapy for advanced breast cancer includes taxanes, such as paclitaxel, docetaxel, and albumin-bound paclitaxel, anthracyclines, such as doxorubicin, pegylated liposomal doxorubicin, and epirubicin, platinum agents, vinorelbine, capecitabine, gemcitabine, ixabepilone, albumin-bound paclitaxel, and eribulin, or combinations thereof.
Pharmaceutical Therapeutics
[0130] For therapeutic uses, the compositions or agents described herein may be administered systemically, for example, formulated in a pharmaceutically-acceptable buffer such as physiological saline. Preferable routes of administration include, for example, subcutaneous, intravenous, intraperitoneally, intramuscular, or intradermal injections that provide continuous, sustained levels of the drug in the patient. Treatment of human patients or other animals will be carried out using a therapeutically effective amount of a therapeutic identified herein in a physiologically-acceptable carrier. Suitable carriers and their formulation are described, for example, in Remington's Pharmaceutical Sciences by E. W. Martin. The amount of the therapeutic agent to be administered varies depending upon the manner of administration, the age and body weight of the patient, and with the clinical symptoms of the neoplasia, i.e., the melanoma. Generally, amounts will be in the range of those used for other agents used in the treatment of other diseases associated with neoplasia, although in certain instances lower amounts will be needed because of the increased specificity of the compound. For example, a therapeutic compound is administered at a dosage that is cytotoxic to a neoplastic cell.
Formulation of Pharmaceutical Compositions
[0131] The administration of a compound or a combination of compounds for the treatment of a neoplasia, e.g., a melanoma, may be by any suitable means that results in a concentration of the therapeutic that, combined with other components, is effective in ameliorating, reducing, or stabilizing a neoplasia. The compound may be contained in any appropriate amount in any suitable carrier substance, and is generally present in an amount of 1-95% by weight of the total weight of the composition. The composition may be provided in a dosage form that is suitable for parenteral (e.g., subcutaneously, intravenously, intramuscularly, or intraperitoneally) administration route. The pharmaceutical compositions may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York).
[0132] Human dosage amounts can initially be determined by extrapolating from the amount of compound used in mice, as a skilled artisan recognizes it is routine in the art to modify the dosage for humans compared to animal models. In certain embodiments it is envisioned that the dosage may vary from between about 1 g compound/Kg body weight to about 5000 mg compound/Kg body weight; or from about 5 mg/Kg body weight to about 4000 mg/Kg body weight or from about 10 mg/Kg body weight to about 3000 mg/Kg body weight; or from about 50 mg/Kg body weight to about 2000 mg/Kg body weight; or from about 100 mg/Kg body weight to about 1000 mg/Kg body weight; or from about 150 mg/Kg body weight to about 500 mg/Kg body weight. In other cases, this dose may be about 1, 5, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2500, 3000, 3500, 4000, 4500, or 5000 mg/Kg body weight. In other aspects, it is envisaged that doses may be in the range of about 5 mg compound/Kg body to about 20 mg compound/Kg body. In other embodiments, the doses may be about 8, 10, 12, 14, 16 or 18 mg/Kg body weight. Of course, this dosage amount may be adjusted upward or downward, as is routinely done in such treatment protocols, depending on the results of the initial clinical trials and the needs of a particular patient.
[0133] Pharmaceutical compositions according to the invention may be formulated to release the active compound substantially immediately upon administration or at any predetermined time or time period after administration. The latter types of compositions are generally known as controlled release formulations, which include (i) formulations that create a substantially constant concentration of the drug within the body over an extended period of time; (ii) formulations that after a predetermined lag time create a substantially constant concentration of the drug within the body over an extended period of time; (iii) formulations that sustain action during a predetermined time period by maintaining a relatively, constant, effective level in the body with concomitant minimization of undesirable side effects associated with fluctuations in the plasma level of the active substance (sawtooth kinetic pattern); (iv) formulations that localize action by, e.g., spatial placement of a controlled release composition adjacent to or in contact with the thymus; (v) formulations that allow for convenient dosing, such that doses are administered, for example, once every one or two weeks; and (vi) formulations that target a neoplasia by using carriers or chemical derivatives to deliver the therapeutic agent to a particular cell type (e.g., neoplastic (i.e., cancer) cell). For some applications, controlled release formulations obviate the need for frequent dosing during the day to sustain the plasma level at a therapeutic level.
[0134] Any of a number of strategies can be pursued in order to obtain controlled release in which the rate of release outweighs the rate of metabolism of the compound in question. In one example, controlled release is obtained by appropriate selection of various formulation parameters and ingredients, including, e.g., various types of controlled release compositions and coatings. Thus, the therapeutic is formulated with appropriate excipients into a pharmaceutical composition that, upon administration, releases the therapeutic in a controlled manner. Examples include single or multiple unit tablet or capsule compositions, oil solutions, suspensions, emulsions, microcapsules, microspheres, molecular complexes, nanoparticles, patches, and liposomes.
Parenteral Compositions
[0135] The pharmaceutical composition may be administered parenterally by injection, infusion or implantation (subcutaneous, intravenous, intramuscular, intraperitoneal, or the like) in dosage forms, formulations, or via suitable delivery devices or implants containing conventional, non-toxic pharmaceutically acceptable carriers and adjuvants. The formulation and preparation of such compositions are well known to those skilled in the art of pharmaceutical formulation. Formulations can be found in Remington: The Science and Practice of Pharmacy, supra.
[0136] Compositions for parenteral use may be provided in unit dosage forms (e.g., in single-dose ampoules), or in vials containing several doses and in which a suitable preservative may be added (see below). The composition may be in the form of a solution, a suspension, an emulsion, an infusion device, or a delivery device for implantation, or it may be presented as a dry powder to be reconstituted with water or another suitable vehicle before use. Apart from the active agent that reduces or ameliorates a neoplasia, the composition may include suitable parenterally acceptable carriers and/or excipients. The active therapeutic agent(s) may be incorporated into microspheres, microcapsules, nanoparticles, liposomes, or the like for controlled release. Furthermore, the composition may include suspending, solubilizing, stabilizing, pH-adjusting agents, tonicity adjusting agents, and/or dispersing, agents.
[0137] As indicated above, the pharmaceutical compositions according to the invention may be in the form suitable for sterile injection. To prepare such a composition, the suitable active antineoplastic therapeutic(s) are dissolved or suspended in a parenterally acceptable liquid vehicle. Among acceptable vehicles and solvents that may be employed are water, water adjusted to a suitable pH by addition of an appropriate amount of hydrochloric acid, sodium hydroxide or a suitable buffer, 1,3-butanediol, Ringer's solution, and isotonic sodium chloride solution and dextrose solution. The aqueous formulation may also contain one or more preservatives (e.g., methyl, ethyl or n-propyl p-hydroxybenzoate). In cases where one of the compounds is only sparingly or slightly soluble in water, a dissolution enhancing or solubilizing agent can be added, or the solvent may include 10-60% w/w of propylene glycol.
Combination Therapies
[0138] In some cases, the DHHC3 inhibitors of the invention are administered in combination with any other standard therapy; such methods are known to the skilled artisan and described in Remington's Pharmaceutical Sciences by E. W. Martin. For example, the DHHC3 inhibitors of the invention are administered with an anti-PD-L1 inhibitor, e.g., an anti-PD-L1 antibody, or any other anti-neoplastic therapy, including but not limited to immunotherapy, therapeutic antibodies, targeted therapy, surgery, radiation therapy, or chemotherapy.
Kits or Pharmaceutical Systems
[0139] The present compositions may be assembled into kits or pharmaceutical systems for use in ameliorating a neoplasia (e.g., breast cancer). Kits or pharmaceutical systems according to this aspect of the invention comprise a carrier means, such as a box, carton, tube or the like, having in close confinement therein one or more container means, such as vials, tubes, ampoules, or bottles. The kits or pharmaceutical systems of the invention may also comprise associated instructions for using the agents of the invention.
[0140] The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, 1989); Oligonucleotide Synthesis (Gait, 1984); Animal Cell Culture (Freshney, 1987); Methods in Enzymology Handbook of Experimental Immunology (Weir, 1996); Gene Transfer Vectors for Mammalian Cells (Miller and Calos, 1987); Current Protocols in Molecular Biology (Ausubel, 1987); PCR: The Polymerase Chain Reaction, (Mullis, 1994); Current Protocols in Immunology (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
[0141] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.
EXAMPLES
Example 1: Materials and Methods
[0142] The following materials and methods were utilized in generating the results presented herein.
Cell Culture, Other Reagents and Western Blotting
[0143] Human breast cancer (MDA-MB-231, MCF-7, ZR-75, BT549, BT474) and kidney (HEK 293) cell lines were obtained from American Type Culture Collection (ATCC; Manassas, Va.) without further authentication. After 10-20 passages, frozen cells were newly thawed. Mycoplasma was tested using the MycoAlert kit (Lonza Biologics, Portsmouth, N.H.). Cells were cultured in DMEM and/or RPMI medium (Invitrogen, Grand Island, N.Y.) containing 10% FBS (Sigma, MO), HEPES and 1% penicillin-streptomycin (Invitrogen, Grand Island, N.Y.). Antibodies to DHHC3 (pAb) and MCP-1 (pAb) were from Abcam, (Cambridge, Mass.), and antibodies to p-FAK (pAb), total FAK (pAb), VEGF (pAb), total STAT3 (pAb) and IL-8 (pAb) were from Santa Cruz Biotechnology, Inc. (Dallas, Tex.). Antibodies to p-STAT3 (mAb), p-ERK (pAb), and total ERK (mAb) were from Cell Signaling technology (Danvers, Mass.), anti-TXNIP (mAb) was from MBL International (Woburn, Mass.), 4G10 (mAb) was from Millipore (Billerica, Mass.), and anti-EGFR (mAb) was from BD Biosciences (San Jose, Calif.). Dyes for measuring oxidative stress (CellROX) and cellular senescence (C12FDG) were from Invitrogen (Carlsbad, Calif.). Oxidative stress inhibitors, N-acetyl cysteine (NAC) and -lipoic acid (-LA) were from Sigma (Saint Louis, Mo.), and atrovastatin was from Cayman Chemicals (Ann Arbor, Mich.). Chemokine array analysis kit was from R&D systems (Minneapolis, Minn.). Cultured cells were lysed in 1% Triton X-100, and total protein was quantified using BCA protein estimation kit. Western blotting and relative band intensity densitometry were described previously (Sharma et al., 2012 Cell Mol Life Sci, 69:2233-44).
Gene Ablation and Reconstitution
[0144] Transient and stable, control and ZDHHC3 ablations were performed as described (Sharma et al., 2012 Cell Mol Life Sci, 69:2233-44). TXNIP was ablated using two different siRNA's from OriGene (Rockville, Md.). For ZDHHC3 reconstitution, ZDHHC3 cDNA was mutated to escape shRNA targeting (D3.sup.R) and two DHHC palmitoylation site mutations were made (D3.sup.R+DH/AA & D3.sup.R+C/S). These three cDNA's were cloned into lentiviral plasmids downstream of DHHC3 shRNA, and followed by DNA coding for C-terminal 2A linker peptide and GFP tag. These lentiviral plasmids were transfected into HEK293 cells along with pCMV-dR8.91 and VSV-G packaging plasmids, to produce lentiviral particles, which were subsequently used to infect target cells (MDA-MB-231) for stable expression. Plasmid expression in target cells was verified by GFP analysis and GFP positive cells were sorted by flow cytometry.
Mouse Xenograft Growth and Lung Metastasis Assays
[0145] For in vivo tumor growth experiments, control and ZDHHC3-ablated MDA-MB-231 cells were injected into female nude mice on both flanks either ectopically (1.010.sup.6 cells, s.c.) or orthotopically (0.510.sup.6 cells, into mammary fat pads), with 5 mice/group. Starting at day 5 post injection, tumors were measured using calipers and tumor volumes were calculated (lengthwidth.sup.20.5). Mice were sacrificed when tumor size reached 2 cm, and tumors were excised, weighed and portions were fixed and embedded in paraffin sections for immunohistochemical staining, while remaining portions were frozen and used for RNA isolation and DNA array analysis. For lung metastasis, control and ZDHHC3-ablated MDA-MB-231 (1.010.sup.6 cells) were injected into tail veins of SCID Beige mice (3 mice/group). After 5 weeks, mice were sacrificed and lungs were perfused with India Ink, excised and fixed with Fekete's solution. Tumor colonies (white) on lung surfaces were counted using a stereomicroscope. Paraffin embedded lung sections were H&E stained to assess colony size (using light microscope; 2 magnification).
Measurement of Oxidative Stress and Senescence
[0146] To assess oxidative stress/reactive oxygen species (ROS), control and ZDHHC3-ablated tumor cells were trypsinized and suspended in complete medium. After PBS wash, cells were loaded with 2 M CellROX dye in complete medium (37 C., 30 min). Cells were then washed twice with 1PBS, incubated in complete media (37 C., 30 min), washed twice again with 1PBS, and then analyzed by flow cytometry. Similarly, senescence was measured by loading suspended control and ZDHHC3 ablated cells with C12FDG dye (30 min, 37 C.) in complete medium. The C12FDG dye is converted by intracellular -galactosidase (elevated in senescent cells) to produce fluorescence, which was quantitated by flow cytometry.
Chemokine Assay
[0147] As per array kit instructions (ARY017 Kit, R & D Systems), 500 l of supernatant was collected from MDA-MB-231 cells (after 30 h in DMEM media with 1% BSA), and mixed with detection antibody (biotinylated) cocktail. Next nitrocellulose membranes (in duplicate) containing immobilized antibodies to 31 human chemokines were incubated overnight at 4 C. with supernatant/antibody mix. Membranes were then incubated with streptavidin-HRP solution followed by Chemi reagent mix and autoradiography detection. Signal intensities for each chemokine were estimated from pixel densities (Image Quant, version 5.2 software, GE Healthcare).
Immunohistochemical Staining
[0148] Human malignant and metastatic breast tumor microarray slides and normal controls (BR2082, BR10010a) were from US Biomax Inc. (Rockville, Md., USA), and stained for DHHC3 using Alkaline Phosphatase immunohistochemistry Detection kit (ZYAGEN, San Diego, USA). Briefly, slides were deparaffinized, rehydrated, boiled in 10 mmol/L citrate buffer (pH 6.0, 15 min), followed by blocking in serum (1 hr). Next, slides were incubated with 1:75 dilution of anti-DHHC3 antibody, Sigma (Saint Louis, Mo.) at 4 C. overnight, and then with biotinylated secondary antibody (1 hr) and streptavidin-alkaline phosphatase (AP) conjugate (30 min). Finally, slides were incubated with fast red solution and counterstained for hematoxylin. Staining intensity was analyzed by light microscopy and scoring (from 0=no staining to 3=high staining) was performed, in an unbiased and blinded fashion, by a pathology expert at Brigham and Women's Hospital, Boston.
Microarray Analysis
[0149] RNA was isolated using RNeasy kit (Qiagen, Germantown, Md.) from mammary fat pad derived xenograft tumors from control and ZDHHC3 ablated MDA-MB-231 cells. RNA was analyzed from two tumors of each group using U133A 2.0 Affymetrix gene chip array at Dana-Farber Cancer Institute, Microarray Core facility. Microarray data were processed using dChip software. Results were submitted to the GEO database and assigned accession number GSE102776.
Patient Survival and Tissue Expression Data
[0150] Data used for
Differential Protein Palmitoylation
[0151] Using described procedures (Yang et al., 2010 Mol Cell Proteomics, 9:54-70), protein lysates from MDA-MB-231 cells were subjected to TCEP [tris(2-carboxyethyl)phosphine]treatment to selectively reduce all disulfide bonds, followed by irreversible alkylation with NEM (N-ethylmaleimide) to block all free sulfhydryl moieties. Then, proteins were subjected to hydroxylamine (HA) treatment to cleave thioester bonds and newly freed SH moieties subsequently were biotinylated using BMCC-biotin reagent. Finally, biotinylated proteins were immunoprecipitated using neutrAvidin agarose beads, and transferred to nylon membrane for blotting.
TABLE-US-00007 TABLE 1 Correlation between elevated gene expression and diminished patient survival.sub.a # of Type of Cancer samples ZDHHC3 ZDHHC7 ZDHHC5 ZDHHC17 Breast Invasive 817 .sup.0.01.sup.b 0.03 0.38 0.66 Carcinoma Thyroid Carcinoma 509 0.01 0.46 0.45 0.37 Skin Cutaneous 472 0.01 0.04 9.6e.sup.4 0.38 Melanoma Uterine Corpus 333 3.1e.sup.4 0.65 0.21 0.41 Endometrial Carcinoma Sarcoma 263 0.02 0.20 0.09 0.57 Bladder Urothelial 129 0.04 0.2 0.09 0.2 Carcinoma Papillary Thyroid 486 0.04 0.32 0.45 0.5 Carcinoma .sub.aElevated gene expression is defined as Z score 2 (data from cBioPortal (14, 15)). .sup.bNumbers in last four columns represent P values (log rank test) from Kaplan Meier overall survival graphs.
Statistics
[0152] For evaluation of statistical significance, unpaired t tests were used unless otherwise indicated.
Example 2: DHHC3 Upregulation and Cancer Patient Survival
[0153] As described in detail below, DHHC3 expression correlates with patient survival and supports breast xenograft growth. Specifically, analysis of publicly available human breast invasive carcinoma patient data, from the cBioPortal TCGA database, indicated that elevated ZDHHC3 gene expression significantly correlated with diminished patient overall survival (
[0154] Upregulated ZDHHC3 gene expression correlated with significantly diminished overall patient survival in six other cancer types (Table 1). Upregulation of ZDHHC7, the protein acyl transferase with most sequence similarity to ZDHHC3, correlated with significantly diminished overall survival in 2/7 cancers (Table 1). By contrast, upregulation of other DHHC genes (ZDHHC5 and ZDHHC17), though previously linked to tumor xenograft growth, did not correlate with survival of these patients, except for ZDHHC5 in melanoma (Table 1).
Example 3: DHHC3 Supports Breast Cancer Xenograft Growth
[0155] MDA-MB-231 human breast cancer cells stably ablated for ZDHHC3 (D3) yielded significantly reduced xenograft growth in female nude mice, whether in mammary fat pads (
Example 4: Mechanistic Insights into Effects of DHHC3 Ablation
[0156] ZDHHC3 ablation minimally affected primary tumor xenograft angiogenesis (CD31 staining;
[0157] For unbiased mechanistic insight, DNA microarray analysis was performed on ZDHHC3-ablated orthotopic xenograft tumor samples. The complete list of results (Table 2) included 25 upregulated and 27 downregulated genes (>1.5-fold increase or decrease; P<0.05; Table 3). ZDHHC3 itself topped the list of downregulated genes. Importantly, changes in 29/52 genes (55.8%; Table 3) are consistent with increased oxidative stress and/or senescence. Altered expression of 21 additional genes typically linked to senescence, but not quite meeting rigorous criteria for inclusion in Table 3, are indicated in Table 4. Tumor suppressor genes VGLL3 and TXNIP were also upregulated in ZDHHC3-ablated samples (Table 3).
TABLE-US-00008 TABLE 2 DNA array results for control and ZDHHC3 ablated MDA-MB-231 cells 1 Supplemental Table S2. DNA array results for control and ZDHHC3 ablated MDA-MB-231 cells 2 probe set gene Accession EntrezGene Description 3 201008_s_at thioredoxin NM_006472 10628 Consensus includes gb: AA812232/FEA = EST/ interacting DB_XREF = gi: 2881843/DB_XREF = est: ob84h09.s1/ protein CLONE = IMAGE: 1338113/UG = Hs.179526 upregulated by 1,25-dihydroxyvitamin D-3/ FL = gb: NM_006472.1 gb: S73591.1 4 201368_at zinc finger AI356398 678 Consensus includes gb: U07802/DEF = Human Tis11d protein 36, gene, complete cds/FEA = mRNA/ C3H type- DB_XREF = gi: 984508/UG = Hs.78909 butyrate like 2 response factor 2 (EGF-response factor 2)/ FL = gb: BC005010.1 gb: NM_006887.1 5 201438_at collagen, NM_004369 1293 gb: NM_004369.1/DEF = Homo sapiens collagen, type type VI, VI, alpha 3 (COL6A3), mRNA./FEA = mRNA/ alpha 3 GEN = COL6A3/PROD = collagen, type VI, alpha 3/ DB_XREF = gi: 4758027/UG = Hs.80988 collagen, type VI, alpha 3/FL = gb: NM_004369.1 6 201711_x_at RAN binding AI681120 5903 gb: AI681120/DB_XREF = gi: 4891302/ protein 2 DB_XREF = tx44b06.x1/CLONE = IMAGE: 2272403/ FEA = FLmRNA/CNT = 183/TID = Hs.199179.0/ TIER = Stack/STK = 9/UG = Hs.199179/LL = 5903/ UG_GENE = RANBP2/UG_TITLE = RAN binding protein 2/FL = gb: NM_006267.2 gb: D42063.1 7 201847_at lipase A, NM_000235 3988 gb: NM_000235.1/DEF = Homo sapiens lipase A, lysosomal lysosomal acid, cholesterol esterase (Wolman acid, disease) (LIPA), mRNA./FEA = mRNA/GEN = LIPA/ cholesterol PROD = lipase A precursor/DB_XREF = gi: 4557720/ esterase UG = Hs.85226 lipase A, lysosomal acid, cholesterol (Wolman esterase (Wolman disease)/FL = gb: M74775.1 disease) gb: NM_000235.1 gb: U08464.1 8 201965_s_at senataxin NM_015046 23064 gb: NM_015046.1/DB_XREF = gi: 7662211/ GEN = KIAA0625/FEA = FLmRNA/CNT = 233/ TID = Hs.154919.0/TIER = FL + Stack/STK = 39/ UG = Hs.154919/LL = 23064/DEF = Homo sapiens KIAA0625 protein (KIAA0625), mRNA./ PROD = KIAA0625 protein/FL = gb: NM_015046.1 9 202149_at neural AL136139 4739 gb: AL136139/DB_XREF = gi: 8217463/FEA = FLmRNA/ precursor cell CNT = 161/TID = Hs.80261.0/TIER = Stack/STK = 41/ expressed, UG = Hs.80261/LL = 10543/UG_GENE = HEF1/ developmentally UG_TITLE = enhancer of filamentation 1 (cas-like down-regulated 9 docking: Crk-associated substrate related)/ DEF = Human DNA sequence from clone RP4-761I2 on chromosome 6 Contains 3 part of the gene for enhancer of filamentation (HEF1), ESTs, STSs and CpG islands/FL = gb: U64317.1 gb: NM_006403.1 gb: L43821.1 10 202279_at chromosome NM_004894 9556 gb: NM_004894.1/DEF = Homo sapiens chromosome 14 open 14 open reading frame 2 (C14ORF2), mRNA./ reading FEA = mRNA/GEN = C14ORF2/PROD = chromosome 14 frame 2 open reading frame 2/DB_XREF = gi: 4758939/ UG = Hs.109052 chromosome 14 open reading frame 2/FL = gb: BC000429.1 gb: BC001944.1 gb: AF054175.1 gb: NM_004894.1 11 202481_at dehydrogenase/ NM_004753 9249 gb: NM_004753.1/DEF = Homo sapiens short-chain reductase dehydrogenasereductase 1 (SDR1), mRNA./ (SDR family) FEA = mRNA/GEN = SDR1/PROD = short-chain member 3 dehydrogenasereductase 1/DB_XREF = gi: 4759083/ UG = Hs.17144 short-chain dehydrogenasereductase 1/FL = gb: BC002730.1 gb: AF061741.1 gb: NM_004753.1 12 202554_s_at glutathione AL527430 2947 gb: AL527430/DB_XREF = gi: 12790923/ S-transferase DB_XREF = AL527430/CLONE = CS0DC021YF13 (5 M3 (brain) prime)/FEA = FLmRNA/CNT = 157/TID = Hs.2006.0/ TIER = Stack/STK = 54/UG = Hs.2006/LL = 2947/ UG_GENE = GSTM3/UG_TITLE = glutathione S- transferase M3 (brain)/FL = gb: NM_000849.1 gb: BC000088.1 gb: J05459.1 13 202759_s_at A kinase BE879367 11217/// Consensus includes gb: BE879367/FEA = EST/ (PRKA) 445815 DB_XREF = gi: 10328143/DB_XREF = est: 601484628F1/ anchor CLONE = IMAGE: 3887262/UG = Hs.42322 A kinase protein 2/// (PRKA) anchor protein 2/FL = gb: AB023137.1 PALM2- gb: NM_007203.1 AKAP2 protein 14 202957_at hematopoietic NM_005335 3059 gb: NM_005335.1/DB_XREF = gi: 4885404/ cell-specific GEN = HCLS1/FEA = FLmRNA/CNT = 140/ Lyn substrate 1 TID = Hs.14601.0/TIER = FL + Stack/STK = 59/ UG = Hs.14601/LL = 3059/DEF = Homo sapiens hematopoietic cell-specific Lyn substrate 1 (HCLS1), mRNA./PROD = hematopoietic cell-specific Lyn substrate 1/FL = gb: NM_005335.1 15 203186_s_at S100 calcium NM_002961 6275 gb: NM_002961.2/DEF = Homo sapiens S100 calcium- binding binding protein A4 (calcium protein, calvasculin, protein metastasin, murine placental homolog) (S100A4), A4 (calcium transcript variant 1, mRNA./FEA = mRNA/ protein, GEN = S100A4/PROD = S100 calcium-binding protein calvasculin, A4/DB_XREF = gi: 9845514/UG = Hs.81256 S100 metastasin, calcium-binding protein A4 (calcium protein, murine calvasculin, metastasin, murine placental homolog)/ placental FL = gb: NM_002961.2 gb: NM_019554.1 homolog) 16 203568_s_at tripartite NM_006355 10475 gb: NM_006355.1/DB_XREF = gi: 5454013/ motif- GEN = RNF15/FEA = FLmRNA/CNT = 108/ containing TID = Hs.59545.0/TIER = FL + Stack/STK = 16/ 38 UG = Hs.59545/LL = 10475/DEF = Homo sapiens ring finger protein 15 (RNF15), mRNA./PROD = ring finger protein 15/FL = gb: U90547.1 gb: NM_006355.1 17 204151_x_at aldo-keto NM_001353 1645 gb: NM_001353.2/DB_XREF = gi: 5453542/ reductase GEN = AKR1C1/FEA = FLmRNA/CNT = 107/ family 1, TID = Hs.306098.0/TIER = FL + Stack/STK = 25/ member C1 UG = Hs.306098/LL = 1645/DEF = Homo sapiens aldo- (dihydrodiol keto reductase family 1, member C1 (dihydrodiol dehydrogenase dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid 1; 20-alpha dehydrogenase) (AKR1C1), mRNA./PROD = aldo-keto (3-alpha)- reductase family 1, member C1(dihydrodiol hydroxysteroid dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase) dehydrogenase)/FL = gb: NM_001353.2 gb: M86609.1 gb: U05684.1 18 204218_at chromosome NM_014042 25906 gb: NM_014042.1/DB_XREF = gi: 7661621/ 11 open GEN = DKFZP564M082/FEA = FLmRNA/CNT = 67/ reading TID = Hs.38044.0/TIER = FL + Stack/STK = 18/ frame 51 UG = Hs.38044/LL = 25906/DEF = Homo sapiens DKFZP564M082 protein (DKFZP564M082), mRNA./ PROD = DKFZP564M082 protein/FL = gb: AF077206.1 gb: BC005156.1 gb: AL080071.1 gb: NM_014042.1 gb: BC005393.1 19 204387_x_at mitochondrial NM_024026 78988 gb: NM_024026.1/DEF = Homo sapiens hypothetical ribosomal protein MGC3243 (MGC3243), mRNA./FEA = mRNA/ protein 63 GEN = MGC3243/PROD = hypothetical protein MGC3243/DB_XREF = gi: 13128969/UG = Hs.182695 hypothetical protein MGC3243/FL = gb: BC000002.1 gb: NM_024026.1 20 204461_x_at RAD1 NM_002853 5810 gb: NM_002853.1/DEF = Homo sapiens RAD1 homolog (S. pombe) homolog (RAD1), mRNA./FEA = mRNA/ (S. pombe) GEN = RAD1/ PROD = RAD1 (S. pombe) homolog/ DB_XREF = gi: 4506384/UG = Hs.7179 RAD1 (S. pombe) homolog/FL = gb: AF058392.1 gb: AF073524.1 gb: AF074717.1 gb: AF011905.1 gb: AF084512.1 gb: AF030933.1 gb: AF076841.1 gb: NM_002853.1 21 204525_at PHD NM_014660 9678 gb: NM_014660.1/DB_XREF = gi: 7662303/ finger GEN = KIAA0783/FEA = FLmRNA/CNT = 49/ protein TID = Hs.156276.0/TIER = FL/STK = 4/UG = Hs.156276/ 14 LL = 9678/DEF = Homo sapiens KIAA0783 gene product (KIAA0783), mRNA./PROD = KIAA0783 gene product/FL = gb: AB018326.1 gb: NM_014660.1 22 204852_s_at protein NM_002832 5778 gb: NM_002832.1/DEF = Homo sapiens protein tyrosine tyrosine phosphatase, non-receptor type 7 (PTPN7), phosphatase, mRNA./FEA = mRNA/GEN = PTPN7/PROD = protein non-receptor tyrosine phosphatase, non-receptor type7/ type 7 DB_XREF = gi: 4506298/UG = Hs.35 protein tyrosine phosphatase, non-receptor type 7/ FL = gb: BC001746.1 gb: M64322.1 gb: NM_002832.1 23 204860_s_at baculoviral AI817801 4671/// gb: AI817801/DB_XREF = gi: 5436880/ IAP repeat- 648984/// DB_XREF = wk40d12.x1/CLONE = IMAGE: 2417879/ containing 653371 FEA = FLmRNA/CNT = 49/TID = Hs.79019.0/ 1/// similar TIER = Stack/STK = 10/UG = Hs.79019/LL = 4671/ to Baculoviral UG_GENE = BIRC1/UG_TITLE = baculoviral IAP repeat- IAP repeat- containing 1/FL = gb: NM_004536.1 gb: U19251.1 containing protein 1 (Neuronal apoptosis inhibitory protein)/// similar to Baculoviral IAP repeat- containing protein 1 (Neuronal apoptosis inhibitory protein) 24 205362_s_at prefoldin NM_002623 5203 gb: NM_002623.2/DEF = Homo sapiens prefoldin 4 subunit 4 (PFDN4), mRNA./FEA = mRNA/GEN = PFDN4/ PROD = prefoldin 4/DB_XREF = gi: 12408676/ UG = Hs.91161 prefoldin 4/FL = gb: NM_002623.2 gb: U41816.1 25 205511_at hypothetical NM_017976 55056 gb: NM_017976.1/DEF = Homo sapiens hypothetical protein protein FLJ10038 (FLJ10038), mRNA./FEA = mRNA/ FLJ10038 GEN = FLJ10038/PROD = hypothetical protein FLJ10038/DB_XREF = gi: 8922197/UG = Hs.181202 hypothetical protein FLJ10038/FL = gb: NM_017976.1 26 205539_at advillin NM_006576 10677 gb: NM_006576.1/DB_XREF = gi: 5729735/GEN = AVIL/ FEA = FLmRNA/CNT = 32/TID = Hs.47344.0/TIER = FL/ STK = 0/UG = Hs.47344/LL = 10677/DEF = Homo sapiens advillin (AVIL), mRNA./ PROD = advillin/FL = gb: AF041449.1 gb: NM_006576.1 27 205681_at BCL2-related NM_004049 597 gb: NM_004049.1/DB_XREF = gi: 4757839/ protein A1 GEN = BCL2A1/FEA = FLmRNA/CNT = 32/ TID = Hs.227817.0/TIER = FL + Stack/STK = 11/ UG = Hs.227817/LL = 597/DEF = Homo sapiens BCL2-related protein A1 (BCL2A1), mRNA./PROD = BCL2-related protein A1/FL = gb: U27467.1 gb: U29680.1 gb: NM_004049.1 28 205741_s_at dystrobrevin, NM_001392 1837 gb: NM_001392.1/DB_XREF = gi: 4503410/ alpha GEN = DTNA/FEA = FLmRNA/CNT = 26/ TID = Hs.54435.0/TIER = FL + Stack/STK = 15/ UG = Hs.54435/LL = 1837/DEF = Homo sapiens dystrobrevin, alpha (DTNA), mRNA./ PROD = dystrobrevin, alpha/FL = gb: NM_001392.1 gb: BC005300.1 29 205871_at plasminogen- BC005379 285189/// gb: BC005379.1/DB_XREF = gi: 13529238/ like B2/// 5342/// FEA = FLmRNA/CNT = 46/TID = Hs.262869.0/TIER = FL/ plasminogen- 5343 STK = 2/UG = Hs.262869/LL = 5342/UG_GENE = PLGL/ like B1/// DEF = Homo sapiens, Similar to plasminogen, clone plasminogen- MGC: 12496, mRNA, complete cds./ PROD = Similar to like A1 plasminogen/FL = gb: NM_002665.1 gb: M93143.2 gb: BC005379.1 30 205888_s_at janus kinase AI962693 9832 Consensus includes gb: AI962693/FEA = EST/ and DB_XREF = gi: 5755406/DB_XREF = est: wq55a09.x1/ microtubule CLONE = IMAGE: 2475160/UG = Hs.43107 KIAA0555 interacting gene product/FL = gb: AB011127.1 gb: NM_014790.1 protein 2 31 206659_at hypothetical NM_025024 80092 gb: NM_025024.1/DB_XREF = gi: 13376542/ protein GEN = FLJ14082/FEA = FLmRNA/CNT = 10/ FLJ14082 TID = Hs.287622.0/TIER = FL/STK = 1/UG = Hs.287622/ LL = 80092/DEF = Homo sapiens hypothetical protein FLJ14082 (FLJ14082), mRNA./PROD = hypothetical protein FLJ14082/FL = gb: NM_025024.1 32 207487_at hypothetical NM_024976 80041 gb: NM_024976.1/DB_XREF = gi: 13376475/ protein GEN = FLJ11996/FEA = FLmRNA/CNT = 4/ FLJ11996 TID = Hs.287473.0/TIER = FL/STK = 0/UG = Hs.287473/ LL = 80041/DEF = Homo sapiens hypothetical protein FLJ11996 (FLJ11996), mRNA./PROD = hypothetical protein FLJ11996/FL = gb: NM_024976.1 33 207598_x_at X-ray repair NM_005431 7516 gb: NM_005431.1/DB_XREF = gi: 4885656/ complementing GEN = XRCC2/FEA = FLmRNA/CNT = 5/ defective TID = Hs.129727.0/TIER = FL/STK = 0/UG = Hs.129727/ repair in LL = 7516/DEF = Homo sapiens X-ray repair Chinese complementing defective repair in Chinese hamster hamster cells 2 cells 2 (XRCC2), mRNA./PROD = X-ray repair cross complementing protein 2/FL = gb: AF035587.1 gb: NM_005431.1 34 207730_x_at Hepatoma- NM_017932 84717 gb: NM_017932.1/DB_XREF = gi: 8923629/ derived GEN = FLJ20700/FEA = FLmRNA/CNT = 3/ growth TID = Hs.272222.0/TIER = FL/STK = 0/UG = Hs.272222/ factor- LL = 55021/DEF = Homo sapiens hypothetical protein related FLJ20700 (FLJ20700), mRNA./PROD = hypothetical protein 2 protein FLJ20700/FL = gb: NM_017932.1 35 207829_s_at BCL2/ NM_013978 662 gb: NM_013978.1/DB_XREF = gi: 7524347/GEN = BNIP1/ adenovirus FEA = FLmRNA/CNT = 4/TID = Hs.77572.2/ E1B 19 kDa TIER = FL/STK = 0/UG = Hs.77572/LL = 662/DEF = interacting Homo sapiens BCL2adenovirus E1B 19 kD-interacting protein 1 protein 1 (BNIP1), transcript variant BNIP1-a, mRNA./ PROD = BCL2adenovirus E1B 19 kD-interacting protein 1, isoform BNIP1-a/FL = gb: NM_013978.1 gb: AF083956.1 36 208154_at mesenchymal NM_016646 51336 gb: NM_016646.1/DB_XREF = gi: 7706197/ stem cell GEN = LOC51336/FEA = FLmRNA/CNT = 2/ protein TID = Hs.272416.0/TIER = FL/STK = 0/UG = Hs.272416/ DSCD28 LL = 51336/DEF = Homo sapiens mesenchymal stem cell protein DSCD28 (LOC51336), mRNA./ PROD = mesenchymal stem cell protein DSCD28/ FL = gb: NM_016646.1 gb: AF242772.1 37 208185_x_at gb: NM_016415.1/ NM_016415 gb: NM_016415.1/DB_XREF = gi: 10047109/ DB_XREF = GEN = LOC51216/FEA = FLmRNA/CNT = 2/ gi: 10047109/ TID = Hs.277887.0/TIER = ConsEnd/STK = 0/ GEN = LOC51216/ UG = Hs.277887/LL = 51216/DEF = Homo sapiens FEA = FLmRNA/ clone FLB3816 (LOC51216), mRNA./PROD = clone CNT = 2/ FLB3816/FL = gb: NM_016415.1 gb: AF113685.1 TID = Hs.277887.0/ TIER = ConsEnd/ STK = 0/ UG = Hs.277887/ LL = 51216/ DEF = Homo sapiens clone FLB3816 (LOC51216), mRNA./ PROD = clone FLB3816/ FL = gb: NM_016415.1 gb: AF113685.1 38 208238_x_at gb: NM_013344.1/ NM_013344 gb: NM_013344.1/DB_XREF = gi: 7106350/ GEN = LZLP/ DB_XREF = FEA = FLmRNA/CNT = 2/TID = Hs.278952.0/TIER = FL/ gi: 7106350/ STK = 0/UG = Hs.278952/LL = 29932/DEF = GEN = LZLP/ Homo sapiens leucine zipper-like protein (LZLP), FEA = FLmRNA/ mRNA./PROD = leucine zipper-like protein/ CNT = 2/ FL = gb: NM_013344.1 gb: AF159055.1 TID = Hs.278952.0/ TIER = FL/ STK = 0/ UG = Hs.278952/ LL = 29932/ DEF = Homo sapiens leucine zipper-like protein (LZLP), mRNA./ PROD = leucine zipper-like protein/FL = gb: NM_013344.1 gb: AF159055.1 39 208386_x_at DMC1 dosage NM_007068 11144 gb: NM_007068.1/DB_XREF = gi: 5901995/ suppressor of GEN = DMC1/FEA = FLmRNA/CNT = 4/TID = Hs.37181.0/ mck1 homolog, TIER = FL/STK = 0/UG = Hs.37181/LL = 11144/ meiosis-specific DEF = Homo sapiens DMC1 (dosage suppressor of homologous mck1, yeast homolog) meiosis-specific homologous recombination recombination (DMC1), mRNA./PROD = DMC1 (yeast) (dosage suppressor of mck1, yeast homolog)meiosis- specific homologous recombination/ FL = gb: NM_007068.1 gb: D64108.1 gb: D63882.1 40 208498_s_at amylase, alpha 1A; NM_004038 276/// gb: NM_004038.1/DB_XREF = gi: 4757749/ salivary/// 277/// GEN = AMY1A/FEA = FLmRNA/CNT = 2/ amylase, alpha 1B; 278/// TID = Hs.274376.0/TIER = FL/STK = 0/UG = Hs.274376/ salivary/// 279/// LL = 276/DEF = Homo sapiens amylase, alpha 1A; amylase, alpha 1C; 280/// salivary (AMY1A), mRNA./PROD = amylase, alpha 1A; salivary/// 647537/// salivary/FL = gb: NM_004038.1 amylase, alpha 2A; 648759 pancreatic/// amylase, alpha 2B (pancreatic)/// similar to Pancreatic alpha-amylase precursor (PA) (1,4-alpha-D-glucan glucanohydrolase)/// similar to Salivary alpha-amylase precursor (1,4-alpha-D-glucan glucanohydrolase) 41 208760_at Ubiquitin-conjugating AL031714 7329 gb: AL031714/DB_XREF = gi: 4775608/FEA = FLmRNA/ enzyme E2I (UBC9 CNT = 328/TID = Hs.84285.0/TIER = Stack/STK = 30/ homolog, yeast) UG = Hs.84285/LL = 7329/UG_GENE = UBE2I/ UG_TITLE = ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9)/DEF = Human DNA sequence from clone LA16-358B7 on chromosome 16 Contains the UBE21 gene for ubiquitin- conjugating enzyme E2I (homologous to yeast UBC9), and an RPS20 (40S Ribosomal protein S20) pseudogene. Contains ESTs, STSs. GSSs and a putative CpG is . . ./FL = gb: U31933.1 gb: U66867.1 gb: U38785.1 gb: U66818.1 gb: NM_003345.1 gb: BC000427.1 gb: BC004429.1 gb: U31882.1 gb: U45328.1 gb: U29092.1 42 209006_s_at chromosome AF247168 57035 gb: AF247168.1/DB_XREF = gi: 12005626/ 1 open GEN = NPD014/FEA = FLmRNA/CNT = 237/ reading frame TID = Hs.8084.0/TIER = FL + Stack/STK = 13/ 63 UG = Hs.8084/LL = 57035/DEF = Homo sapiens NPD014 (NPD014) mRNA, complete cds./ PROD = NPD014/ FL = gb: AF247168.1 gb: AF267856.1 43 209012_at triple AV718192 7204 gb: AV718192/DB_XREF = gi: 10815344/ functional DB_XREF = AV718192/CLONE = FHTAABE08/ domain FEA = FLmRNA/CNT = 235/TID = Hs.171957.1/ (PTPRF TIER = Stack/STK = 47/UG = Hs.171957/LL = 7204/ interacting) UG_GENE = TRIO/UG_TITLE = triple functional domain (PTPRF interacting)/FL = gb: AF091395.1 44 209531_at glutathione BC001453 2954 gb: BC001453.1/DB_XREF = gi: 12655190/ transferase FEA = FLmRNA/ CNT = 127/TID = Hs.26403.0/ zeta 1 TIER = FL + Stack/STK = 54/ (maleylacetoacetate UG = Hs.26403/LL = 2954/UG_GENE = GSTZ1/ isomerase) DEF = Homo sapiens, glutathione transferase zeta 1 (maleylacetoacetate isomerase), clone MGC: 2029, mRNA, complete cds./ PROD = glutathione transferase zeta 1(maleylacetoacetate isomerase)/ FL = gb: NM_001513.1 gb: BC001453.1 gb: U86529.1 45 209689_at coiled-coil BC005078 54520 gb: BC005078.1/DB_XREF = gi: 13477224/ domain FEA = FLmRNA/CNT = 76/TID = Hs.26118.0/ containing 93 TIER = FL + Stack/STK = 41/UG = Hs.26118 /DEF = Homo sapiens, clone MGC: 13033, mRNA, complete cds./PROD = Unknown (protein for MGC: 13033)/FL = gb: BC005078.1 46 209714_s_at cyclin- AF213033 1033 gb: AF213033.1/DB_XREF = gi: 12734643/ dependent FEA = FLmRNA/CNT = 87/TID = Hs.84113.0/TIER = FL/ kinase STK = 0/UG = Hs.84113/LL = 1033/UG_GENE = CDKN3/ inhibitor 3 DEF = Homo sapiens isolate BX-01 cyclin-dependent (CDK2- kinase associated protein phosphatase mRNA, associated complete cds./PROD = cyclin-dependent kinase dual associated proteinphosphatase/FL = gb: L27711.1 specificity gb: L25876.1 gb: AF213037.1 gb: AF213041.1 phosphatase) gb: AF213052.1 gb: AF213033.1 gb: AF213039.1 gb: AF213036.1 gb: AF213046.1 gb: AF213053.1 gb: AF213040.1 gb: AF213048.1 gb: AF213044.1 gb: AF213049.1 gb: AF213042.1 gb: AF213051.1 gb: AF213038.1 gb: AF213047.1 gb: AF213050.1 gb: AF213034.1 gb: AF213035.1 gb: NM_005192.1 gb: U02681.1 47 209907_s_at intersectin 2 AF182198 50618 gb: AF182198.1/DB_XREF = gi: 7329075/GEN = ITSN2/ FEA = FLmRNA/CNT = 34/TID = Hs.166184.2/TIER = FL/ STK = 4/UG = Hs.166184/LL = 50618/DEF = Homo sapiens intersectin 2 long isoform (ITSN2) mRNA, complete cds./PROD = intersectin 2 long isoform/ FL = gb: AF182198.1 48 210528_at major AF010447 3140 gb: AF010447.1/DB_XREF = gi: 4102223/GEN = MR1C/ histocompatibility FEA = FLmRNA/CNT = 4/TID = Hs.101840.2/TIER = FL/ complex, STK = 2/UG = Hs.101840/LL = 3140/DEF = class I-related Homo sapiens MHC class I related protein 1 isoform C (MR1C) mRNA, complete cds./PROD = MHC class I related protein 1 isoform C/FL = gb: AF010447.1 49 210534_s_at B9 protein BC002944 27077 gb: BC002944.1/DB_XREF = gi: 12804172/ FEA = FLmRNA/CNT = 4/TID = Hs.11955.1/TIER = FL/ STK = 0/UG = Hs.11955/LL = 27077/UG_GENE = B9/ DEF = Homo sapiens, Similar to B9 protein, clone MGC: 11339, mRNA, complete cds./PROD = Similar to B9 protein/FL = gb: BC002944.1 50 210598_at gb: AF130051.1/ AF130051 gb: AF130051.1/DEF = Homo sapiens clone FLB3535 DEF = PRO0898 mRNA, complete cds./FEA = mRNA/ Homo sapiens PROD = PRO0898/DB_XREF = gi: 11493408/ clone UG = Hs.306960 Homo sapiens clone FLB3535 FLB3535 PRO0898 mRNA, complete cds/FL = gb: AF130051.1 PRO0898 mRNA, complete cds./ FEA = mRNA/ PROD = PRO0898/ DB_XREF = gi: 11493408/ UG = Hs.306960 Homo sapiens clone FLB3535 PRO0898 mRNA, complete cds/ FL = gb: AF130051.1 51 210892_s_at general BC004472 2969 gb: BC004472.1/DB_XREF = gi: 13325321/ transcription FEA = FLmRNA/CNT = 2/TID = Hs.278589.2/ factor II, i TIER = FL/STK = 0/UG = Hs.278589/LL = 2969/ UG_GENE = GTF2I/DEF = Homo sapiens, Similar to general transcription factor II, i, clone MGC: 10428, mRNA, complete cds./PROD = Similar to general transcription factor II, i/FL = gb: BC004472.1 52 211114_x_at survival of AB037702 8487 gb: AB037702.1/DEF = Homo sapiens SIP1-gamma motor neuron mRNA for SMN interacting protein 1-gamma, protein complete cds./FEA = mRNA/GEN = SIP1-gamma/ interacting PROD = SMN interacting protein 1-gamma/ protein 1 DB_XREF = gi: 9650994/UG = Hs.102456 survival of motor neuron protein interacting protein 1/ FL = gb: AB037702.1 53 211115_x_at survival of AB037703 8487 gb: AB037703.1/DEF = Homo sapiens SIP1-delta mRNA motor neuron for SMN interacting protein 1-delta, complete protein cds./FEA = mRNA/GEN = SIP1-delta/PROD = SMN interacting interacting protein 1-delta/DB_XREF = gi: 9650996/ protein 1 UG = Hs.102456 survival of motor neuron protein interacting protein 1/FL = gb: AB037703.1 54 211302_s_at phosphodiesterase L20966 5142 gb: L20966.1/DEF = Human phosphodiesterase 4B, cAMP-specific mRNA, complete cds./FEA = mRNA/ (phosphodiesterase PROD = phosphodiesterase/DB_XREF = gi: 347121/ E4 dunce homolog, UG = Hs.188 phosphodiesterase 4B, cAMP-specific Drosophila) (dunce (Drosophila)-homolog phosphodiesterase E4)/ FL = gb: L20966.1 55 211732_x_at histamine N- BC005907 3176 gb: BC005907.1/DB_XREF = gi: 13543496/ methyltransferase/// FEA = FLmRNA/CNT = 1/TID = HsAffx.900754.434/ histamine N- TIER = FL/STK = 0/DEF = Homo sapiens, Similar to methyltransferase histamine N-methyltransferase, clone MGC: 14500, mRNA, complete cds./PROD = Similar to histamine N- methyltransferase/FL = gb: BC005907.1 56 211796_s_at T cell receptor AF043179 28566/// gb: AF043179.1/DB_XREF = gi: 3002924/ beta variable 28568/// GEN = TCRBV13S1-TCRBJ2S1/FEA = FLmRNA/CNT = 3/ 21-1/// T cell 28611/// TID = Hs.303157.6/TIER = FL/STK = 0/UG = Hs.303157/ receptor beta 28619/// LL = 6957/DEF = Homo sapiens T cell receptor beta variable 19/// 28639/// chain (TCRBV13S1-TCRBJ2S1) mRNA, complete cds./ T cell receptor 647353 PROD = T cell receptor beta chain/ beta variable FL = gb: AF043179.1 5-4/// T cell receptor beta variable 3-1/// T cell receptor beta constant 1/// similar to T-cell receptor beta chain V region CTL-L17 precursor 57 211809_x_at collagen, type M59217 1305 gb: M59217.1/DEF = Human collagen type XIII alpha-1 XIII, alpha 1 mRNA, complete cds./FEA = CDS/GEN = COL13A1/ PROD = alpha-1 type XIII collagen/ DB_XREF = gi: 178319/UG = Hs.211933 collagen, type XIII, alpha 1/FL = gb: M59217.1 58 211929_at heterogeneous BF195526 220988 Consensus includes gb: AA527502/FEA = EST/ nuclear DB_XREF = gi: 2269571/DB_XREF = est: ng41f10.s1/ ribonucleoprotein CLONE = IMAGE: 937387/UG = Hs.249247 A3 heterogeneous nuclear protein similar to rat helix destabilizing protein 59 211980_at collagen, type AI922605 1282 gb: AI922605/DB_XREF = gi: 5658569/ IV, alpha 1 DB_XREF = wm90c05.x1/CLONE = IMAGE: 2443208/ FEA = FLmRNA/CNT = 492/TID = Hs.119129.0/ TIER = Stack/STK = 55/UG = Hs.119129/LL = 1282/ UG_GENE = COL4A1/UG_TITLE = collagen, type IV, alpha 1/FL = gb: NM_001845.1 60 212156_at vacuolar AA812224 23339 gb: AA812224/DB_XREF = gi: 2881835/ protein sorting DB_XREF = ob84g11.s1/CLONE = IMAGE: 1338116/ 39 (yeast) FEA = mRNA/CNT = 170/TID = Hs.9452.0/TIER = Stack/ STK = 11/UG = Hs.9452/LL = 23339/ UG_GENE = KIAA0770/UG_TITLE = KIAA0770 protein 61 212162_at kinase AK022873 57498 gb: AK022873.1/DB_XREF = gi: 10434518/ D-interacting FEA = mRNA/CNT = 204/TID = Hs.9873.0/TIER = Stack/ substance of STK = 11/UG = Hs.9873/LL = 57498/ 220 kDa UG_GENE = KIAA1250/UG_TITLE = likely homolog of rat kinase D-interacting substance of 220 kDa; KIAA1250 protein/DEF = Homo sapiens cDNA FLJ12811 fis, clone NT2RP2002475. 62 212248_at CDNA FLJ41088 AI886796 92140 gb: AI886796/DB_XREF = gi: 5591960/ fis, clone DB_XREF = wk20b07.x1/CLONE = IMAGE: 2412853/ ASTRO2002459/// FEA = mRNA/CNT = 189/TID = Hs.243901.0/ Metadherin TIER = Stack/STK = 19/UG = Hs.243901/ UG_TITLE = Homo sapiens cDNA FLJ20738 fis, clone HEP08257 63 212538_at dedicator of AL576253 23348 Consensus includes gb: AL576253/FEA = EST/ cytokinesis 9 DB_XREF = gi: 12938214/DB_XREF = est: AL576253/ CLONE = CS0DI073YM22 (3 prime)/UG = Hs.8021 KIAA1058 protein 64 212556_at scribbled AI469403 23513 gb: AI469403/DB_XREF = gi: 4331493/ homolog DB_XREF = tm08c12.x1/CLONE = IMAGE: 2155990/ (Drosophila) FEA = mRNA/CNT = 120/TID = Hs.239784.0/ TIER = Stack/STK = 50/UG = Hs.239784/LL = 23513/ UG_GENE = KIAA0147/UG_TITLE = human homolog of Drosophila Scribble 65 212655_at zinc finger, AB011151 23174 gb: AB011151.1/DB_XREF = gi: 3043681/ CCHC domain GEN = KIAA0579/FEA = mRNA/CNT = 135/ containing 14 TID = Hs.81505.0/TIER = Stack/STK = 51/ UG = Hs.81505/LL = 23174/DEF = Homo sapiens mRNA for KIAA0579 protein, partial cds./ PROD = KIAA0579 protein 66 212672_at ataxia U82828 472 gb: U82828/DB_XREF = gi: 2304970/FEA = mRNA/ telangiectasia CNT = 113/TID = Hs.194382.2/TIER = Stack/STK = 42/ mutated UG = Hs.194382/LL = 472/UG_GENE = ATM/ (includes UG_TITLE = ataxia telangiectasia mutated (includes complementation complementation groups A, C and D)/DEF = groups A, C Homo sapiens ataxia telangiectasia (ATM) gene, complete and D) cds 67 212921_at SET and MYND AF070592 56950 Consensus includes gb: AF070592.1/DEF = domain Homo sapiens clone 24503 mRNA sequence./FEA = mRNA/ containing 2 DB_XREF = gi: 3387967/UG = Hs.66170 HSKM-B protein 68 213383_at Full-length AW593269 Consensus includes gb: AW593269/FEA = EST/ cDNA clone DB_XREF = gi: 7280527/DB_XREF = est: hg11h06.x1/ CS0DF026YC16 CLONE = IMAGE: 2945339/UG = Hs.296406 KIAA0685 of Fetal brain of gene product Homo sapiens (human) 69 213478_at kazrin AB028949 23254 gb: AB028949.1/DB_XREF = gi: 5689388/ GEN = KIAA1026/FEA = mRNA/CNT = 40/ TID = Hs.27742.0/TIER = Stack/STK = 23/ UG = Hs.27742/LL = 23254/DEF = Homo sapiens mRNA for KIAA1026 protein, partial cds./ PROD = KIAA1026 protein 70 214005_at gamma- BE326952 2677 gb: BE326952/DB_XREF = gi: 9200728/ glutamyl DB_XREF = hr68a04.x1/CLONE = IMAGE: 3133614/ carboxylase FEA = EST/CNT = 23/TID = Hs.77719.1/TIER = Stack/ STK = 18/UG = Hs.77719/LL = 2677/UG_GENE = GGCX/ UG_TITLE = gamma-glutamyl carboxylase 71 214097_at ribosomal AW024383 6227 gb: AW024383/DB_XREF = gi: 5877913/ protein S21 DB_XREF = wv03e06.x1/CLONE = IMAGE: 2528482/ FEA = EST/CNT = 16/TID = Hs.1948.1/TIER = Stack/ STK = 8/UG = Hs.1948/LL = 6227/UG_GENE = RPS21/ UG_TITLE = ribosomal protein S21 72 214415_at plasminogen- N58120 285189 gb: N58120/DB_XREF = gi: 1202010/ like A1 DB_XREF = yv65a07.s1/CLONE = IMAGE: 247572/ FEA = EST/CNT = 20/TID = Hs.262869.1/TIER = Stack/ STK = 11/UG = Hs.262869/LL = 5342/UG_GENE = PLGL/ UG_TITLE = plasminogen-like 73 214670_at zinc finger AA653300 7586 gb: AA653300/DB_XREF = gi: 2589471/ with KRAB DB_XREF = ag65c10.s1/CLONE = IMAGE: 1127826/ and SCAN FEA = mRNA/CNT = 54/TID = Hs.132390.1/ domains 1 TIER = ConsEnd/STK = 1/UG = Hs.132390/LL = 7586/ UG_GENE = ZNF36/UG_TITLE = zinc finger protein 36 (KOX 18) 74 214715_x_at zinc finger AK024789 90338 gb: AK024789.1/DB_XREF = gi: 10437175/ protein 160 FEA = mRNA/CNT = 37/TID = Hs.206882.0/ TIER = ConsEnd/STK = 0/UG = Hs.206882/ UG_TITLE = Homo sapiens mRNA for FLJ00032 protein, partial cds/DEF = Homo sapiens cDNA: FLJ21136 fis, clone CAS07469. 75 214719_at hypothetical AK026720 283537 gb: AK026720.1/DB_XREF = gi: 10439638/ protein FEA = mRNA/CNT = 79/TID = Hs.117167.0/ LOC283537 TIER = ConsEnd/STK = 0/UG = Hs.117167/ UG_TITLE = Homo sapiens cDNA: FLJ23067 fis, clone LNG04993/DEF = Homo sapiens cDNA: FLJ23067 fis, clone LNG04993. 76 214753_at Phosphonoformate AW084068 10443 gb: AW084068/DB_XREF = gi: 6039220/ immuno-associated DB_XREF = xc26c06.x1/CLONE = IMAGE: 2585386/ protein 5 FEA = mRNA/CNT = 22/TID = Hs.110630.0/ TIER = ConsEnd/STK = 1/UG = Hs.110630/ UG_TITLE = Human BRCA2 region, mRNA sequence CG006 77 214778_at multiple AB011541 1954 Consensus includes gb: AB011541.1/DEF = EGF-like- Homo sapiens mRNA for MEGF8, partial cds./FEA = mRNA/ domains 8 GEN = MEGF8/PROD = MEGF8/DB_XREF = gi: 3449307/UG = Hs.158200 EGF-like-domain, multiple 4 78 214808_at MRNA; cDNA AU147851 gb: AU147851/DB_XREF = gi: 11009372/ DKFZp762N156 DB_XREF = AU147851/CLONE = MAMMA1001878/ (from clone FEA = mRNA/CNT = 19/TID = Hs.183819.0/ DKFZp762N156) TIER = ConsEnd/STK = 1/UG = Hs.183819/ UG_TITLE = Homo sapiens cDNA FLJ12304 fis, clone MAMMA1001878 79 214829_at aminoadipate- AK023446 10157 gb: AK023446.1/DB_XREF = gi: 10435383/FEA = mRNA/ semialdehyde CNT = 18/TID = Hs.323091.0/TIER = ConsEnd/STK = 0/ synthase UG = Hs.323091/UG_TITLE = Homo sapiens cDNA FLJ13384 fis, clone PLACE1001062, highly similar to Homo sapiens mRNA for lysine-ketoglutarate reductasesaccharopine dehydrogenase/DEF = Homo sapiens cDNA FLJ13384 fis, clone PLACE1001062, highly similar to Homo sapiens mRNA for lysine-ketoglutarate reductasesaccharopine dehydrogenase. 80 214917_at protein kinase, AK024252 5562 gb: AK024252.1/DB_XREF = gi: 10436581/ AMP-activated, FEA = mRNA/CNT = 9/TID = Hs.288546.0/ alpha 1 TIER = ConsEnd/STK = 0/UG = Hs.288546/ catalytic subunit UG_TITLE = Homo sapiens cDNA FLJ14190 fis, clone NT2RP2006534, moderately similar to 5-AMP-ACTIVATED PROTEIN KINASE, CATALYTIC ALPHA-1 CHAIN (EC 2.7.1.)/DEF = Homo sapiens cDNA FLJ14190 fis, clone NT2RP2006534, moderately similar to 5-AMP-ACTIVATED PROTEIN KINASE, CATALYTIC ALPHA-1 CHAIN (EC 2.7.1.). 81 215067_x_at peroxiredoxin 2 AU147942 7001 Consensus includes gb: AU147942/FEA = EST/ DB_XREF = gi: 11009463/DB_XREF = est: AU147942/ CLONE = MAMMA1002198/ UG = Hs.287517 Homo sapiens cDNA FLJ12333 fis, clone MAMMA1002198, highly similar to THIOREDOXIN PEROXIDASE 1 82 215233_at phosphatidylserine AA351360 23210 Consensus includes gb: AA351360/FEA = EST/ receptor DB_XREF = gi: 2003690/DB_XREF = est: EST59093/ UG = Hs.72660 phosphatidylserine receptor 83 215268_at hypothetical AW663712 643314 Consensus includes gb: AW663712/FEA = EST/ LOC643314 DB_XREF = gi: 7456250/DB_XREF = est: hj12e06.x1/ CLONE = IMAGE: 2981602/UG = Hs.159183 KIAA0754 protein 84 215287_at ELISC-1 AA975427 Consensus includes gb: AA975427/FEA = EST/ DB_XREF = gi: 3151219/DB_XREF = est: oq28g02.s1/ CLONE = IMAGE: 1587698/UG = Hs.128434 Homo sapiens ELISC-1 mRNA, partial cds 85 215314_at Ankyrin 3, AU146646 288 Consensus includes gb: AU146646/FEA = EST/ node of DB_XREF = gi: 11008167/DB_XREF = est: AU146646/ Ranvier CLONE = HEMBB1001096/UG = Hs.179752 (ankyrin G) Homo sapiens cDNA FLJ10270 fis, clone HEMBB1001096 86 215359_x_at zinc finger AI758888 51710 Consensus includes gb: AI758888/FEA = EST/ protein 44 DB_XREF = gi: 5152613/DB_XREF = est: ty94c12.x1/ CLONE = IMAGE: 2286742/UG = Hs.278480 zinc finger protein 44 (KOX 7) 87 215385_at Fatso AK022473 79068 Consensus includes gb: AK022473.1/ DEF = Homo sapiens cDNA FLJ12411 fis, clone MAMMA1002964./FEA = mRNA/DB_XREF = gi: 10433882/UG = Hs.296722 Homo sapiens cDNA FLJ12411 fis, clone MAMMA1002964 88 215447_at Consensus includes AL080215 Consensus includes gb: AL080215.1/DEF = gb: AL080215.1/ Homo sapiens mRNA; cDNA DKFZp586J0323 (from clone DEF = DKFZp586J0323)./FEA = mRNA/ Homo sapiens DB_XREF = gi: 5262706/UG = Hs.102301 Homo sapiens mRNA; cDNA mRNA; cDNA DKFZp586J0323 (from clone DKFZp586J0323 DKFZp586J0323) (from clone DKFZp586J0323)./ FEA = mRNA/ DB_XREF = gi: 5262706/ UG = Hs.102301 Homo sapiens mRNA; cDNA DKFZp586J0323 (from clone DKFZp586J0323) 89 215595_x_at Glucosaminyl AK023918 2651 Consensus includes gb: AK023918.1/DEF = (N-acetyl) Homo sapiens cDNA FLJ13856 fis, clone THYRO1000988./ transferase 2, FEA = mRNA/DB_XREF = gi: 10436003/ I-branching UG = Hs.288489 Homo sapiens cDNA FLJ13856 fis, enzyme clone THYRO1000988 (I blood group) 90 215599_at SMA4/// region X83300 11039/// Consensus includes gb: X83300.1/ containing SMA4; 643367/// DEF = H. sapiens SMA4 mRNA./FEA = mRNA/ hypothetical 643373/// GEN = SMA4/DB_XREF = gi: 603028/ protein 652924/// UG = Hs.289103 SMA4 LOC153561/// 653869 region containing hypothetical protein LOC153561; SMA4/// SMA4/// similar to Beta- glucuronidase precursor 91 215648_at NudC AU144324 23386 Consensus includes gb: AU144324/FEA = EST/ domain DB_XREF = gi: 11005845/DB_XREF = est: AU144324/ containing 3 CLONE = HEMBA1001570/UG = Hs.306599 Homo sapiens cDNA FLJ11461 fis, clone HEMBA1001570 92 215907_at BTB and CNC AK027193 60468 Consensus includes gb: AK027193.1/DEF = homology 1, Homo sapiens cDNA: FLJ23540 fis, clone LNG08239./ basic leucine FEA = mRNA/DB_XREF = gi: 10440262/ zipper UG = Hs.293931 Homo sapiens cDNA: FLJ23540 fis, transcription clone LNG08239 factor 2 93 216187_x_at Kinesin 2 AF222691 3831 Consensus includes gb: AF222691.1/DEF = Homo sapiens Alu repeat (LNX1) mRNA sequence./ FEA = mRNA/DB_XREF = gi: 12655850/UG = Hs.307008 Homo sapiens Alu repeat (LNX1) mRNA sequence 94 216527_at HLA AL049252 414777 Consensus includes gb: AL049252.1/DEF = complex Homo sapiens mRNA; cDNA DKFZp564D193 (from clone group 18 DKFZp564D193)./FEA = mRNA/DB_XREF = gi: 4499993/UG = Hs.302048 Homo sapiens mRNA; cDNA DKFZp564D193 (from clone DKFZp564D193) 95 216698_x_at olfactory receptor, AF065854 26628/// Consensus includes gb: AF065854/DEF = Homo sapiens family 7, 26636/// OR7E12P pseudogene, complete sequence/ subfamily E, 390885/// FEA = CDS/DB_XREF = gi: 3831591/UG = Hs.120017 member 47 391632/// olfactory receptor, family 7, subfamily E, member 12 pseudogene/// 441453 pseudogene olfactory receptor, family 7, subfamily E, member 37 pseudogene/// olfactory receptor, family 7, subfamily E, member 18 pseudogene/// olfactory receptor, family 7, subfamily E, member 35 pseudogene/// similar to olfactory receptor, family 7, subfamily A, member 17 96 216751_at CMT1A duplicated AK024879 284040 Consensus includes gb: AK024879.1/DEF = region transcript 4 Homo sapiens cDNA: FLJ21226 fis, clone COL00721./ FEA = mRNA/DB_XREF = gi: 10437291/UG = Hs.306715 Homo sapiens cDNA: FLJ21226 fis, clone COL00721 97 216859_x_at Consensus includes AL080112 Consensus includes gb: AL080112.1/DEF = gb: AL080112.1/ Homo sapiens mRNA; cDNA DKFZp586H0722 (from clone DEF = DKFZp586H0722)./FEA = mRNA/DB_XREF = Homo sapiens gi: 5262539/UG = Hs.332731 Homo sapiens mRNA; mRNA; cDNA cDNA DKFZp586H0722 (from clone DKFZp586H0722) DKFZp586H0722 (from clone DKFZp586H0722)./ FEA = mRNA/ DB_XREF = gi: 5262539/ UG = Hs.332731 Homo sapiens mRNA; cDNA DKFZp586H0722 (from clone DKFZp586H0722) 98 217191_x_at Consensus includes AF042163 Consensus includes gb: AF042163/DEF = Homo sapiens gb: AF042163/ cytochrome c oxidase subunit VIc (COX6CP1) DEF = pseudogene, complete sequence/FEA = CDS/ Homo sapiens DB_XREF = gi: 3861484/UG = Hs.248205 cytochrome c cytochrome c oxidase subunit VIc pseudogene 1 oxidase subunit VIc (COX6CP1) pseudogene, complete sequence/ FEA = CDS/ DB_XREF = gi: 3861484/ UG = Hs.248205 cytochrome c oxidase subunit VIc pseudogene 1 99 217477_at phosphatidylinositol- U78581 8395 Consensus includes gb: U78581.1/DEF = Human type I 4-phosphate phosphatidylinositol-4-phosphate 5-kinase beta 5-kinase, type I, (STM7) mRNA, partial cds./FEA = mRNA/GEN = STM7/ beta PROD = type I phosphatidylinositol-4-phosphate 5-kinasebeta/DB_XREF = gi: 1743882/UG = Hs.78406 phosphatidylinositol-4-phosphate 5-kinase, type I, beta 100 217503_at Consensus includes AA203487 Consensus includes gb: AA203487/FEA = EST/ gb: AA203487/ DB_XREF = gi: 1799460/DB_XREF = est: zx53d03.r1/ FEA = EST/ CLONE = IMAGE: 446213/UG = Hs.314363 ESTs DB_XREF = gi: 1799460/ DB_XREF = est: zx53d03.r1/ CLONE = IMAGE: 446213/ UG = Hs.314363 ESTs 101 217536_x_at Transcribed locus M78162 Consensus includes gb: M78162/FEA = EST/ DB_XREF = gi: 273899/DB_XREF = est: EST01755/ CLONE = HHCPN60/UG = Hs.314534 ESTs, Moderately similar to ALU5_HUMAN ALU SUBFAMILY SC SEQUENCE CONTAMINATION WARNING ENTRY H. sapiens 102 217586_x_at Consensus includes N35922 Consensus includes gb: N35922/FEA = EST/ gb: N35922/ DB_XREF = gi: 1157064/DB_XREF = est: yy28g05.s1/ FEA = EST/ CLONE = IMAGE: 272600/UG = Hs.269852 ESTs, DB_XREF = Weakly similar to ALU1_HUMAN ALU SUBFAMILY J gi: 1157064/ SEQUENCE CONTAMINATION WARNING ENTRY DB_XREF = est: H. sapiens yy28g05.s1/ CLONE = IMAGE: 272600/ UG = Hs.269852 ESTs, Weakly similar to ALU1_HUMAN ALU SUBFAMILY J SEQUENCE CONTAMINATION WARNING ENTRY H. sapiens 103 217610_at hypothetical AL047879 641807 Consensus includes gb: AL047879/FEA = EST/ protein DB_XREF = gi: 4728067/ LOC641807 DB_XREF = est: DKFZp586N1222_s1/ CLONE = DKFZp586N1222/UG = Hs.194251 ESTs, Weakly similar to ALU2_HUMAN ALU SUBFAMILY SB SEQUENCE CONTAMINATION WARNING ENTRY H. sapiens 104 217653_x_at similar to AW150065 653471/// Consensus includes gb: AW150065/FEA = EST/ Ribosome 654000 DB_XREF = gi: 6197971/DB_XREF = est: xg48a10.x1/ biogenesis CLONE = IMAGE: 2630778/UG = Hs.271957 ESTs protein BMS1 homolog/// similar to Ribosome biogenesis protein BMS1 homolog 105 217679_x_at Consensus includes AI683552 Consensus includes gb: AI683552/FEA = EST/ gb: AI683552/ DB_XREF = gi: 4893734/DB_XREF = est: tx67h02.x1/ FEA = EST/ CLONE = IMAGE: 2274675/UG = Hs.201605 ESTs, DB_XREF = Moderately similar to ALU8_HUMAN ALU SUBFAMILY gi: 4893734/ SX SEQUENCE CONTAMINATION WARNING ENTRY DB_XREF = est: H. sapiens tx67h02.x1/ CLONE = IMAGE: 2274675/ UG = Hs.201605 ESTs, Moderately similar to ALU8_HUMAN ALU SUBFAMILY SX SEQUENCE CONTAMINATION WARNING ENTRY H. sapiens 106 218078_s_at zinc finger, NM_016598 51304 gb: NM_016598.1/DEF = Homo sapiens DHHC1 protein DHHC-type (LOC51304), mRNA./FEA = mRNA/GEN = LOC51304/ containing 3 PROD = DHHC1 protein/DB_XREF = gi: 7706132/ UG = Hs.14896 DHHC1 protein/FL = gb: AF247703.1 gb: NM_016598.1 107 218609_s_at nudix NM_001161 318 gb: NM_001161.1/DEF = Homo sapiens nudix (nucleoside (nucleoside diphosphate linked moiety X)-type motif diphosphate 2 (NUDT2), mRNA./FEA = mRNA/GEN = NUDT2/ linked PROD = nudix (nucleoside diphosphate linked moiety X)- moietyX)-type motif 2/DB_XREF = gi: 4502124/ type motif 2 UG = Hs.14142 nudix (nucleoside diphosphate linked moiety X)-type motif 2/FL = gb: BC004926.1 gb: NM_001161.1 108 219117_s_at FK506 NM_016594 51303 gb: NM_016594.1/DEF = Homo sapiens FK506 binding binding protein precursor (LOC51303), mRNA./FEA = mRNA/ protein GEN = LOC51303/PROD = FK506 binding protein 11, 19 kDa precursor/DB_XREF = gi: 7706130/UG = Hs.24048 FK506 binding protein precursor/FL = gb: AF238079.1 gb: NM_016594.1 109 219186_at zinc finger NM_020224 51341 gb: NM_020224.1/DEF = Homo sapiens hypothetical and BTB protein DKFZp547O146 (DKFZp547O146), mRNA./ domain FEA = mRNA/GEN = DKFZp547O146/ containing 7A PROD = hypothetical protein DKFZp547O146/ DB_XREF = gi: 9910203/UG = Hs.91246 hypothetical protein DKFZp547O146/FL = gb: NM_020224.1 110 219232_s_at egl nine NM_022073 112399 gb: NM_022073.1/DEF = Homo sapiens hypothetical homolog 3 protein FLJ21620 (FLJ21620), mRNA./FEA = mRNA/ (C. elegans) GEN = FLJ21620/PROD = hypothetical protein FLJ21620/DB_XREF = gi: 11545786/UG = Hs.18878 hypothetical protein FLJ21620/FL = gb: NM_022073.1 111 219555_s_at chromosome NM_018455 55839 gb: NM_018455.1/DEF = Homo sapiens 16 open uncharacterized bone marrow protein BM039 reading (BM039), mRNA./FEA = mRNA/GEN = BM039/ frame 60 PROD = uncharacterized bone marrow protein BM039/DB_XREF = gi: 8922096/UG = Hs.283532 uncharacterized bone marrow protein BM039/ FL = gb: AF217515.1 gb: NM_018455.1 112 219610_at Rho-guanine NM_022448 64283/// gb: NM_022448.1/DEF = Homo sapiens hypothetical nucleotide 643607 protein FLJ21817 similar to Rhoip2 (FLJ21817), exchange mRNA./FEA = mRNA/GEN = FLJ21817/ factor/// PROD = hypothetical protein FLJ21817 similar to similar to Rhoip2/DB_XREF = gi: 11967978/UG = Hs.33254 Rho-guanine hypothetical protein FLJ21817 similar to Rhoip2/ nucleotide FL = gb: NM_022448.1 exchange factor (Rho- interacting protein 2) (RhoGEF) (RIP2) 113 219648_at dilute NM_018000 55686 gb: NM_018000.1/DEF = Homo sapiens hypothetical suppressor protein FLJ10116 (FLJ10116), mRNA./FEA = mRNA/ GEN = FLJ10116/PROD = hypothetical protein FLJ10116/ DB_XREF = gi: 8922236/UG = Hs.79741 hypothetical protein FLJ10116/FL = gb: NM_018000.1 114 219751_at SET domain NM_024860 79918 gb: NM_024860.1/DEF = Homo sapiens hypothetical containing 6 protein FLJ21148 (FLJ21148), mRNA./FEA = mRNA/ GEN = FLJ21148/PROD = hypothetical protein FLJ21148/ DB_XREF = gi: 13376287/UG = Hs.193300 hypothetical protein FLJ21148/FL = gb: NM_024860.1 115 219763_at DENN/ NM_024820 57706 gb: NM_024820.1/DEF = Homo sapiens KIAA1608 MADD protein (KIAA1608), mRNA./FEA = mRNA/ domain GEN = KIAA1608/PROD = hypothetical protein containing 1A FLJ21129/DB_XREF = gi: 13449264/UG = Hs.300842 KIAA1608 protein/FL = gb: NM_024820.1 116 220071_x_at centrosomal NM_018097 55142 gb: NM_018097.1/DEF = Homo sapiens hypothetical protein protein FLJ10460 (FLJ10460), mRNA./FEA = mRNA/ 27 kDa GEN = FLJ10460/PROD = hypothetical protein FLJ10460/ DB_XREF = gi: 8922429/UG = Hs.14347 hypothetical protein FLJ10460/FL = gb: NM_018097.1 117 220227_at cadherin 4, NM_024883 1002 gb: NM_024883.1/DEF = Homo sapiens hypothetical type 1, protein FLJ22202 (FLJ22202), mRNA./FEA = mRNA/ R-cadherin GEN = FLJ22202/PROD = hypothetical protein (retinal) FLJ22202/DB_XREF = gi: 13376328/UG = Hs.217754 hypothetical protein FLJ22202/FL = gb: NM_024883.1 118 220327_at vestigial NM_016206 389136 gb: NM_016206.1/DEF = Homo sapiens colon like 3 carcinoma related protein (LOC51159), mRNA./ (Drosophila) FEA = mRNA/GEN = LOC51159/PROD = colon carcinoma related protein/DB_XREF = gi: 7705882/ UG = Hs.23142 colon carcinoma related protein/ FL = gb: AF099505.1 gb: NM_016206.1 119 220374_at BTB (POZ) NM_017658 54813 gb: NM_017658.1/DEF = Homo sapiens hypothetical domain protein FLJ20081 (FLJ20081), mRNA./FEA = mRNA/ containing 5 GEN = FLJ20081/PROD = hypothetical protein FLJ20081/DB_XREF = gi: 8923089/UG = Hs.126219 hypothetical protein FLJ20081/FL = gb: NM_017658.1 120 220575_at family with NM_024974 80039 gb: NM_024974.1/DEF = Homo sapiens hypothetical sequence protein FLJ11800 (FLJ11800), mRNA./FEA = mRNA/ similarity 106, GEN = FLJ11800/PROD = hypothetical protein member A FLJ11800/DB_XREF = gi: 13376473/UG = Hs.287456 hypothetical protein FLJ11800/FL = gb: NM_024974.1 121 220940_at KIAA1641 NM_025190 57730 gb: NM_025190.1/DEF = Homo sapiens KIAA1641 protein (KIAA1641), mRNA./FEA = mRNA/ GEN = KIAA1641/PROD = hypothetical protein FLJ21281/DB_XREF = gi: 13449272/UG = Hs.44566 KIAA1641 protein/FL = gb: NM_025190.1 122 220954_s_at paired NM_013440 29990 gb: NM_013440.1/DEF = Homo sapiens paired immunoglobin- immunoglobulin-like receptor beta (PILR(BETA)), like type mRNA./FEA = mRNA/GEN = PILR(BETA)/ 2 receptor PROD = paired immunoglobulin-like receptor beta/ beta DB_XREF = gi: 7305386/UG = Hs.9408 paired immunoglobulin-like receptor beta/ FL = gb: AF161081.1 gb: NM_013440.1 123 220967_s_at zinc finger NM_030895 79943 gb: NM_030895.1/DEF = Homo sapiens hypothetical protein protein FLJ14129 (FLJ14129), mRNA./FEA = mRNA/ 696/// GEN = FLJ14129/PROD = hypothetical protein zinc finger FLJ14129/DB_XREF = gi: 13569857/ protein 696 FL = gb: NM_030895.1 124 221499_s_at syntaxin 16 AK026970 8675 Consensus includes gb: AK026970.1/DEF = Homo sapiens cDNA: FLJ23317 fis, clone HEP12062, highly similar to AF008936 Homo sapiens syntaxin-16B mRNA./FEA = mRNA/DB_XREF = gi: 10439960/ UG = Hs.102178 syntaxin 16/FL = gb: AF008936.1 125 221531_at WD repeat AF309553 80349 gb: AF309553.1/DEF = Homo sapiens meiotic domain 61 recombination protein REC14 mRNA, complete cds./ FEA = mRNA/PROD = meiotic recombination protein REC14/DB_XREF = gi: 11139241/UG = Hs.296242 recombination protein REC14/FL = gb: AF309553.1 gb: NM_025234.1 126 221879_at calmodulin- AA886335 91860 Consensus includes gb: AA886335/FEA = EST/ like 4 DB_XREF = gi: 3001443/DB_XREF = est: oj23g02.s1/ CLONE = IMAGE: 1493042/UG = Hs.239812 Homo sapiens serologically defined breast cancer antigen NY-BR-20 mRNA, partial cds 127 222104_x_at general AI569458 2967 Consensus includes gb: AI569458/FEA = EST/ transcription DB_XREF = gi: 4532832/DB_XREF = est: tn87c02.x1/ factor IIH, CLONE = IMAGE: 2176514/UG = Hs.90304 general polypeptide 3, transcription factor IIH, polypeptide 3 (34 kD subunit)/ 34 kDa FL = gb: NM_001516.1 128 222149_x_at golgi autoantigen, AL137398 283768/// Consensus includes gb: AL137398.1/DEF = golgin subfamily a, 388080/// Homo sapiens mRNA; cDNA DKFZp434K052 (from clone 8G/// golgi 390535/// DKFZp434K052)./FEA = mRNA/DB_XREF = gi: 6807944/ autoantigen, 400304/// UG = Hs.169639 Homo sapiens mRNA; cDNA golgin 440244 DKFZp434K052 (from clone DKFZp434K052) subfamily a, 8D/// golgi autoantigen, golgin subfamily a, 8E/// golgi autoantigen, golgin subfamily a, 8C/// golgi autoantigen, golgin subfamily a, 8F 129 222266_at Chromosome BF796940 8725 Consensus includes gb: BF796940/FEA = EST/ 19 open DB_XREF = gi: 12101994/DB_XREF = est: reading 602258153F1/CLONE = IMAGE: 4341588/ frame 2 UG = Hs.294100 ESTs 130 222267_at hypothetical BE619220 84928 Consensus includes gb: BE619220/FEA = EST/ protein DB_XREF = gi: 9890158/DB_XREF = est: 601472975F1/ FLJ14803 CLONE = IMAGE: 3875730/UG = Hs.267245 ESTs, Weakly similar to cDNA EST EMBL: T02216 comes from this gene C. elegans 131 222372_at Membrane AW971248 9223 Consensus includes gb: AW971248/FEA = EST/ associated DB_XREF = gi: 8161093/DB_XREF = est: EST383337/ guanylate UG = Hs.291289 ESTs, Weakly similar to kinase, ALU1_HUMAN ALU SUBFAMILY J SEQUENCE WW and CONTAMINATION WARNING ENTRY H. sapiens PDZ domain containing 1 132 222375_at Peptidylprolyl AW970944 9360 Consensus includes gb: AW970944/FEA = EST/ isomerase G DB_XREF = gi: 8160789/DB_XREF = est: EST383027/ (cyclophilin G) UG = Hs.291839 ESTs 133 37226_at BCL2/ U15172 662 Cluster Incl. U15172: Homo sapiens BCL2/ adenovirus adenovirus E1B 19 kD-interacting protein 1 (BNIP1) E1B 19 kDa mRNA, complete cds/cds = (10,696)/gb = U15172/ interacting gi = 558841/ug = Hs.77572/len = 1100 protein 1 134 38918_at SRY AF083105 9580 Cluster Incl. AF083105: Homo sapiens HMG box factor (sex SOX-13 mRNA, complete cds/cds = (111,2783)/ determining gb = AF083105/gi = 3982828/ug = Hs.201671/ region Y)- len = 3583 box 13 135 39582_at Cylindromatosis AL050166 1540 Cluster Incl. AL050166: Homo sapiens mRNA; cDNA (turban DKFZp586D1122 (from clone DKFZp586D1122)/ tumor cds = UNKNOWN/gb = AL050166/gi = 4884381/ syndrome) ug = Hs.26295/len = 2654 136 51228_at RNA binding N36928 389677 Cluster Incl. N36928: yy38e06.s1 Homo sapiens cDNA, motif 3 end/clone = IMAGE-273538/clone_end = 3/ protein gb = N36928/gi = 1158070/ug = Hs.33540/len = 582 12B 137 60815_at hypothetical AA601208 84820 Cluster Incl. AA601208: no14c12.s1 Homo sapiens protein cDNA, 3 end/clone = IMAGE-1100662/clone_end = 3/ MGC13098 gb = AA601208/gi = 2434833/ug = Hs.220255/ len = 488 138 63825_at abhydrolase AI557319 11057 Cluster Incl. AI557319: PT2.1_16_F08.r Homo sapiens domain cDNA, 3 end/clone_end = 3/gb = AI557319/ containing 2 gi = 4489682/ug = Hs.21921/len = 876 139 78383_at NADH AI150117 4712 Cluster Incl. AI150117: qf44e06.x1 Homo sapiens dehydrogenase cDNA, 3 end/clone = IMAGE-1752898/clone_end = 3/ (ubiquinone) gb = AI150117/gi = 3678586/ug = Hs.121573/len = 482 1 beta subcomplex, 6, 17 kDa lower upper 1 baseline experiment fold bound bound t filter- 2 V_10L V_30L mean C3_0R C3_30R.sub. mean change of FC of FC statistic P value ed 3 922.09 905.33 915.94 2376.17 2317.29 2350.47 2.57 2.35 2.81 17.879 0.007152 * 4 1977.44 2035.84 2002.8 4045.53 3752.24 3896.24 1.95 1.77 2.14 10.501 0.023083 * 5 264.5 329.5 294.1 913 940.36 926.42 3.15 2.56 4.06 13.672 0.011321 * 6 208.07 230.43 216.04 380.57 384.02 382.4 1.77 1.52 2.1 7.065 0.030743 * 7 2242.95 2162.92 2201.44 1312.67 1338.47 1326 1.66 1.54 1.79 10.423 0.020539 * 8 382.23 418.38 396.41 724.2 703.19 716.23 1.81 1.58 2.1 8.479 0.022197 * 9 506.86 456.97 480.44 909.97 862.13 886.76 1.85 1.65 2.07 9.753 0.010555 * 10 1610.05 1558.89 1589.33 875.12 882.45 878.23 1.81 1.67 1.97 13.16 0.00579 * 11 149.85 140.45 145.03 72.21 70.62 71.44 2.03 1.62 2.63 5.622 0.030218 * 12 2456.05 2311.02 2384.72 1192.69 1157.87 1175.42 2.03 1.88 2.19 13.879 0.013846 * 13 1354.59 1498.64 1425.34 2364.53 2338.21 2352.89 1.65 1.5 1.83 9.812 0.01469 * 14 276.3 289.72 283.27 167.59 174.15 170.59 1.66 1.5 1.84 8.362 0.015621 * 15 9350.78 8746.29 9051.77 4264.6 4313.27 4286.89 2.11 1.92 2.32 11.563 0.024141 * 16 447.5 463.45 453.66 765.95 776.01 770.82 1.7 1.51 1.92 8.083 0.015627 * 17 521.02 540.73 529.66 306.54 301.46 304.32 1.74 1.54 1.99 7.745 0.016304 * 18 680.26 686.6 682.9 308.13 330.83 319.39 2.14 1.9 2.44 13.247 0.009657 * 19 274.29 334.24 310.51 578.65 597.89 591.41 1.9 1.54 2.46 5.786 0.043153 * 20 3602.07 4101.87 3849.03 6669.78 6815.24 6744.54 1.75 1.57 1.98 9.844 0.028837 * 21 97.47 111.44 104.62 53.94 47.9 51.72 2.02 1.61 2.6 5.208 0.039098 * 22 287.8 277.18 281.99 149.05 152.57 150.12 1.88 1.57 2.26 5.582 0.043939 * 23 74.37 64.26 70.56 179.84 179.58 179.7 2.55 1.85 3.95 5.786 0.032902 * 24 1582.39 1577.16 1580.32 771.31 780.11 774.53 2.04 1.89 2.21 17.65 0.003266 * 25 108.73 123.59 115.93 227.96 201.82 214.81 1.85 1.51 2.3 4.881 0.047614 * 26 82.88 97.26 90.69 181.6 212.25 197.53 2.18 1.74 2.78 5.585 0.042766 * 27 1096.03 1206.74 1151.65 484.03 478.94 480.83 2.4 2.1 2.74 10.009 0.02495 * 28 329.91 286.17 307.74 151.94 130.46 141.57 2.17 1.74 2.76 5.643 0.042982 * 29 162.35 137.17 150.42 479.55 436.65 458.78 3.05 2.45 3.92 8.81 0.020509 * 30 49.28 34.36 41.9 114.41 127.69 121.57 2.9 1.99 4.98 5.402 0.032606 * 31 235.64 169.28 201.33 481.6 421.47 451.29 2.24 1.65 3.32 4.841 0.040923 * 32 38.38 29.43 34.16 65.15 73.37 69.37 2.03 1.53 2.91 4.55 0.049665 * 33 140.4 138.9 139.32 265.79 276.08 270.84 1.94 1.64 2.37 7.138 0.02134 * 34 301.78 266.57 283.99 518.19 567.56 542.73 1.91 1.66 2.23 7.774 0.016833 * 35 510.11 563.35 536.81 292.3 320.86 304.15 1.76 1.51 2.06 5.886 0.040511 * 36 29.08 43.01 36.19 98.95 84.13 91.5 2.53 1.73 4.29 4.496 0.046118 * 37 29.3 58.84 44.48 133.46 164.48 149.22 3.35 2.03 8.17 4.629 0.043683 * 38 1117.13 1171.35 1148.76 2386.54 2203.36 2304.12 2.01 1.79 2.26 9.277 0.023096 * 39 1840.87 2041.63 1912.33 3895.74 3397.03 3646.44 1.91 1.62 2.25 6.062 0.045441 * 40 69.79 50.92 59.63 157.76 143.53 150.76 2.53 1.8 3.97 4.988 0.037992 * 41 1131 964.37 1048.96 2077.94 1882.18 1979.89 1.89 1.61 2.25 6.744 0.02224 * 42 375.47 328.08 353.16 901.16 792.75 847.14 2.4 1.98 2.94 7.332 0.030732 * 43 1911.61 1787.67 1854.59 4005.01 3593.72 3804.02 2.05 1.81 2.31 8.174 0.048745 * 44 939.25 1004.2 974.01 570.04 555.72 563.82 1.73 1.57 1.91 8.878 0.018512 * 45 155.5 126.19 141.27 265.4 300.42 283.74 2.01 1.62 2.56 5.583 0.031407 * 46 4123.2 3983.46 4062.81 2196.2 2458.44 2322.76 1.75 1.58 1.95 10.232 0.013555 * 47 394.53 394.66 394.58 765.84 755.65 761.58 1.93 1.73 2.18 11.007 0.008959 * 48 125.44 136.96 130.05 247.76 238.43 243.84 1.88 1.66 2.14 10.059 0.013322 * 49 559.7 498.27 529.82 287.78 256.19 272.55 1.94 1.62 2.34 5.912 0.039153 * 50 74.95 89.43 82.42 174.23 166.4 170.81 2.07 1.61 2.82 5.468 0.036898 * 51 31.43 29.14 29.96 84.96 84.52 84.71 2.83 2.16 3.97 7.403 0.01798 * 52 962.36 948.38 955.24 589.3 570.6 581.65 1.64 1.51 1.79 9.931 0.011366 * 53 1583.78 1438.1 1512.03 879.86 850.67 864.44 1.75 1.58 1.93 7.798 0.049299 * 54 333.81 354.44 342.93 167.97 198.82 182 1.88 1.56 2.34 6.081 0.027406 * 55 937.02 900.54 921.86 535.58 458.27 497.34 1.85 1.55 2.28 6.151 0.027594 * 56 157.52 146.54 152.01 25.39 50.42 38.29 3.97 2.46 9.74 6.647 0.02684 * 57 1242.62 1216.9 1230.79 2064.14 1969.67 2015.81 1.64 1.52 1.76 10.549 0.017822 * 58 1699.94 1456.25 1575.73 3352.79 3121.47 3234.52 2.05 1.77 2.42 8.783 0.012805 * 59 1865.06 2197.36 2022.32 4104.56 3691.08 3896.55 1.93 1.63 2.31 6.557 0.025411 * 60 90.05 111.55 102.68 193 198.35 195.05 1.9 1.52 2.49 5.33 0.042904 * 61 303.43 409.95 356.09 754.1 752.58 753.41 2.12 1.67 2.86 6.29 0.044228 * 62 3130.1 3118.14 3124.47 4942.08 4890.82 4919.33 1.57 1.52 1.64 18.837 0.006053 * 63 830.03 898.32 857.29 1431.81 1480.78 1452.25 1.69 1.51 1.9 7.827 0.018039 * 64 1273.64 1256.49 1267.2 2206.84 2032.64 2123.3 1.68 1.51 1.85 7.282 0.049006 * 65 673.39 574.35 622.41 1216.07 1115.91 1168.18 1.88 1.58 2.27 6.269 0.024787 * 66 483.95 455.96 467.93 814.81 790.73 802.13 1.71 1.53 1.93 8.304 0.014221 * 67 133.19 113.53 124.58 320.16 288.18 304.64 2.45 1.99 3.07 7.363 0.024709 * 68 179.27 202.81 193.07 403.43 354.73 380.07 1.97 1.62 2.41 5.609 0.042866 * 69 24.72 15.01 20.44 75.8 69.48 72.78 3.56 2.18 9.18 5.797 0.04036 * 70 1074.28 987.37 1031.48 522.55 537.86 530.16 1.95 1.75 2.16 9.078 0.035694 * 71 1742.37 1648.31 1693.44 866.28 886.21 876.12 1.93 1.78 2.11 12.502 0.011245 * 72 134.02 109.87 121.71 513.82 483.3 498.97 4.1 3.3 5.33 13.202 0.008424 * 73 462.24 522.52 492.56 865.07 885.7 874.64 1.78 1.57 2.04 8.866 0.026287 * 74 919.47 804.23 862.51 1468.96 1643.67 1556.38 1.8 1.55 2.12 6.17 0.032323 * 75 147.08 138.31 142.97 263.51 276.57 269.75 1.89 1.61 2.24 6.785 0.021848 * 76 238.73 336.16 286.79 707.71 620.22 665.82 2.32 1.73 3.35 5.076 0.037084 * 77 78.35 97.43 87.52 180.85 204.78 192.44 2.2 1.61 3.23 4.368 0.049735 * 78 178.94 203.94 193.12 555.59 500.12 527.64 2.73 2.17 3.59 7.906 0.017721 * 79 312.14 324.62 317.9 662.04 699.51 679.96 2.14 1.93 2.38 12.692 0.008363 * 80 194.69 207.7 200.23 354.63 342.37 349.33 1.74 1.51 2.03 6.307 0.029152 * 81 254.54 252.42 253.74 515.94 586.25 550.54 2.17 1.82 2.59 6.622 0.045646 * 82 60.33 53.62 57.5 104.95 113.75 109.06 1.9 1.56 2.38 5.907 0.030233 * 83 62.05 78.2 69.69 179.74 155.79 167.98 2.41 1.79 3.49 5.245 0.035335 * 84 148.44 147.45 148.11 354.12 341.37 349.18 2.36 2.05 2.74 11.338 0.008322 * 85 38.99 41.04 40.08 136.75 130.56 133.97 3.34 2.65 4.49 12.99 0.011444 * 86 445.86 391.27 417.7 722.78 760.46 740.91 1.77 1.57 2.03 8.635 0.015805 * 87 130.29 155.57 141.23 313.19 320.06 317.04 2.24 1.87 2.8 9.03 0.020409 * 88 286.21 414.54 348.29 985.82 995.05 990.4 2.84 2.16 4.16 9.225 0.049506 * 89 131.42 110.91 122.78 247.45 223.32 236.79 1.93 1.53 2.54 5.004 0.038821 * 90 112.61 137.23 125.04 293.85 321.31 307.79 2.46 2.04 3.05 9.093 0.011966 * 91 53.05 57.31 55.25 108.42 115.51 112.36 2.03 1.68 2.51 6.466 0.024294 * 92 157.78 135.22 145.47 310.51 342.11 327.58 2.25 1.83 2.87 7.123 0.019178 * 93 2419.57 2525.23 2473 4412.4 4840.91 4619.04 1.87 1.69 2.06 8.867 0.042128 * 94 215.76 186.58 201.09 401.49 418.78 409.73 2.04 1.7 2.51 7.604 0.021132 * 95 437.27 409.44 423.12 228.06 248.67 238.97 1.77 1.57 2 7.614 0.025043 * 96 123.92 107.89 115.29 225.21 221.88 223.4 1.94 1.6 2.42 6.515 0.027006 * 97 612.78 576.59 595.48 1096.59 1000 1048.84 1.76 1.59 1.95 7.943 0.043916 * 98 1748.38 1703.42 1726.52 1036.42 966.07 999.33 1.73 1.6 1.87 13.819 0.008998 * 99 9.69 13.76 11.28 43.94 37.02 40.77 3.61 2.04 11.81 4.351 0.049011 * 100 461.12 486.8 474.07 202.43 201.6 201.94 2.35 2.15 2.57 15.536 0.009759 * 101 25.16 20.62 22.17 57.02 58.29 57.55 2.6 1.74 4.65 4.461 0.047383 * 102 312 350.96 337.07 576.04 626.6 606.13 1.8 1.53 2.14 5.92 0.031648 * 103 62.62 88.28 77.98 244.94 233.31 238.98 3.06 2.23 4.71 6.949 0.020111 * 104 1475.25 1551.27 1509.99 2951.15 2813.6 2885.76 1.91 1.79 2.04 15.344 0.010397 * 105 1367.45 1501.79 1437.52 2718.02 2697.74 2708.16 1.88 1.73 2.06 15.464 0.009932 * 106 970.89 853.71 912.25 239.75 263.56 250.51 3.64 3.1 4.29 10.546 0.040834 * 107 986.93 896.21 941.85 495.03 549.02 520.07 1.81 1.56 2.11 6.563 0.027917 * 108 374.15 401.85 385.58 814.69 731.24 775.62 2.01 1.72 2.36 6.656 0.044234 * 109 363.89 434.04 398.95 772.24 701.41 737.44 1.85 1.57 2.2 6.638 0.02207 * 110 387.41 362.67 376.24 209.07 214.57 211.27 1.78 1.53 2.09 6.247 0.028515 * 111 2366.93 2270.57 2317.53 1349.62 1427.98 1389.5 1.67 1.5 1.85 7.705 0.027981 * 112 452.15 409.67 432.83 800.92 746.29 773.68 1.79 1.55 2.08 7.041 0.019802 * 113 1530.91 1468.46 1498.36 894.5 938.85 912.04 1.64 1.51 1.8 10.283 0.009669 * 114 175.96 159.11 167.68 336.43 308.35 322.49 1.92 1.6 2.33 5.835 0.037189 * 115 142.21 150 146.13 76.02 79.16 77.39 1.89 1.63 2.22 7.348 0.018732 * 116 2454 2941.95 2697.31 5067.12 4950.76 5011.42 1.86 1.61 2.19 8.533 0.033698 * 117 167.3 203.1 187.65 354.17 353.2 353.7 1.88 1.57 2.34 6.871 0.046797 * 118 22.44 11.02 17.07 66.74 58.4 62.61 3.67 2.07 12.35 4.527 0.045678 * 119 128.87 113.17 121.31 224.26 244.11 233.04 1.92 1.61 2.35 6.606 0.022576 * 120 83.91 72.84 77.62 203.18 171.35 186.99 2.41 1.86 3.21 5.457 0.046675 * 121 289.94 429.56 360.03 962.21 1149.02 1054.8 2.93 2.11 4.47 5.818 0.032936 * 122 140.37 119.62 131.47 275.34 241.37 257.7 1.96 1.55 2.54 4.865 0.043266 * 123 109.7 119.64 115.46 228.47 214.51 221.46 1.92 1.58 2.38 5.821 0.028482 * 124 1036.33 1114.29 1073.98 1860.83 1808.33 1835.09 1.71 1.57 1.86 11.087 0.008285 * 125 1415.81 1386.03 1402.49 738.95 832.69 786.02 1.78 1.61 2 11.284 0.021506 * 126 58.55 53.83 56.45 113.47 117.94 115.68 2.05 1.64 2.67 5.752 0.029238 * 127 1150.48 1436.97 1294.46 2663.89 2541.9 2601.29 2.01 1.65 2.53 7.023 0.030687 * 128 1054.35 830.59 942.89 2033.33 1950.52 1985.61 2.11 1.72 2.69 7.727 0.042502 * 129 390.8 361.45 376.33 737.14 762.16 749.59 1.99 1.79 2.24 11.194 0.008077 * 130 70.14 87.27 79.02 167.2 170.58 169.01 2.14 1.72 2.8 7.272 0.042197 * 131 223.18 283.83 251.19 557.31 493.51 526.69 2.1 1.63 2.83 5.277 0.034132 * 132 23.65 25.36 24.6 88.17 84.37 86.44 3.51 2.4 5.98 6.011 0.033103 * 133 528.19 530.43 529.26 311.58 313.24 312.31 1.69 1.58 1.83 12.373 0.006947 * 134 143.92 128.72 135.94 255.75 231.23 243.63 1.79 1.52 2.13 5.786 0.033891 * 135 124.49 118.76 121.6 225.26 210.25 218.32 1.8 1.51 2.15 5.539 0.039085 * 136 338.22 288.47 313.31 579.08 631.22 604.1 1.93 1.62 2.34 6.713 0.021482 * 137 136.2 162.96 149.84 376.54 333.88 356.47 2.38 1.93 2.99 6.872 0.029495 * 138 492.44 604.79 548.42 997.44 1113.6 1055.22 1.92 1.58 2.39 5.861 0.028089 * 139 837.23 813.65 825.88 464.11 453.91 459.35 1.8 1.68 1.93 13.104 0.014148 *
TABLE-US-00009 TABLE 3 Genes altered due to DHHC3 ablation Links Gene Name Fold Change (reference).sup.a Up-regulated Vestigial like 3 (VGLL3) 3.67 TS (1) Phosphatidylinositol-4-phosphate 5-kinase, type I, beta (PIP5K1b) 3.61 Sen (2) Collagen, type VI, alpha 3 (COL6A3) 3.15 Sen (3) General transcription factor II, i (GTF2i) 2.83 OS (4, 5) Thioredoxin interacting protein (TXNIP) 2.57 OS, Sen, TS (6, 7) Amylase, alpha 1A (AMY1A) 2.53 Sen (8) Chromosome 1 open reading frame 63, C1orf63 (RSRP1) 2.4 Sen (9) Advillin (AVIL) 2.18 ES (10) Kinase D-interacting substance of 220 kDa (KIDINS220) 2.12 FK506 binding protein 11, 19 kDa (FKBP11) 2.01 OS (11) X-ray repair complementing defective repair in Chinese 1.94 hamster cells 2 (XRCC2) Intersectin 2 (ITSN2) 1.93 Sen (12) SET domain containing 6 (SETD6) 1.92 OS (13) BTB (POZ) domain containing 5 (KLHL28).sup.b 1.92 Sen DMC1 dosage suppressor of mck1 homolog (DMC1) 1.91 Mitochondrial ribosomal protein 63 (MRPL57) 1.90 Major histocompatibility complex, class I-related (MR1) 1.88 Zinc finger, CCHC domain containing 14 (KIAA0579) 1.88 Centrosomal protein 27 kDa, CEP27 (HAUS2) 1.86 Senataxin (SETX) 1.81 OS (14) S.RY (sex determining region Y)-box 13 (SOX13) 1.79 RAD1 homolog (RAD1) 1.7.5 Ataxia telangiectasia mutated (ATM) 1.71 Sen (15) Tripartite motif-containing 38 (TRIM38) 1.7 Sen (16) Collagen, type XIII, alpha 1 (COL13A1) 1.64 Sen (3) Downregulated ZDHHC3 3.64 BCL2-related protein A1 (BCL2A1) 2.4 Sen (17) Dystobrevin, alpha (DTNA) 2.17 Chromosome II open reading frame 51 (ANAPC15) 2.14 Sen (18) S100A4 protein (S100A4) 2.11 Onc. OS (19) Prefoldin subunit 4 (PFDN4) 2.04 Sen (20) Dehydrogenase/reductase (SDR family) member 3 (DHRS3) 2.03 PHD finger protein 14 (PHF14) 2.02 B9 protein (B9D1) 1.94 DENN/MADD domain containing 1A (DENND1A) 1.89 Protein tyrosine phosphatase, non-receptor type 7 (HePTP) 1.88 Sen (21) Phosphodiesterase 4B, cAMP-specific (PDE4B) 1.88 OS (22) Histamine N-methyltransferase (HNMT).sup.c 1.85 OS Nudix (nucleoside diphosphate linked moietyX)-type motif 2 (NUDT2) 1.81 OS (23) Chromosome 14 open reading frame 2 (C14orf2) 1.81 WD repeat domain 61 (WDR61) 1.78 Egl nine homolog 3 (EGLN3) 1.78 BCL2/adenovirus E1B 19 kDa interacting protein 1 (BNIP1) 1.76 Cyclin-dependent kinase inhibitor 3 (CDKN3) 1.75 Sen (24) SMN interacting protein 1-delta (GEMIN2) 1.74 Aldo-keto reductase family 1, member C1 (AKR1C1) 1.74 OS (25) Glutathione transferase zeta 1 (GSTZ1) 1.73 OS (26) Chromosome 16 open reading frame 60 (CENPN) 1.67 Sen (9) Lipase A, lysosomal acid, cholesterol esterase (Wolman disease) 1.66 Sen (27) Hematopoietic cell specific Lyn substrate 1 (HCLS1) 1.66 Sen (28) SMN interacting protein 1-gamma (GEMIN2) 1.64 Dilute suppressor (MREG) 1.64 .sup.aOS = oxidative stress; Sen = senescent; Onc = oncogenic; Ts = Tumor suppressor; ES = ER stress .sup.bpredicted functional partner of RGN (senescence marker protein-30) (//string-db.org/cgi/network.pl?taskId=4OrMQuLACUrH) .sup.cEnhancing HNMT enzyme levels is a suggested therapy for oxidative stress related disorders (U.S. Pat. No. 8,709,406 B2)
TABLE-US-00010 TABLE 4 Additional list of senescence related genes from human microarray analysis of D3 xenograft tumors S#.sup.a Gene name Fold P value Reference 1. Cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), 16 0.008 (29) (CDKN2A) 2. Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor 2.87 0.04 (30) type 1), (PAI-1) 3. Major histocompatibility complex, class II, DR beta 1, (HLA-DRB4).sup.b 1.81 0.005 4. Tight junction protein 1 (zona occludens 1), (TJP1) 1.63 0.0008 (31) 5. Retinoblastoma binding protein 6, (RBBP6) 1.6 0.03 (32) 6. Insulin-like growth factor binding protein 7, (IGFBP7) 1.5 0.03 (33) 7. SMAD specific E3 ubiquitin protein ligase 2, (Smurf2) 1.45 0.04 (34) 8. Mitogen-activated protein kinase kinase kinase 5, (Ask1) 1.41 0.03 (35) 9. Thrombospondin 1, (THBS1) 1.4 0.02 (36) 10. Chromobox homolog 1 (HP1 beta homolog Drosophila), (CBX1) 1.3 0.001 (37) 11. Hypoxia up-regulated 1/ORP150, (GRP170) 1.3 0.04 (38) 12. Cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4), (CDKN2C) 1.4 0.008 (29) 13. Cyclin A2, (CCNA2) 1.32 0.01 (39) 14. Endothelial cell-specific molecule 1, (Esm1) 3.83 0.09 (40) 15. Platelet-derived growth factor beta polypeptide, (PDGFB) 1.93 0.09 (41) 16. Mitogen-activated protein kinase-activated protein kinase 2 1.6 0.08 (42) 17. Platelet derived growth factor C, (PDGFC) 1.22 0.07 (43) 18. Tumor protein p53 (Li-Fraumeni syndrome), (TP53) 1.2 0.07 (44) 19. Fibroblast growth factor 5 (FGF5) 1.4 0.1 (45) .sup.aAlthought the top six genes in this list apparently do meet fold change and P value criteria, they were not selected by the array analysis program due to erroneous false probe results, and thus do not appear in Table 2. .sup.bsuggested as human senescence gene (//liweilab.genetics.ac.en/tm/search.php?st=gn&gn=human%20senescence%20gene&ti=9606&tn=1105&sot=&pg=6)
[0158] The following references were cited in Table 3 and Table 4. [0159] (1) Gambaro et al., 2013 Mol Oncol, 7:513-30. [0160] (2) Ischebeck et al., 2013 Plant Cell, 25:4894-911. [0161] (3) Larsson et al., 2004 Cancer Res, 64:482-9. [0162] (4) Inberg A and Linial M. 2010 J Biol Chem, 285:25686-98. [0163] (5) Hassona et al, 2013 Carcinogenesis, 34:1286-95. [0164] (6) Mahmood et al, 2013 Antioxid Redox Signal, 19:1266-303. [0165] (7) Riahi et al., 2015 J Cell Mol Med, 19:1887-99. [0166] (8) Jie et al., 2009 BMB Rep, 42:101-5. [0167] (9) Chechlinska et al., 2009 BMC Genomics, 10:261. [0168] (10) Wang et al., 1998 EMBO J, 17:3619-30. [0169] (11) Laybutt et al., 2007 Diabetologia, 50:752-63. [0170] (12) Rajarajacholan et al., 2013 PLoS Biol, 11:e1001502. [0171] (13) Chen et al., 2016 Biochim Biophys Acta, 1859:420-7. [0172] (14) Suraweera et al., 2009 Hum Mol Genet, 18:3384-96. [0173] (15) Zhan et al., 2010 J Biol Chem, 285:29662-70. [0174] (16) Santos J and Gil J. 2014 Immunol Lett, 162:281-9. [0175] (17) Makpol et al., 2012 Oxid Med Cell Longev, 2012:785743. [0176] (18) Mansfeld et al., 2011 Nat Cell Biol, 13:1234-43. [0177] (19) Dmytriyeva et al., 2012 Nat Commun, 3:1197. [0178] (20) Iijima et al., 1996 Acta Med Okayama, 50:73-7. [0179] (21) Sergienko et al., 2012 ACS Chem Biol, 7:367-77. [0180] (22) Kashiwagi et al., 2012 Prostate, 72:741-51. [0181] (23) Ogawa et al., 2009 Plant J, 57:289-301. [0182] (24) Krizhanovsky et al., 2008 Cell, 134:657-67. [0183] (25) Burczynski et al., 2001 J Biol Chem, 276:2890-7. [0184] (26) Blackburn et al., 2006 Mol Pharmacol, 69:650-7. [0185] (27) Kojima et al., 2013 Hepatol Res, 43:1361-7. [0186] (28) Marthandan et al., 2015 Biomed Res Int, 2015:731938. [0187] (29) Gagrica et al., 2012 Cancer Res, 72:165-75. [0188] (30) Kortlever et al., 2006 Nat Cell Biol, 8:877-84. [0189] (31) Dabrowska et al., 2011 Tumour Biol, 32:965-76. [0190] (32) Deschenes-Simard et al., 2014 Cell Cycle, 13:1840-58. [0191] (33) Benatar et al., 2012 Breast Cancer Res Treat, 133:563-73. [0192] (34) Zhang H and Cohen S N. 2004 Genes Dev, 18:3028-40. [0193] (35) Yokoi et al., 2006 Diabetes, 55:1660-5. [0194] (36) Acosta et al., 2013 Nat Cell Biol, 15:978-90. [0195] (37) Adams P D. 2007 Gene, 397:84-93. [0196] (38) Kretowski et al., 2014 Biomed Res Int, 2014:196249. [0197] (39) Gopinathan et al., 2014 Cancer Res, 74:3870-9. [0198] (40) Sousa-Victor et al., 2014 Nature, 506:316-21. [0199] (41) Vindrieux et al., 2013 Aging (Albany N.Y.), 5:531-8. [0200] (42) Herranz et al., 2015 Nat Cell Biol, 17:1205-17. [0201] (43) Alessio et al., 2013 Cell Mol Life Sci, 70:1637-51. [0202] (44) Lujambio et al., 2013 Cell, 153:449-60. [0203] (45) Matsunaga et al., 1999 Mol Vis, 5:39.
Example 5: DHHC3 Ablation Promotes Oxidative Stress
[0204] A fluorescent dye conversion assay confirmed that oxidative stress/ROS is significantly elevated in stable ZDHHC3-ablated MDA-MB-231 (
Example 6: DHHC3 Ablation Enhances Cellular Senescence
[0205] Increased oxidative stress often triggers senescence (Hwang et al., 2013 Free Radic Biol Med, 61:95-110; Mahmood et al., 2013 Antioxid Redox Signal, 19:1266-303; Panieri et al., 2013 Free Radic Biol Med, 57:176-87). Consistent with this (and with results in Table 3), ZDHHC3 ablation markedly elevated senescence-associated -galactosidase (SA--Gal) activity in MDA-MB-231 (
Example 7: Recruitment of Innate Immune CellsFurther Evidence for Senescence
[0206] As shown herein, DHHC3 ablation induces cellular senescence and senescence-associated secretory phenotype (SASP). Specifically, the upregulated chemokine pattern (
[0207] As described herein, DHHC3 effects innate immunity. Indeed, ZDHHC3-ablated xenografts showed enhanced iNOS staining, indicative of anti-tumor M1-like macrophages (
[0208] In an in vitro model system, THP1 cells were stimulated by LPS and IFN- to differentiate into iNOS-positive M1-like macrophages (
Example 8: TXNIP Contributes to the DHHC3 Ablation Phenotype
[0209] Among genes with expression altered by ZDHHC3 ablation, TXNIP (#5 in Table 3), which is linked to oxidative stress, senescence, and tumor suppression was focused on (Mahmood et al., 2013 Antioxid Redox Signal, 19:1266-303; Riahi et al., 2015 J Cell Mol Med, 19:1887-99; Morrison et al., 2014 Mol Cancer, 13:62). Enhanced TXNIP protein expression was validated in multiple breast cancer lines (
Example 9: DHHC3 Ablation Effects are Specific and Require the Enzyme Active Site
[0210] To confirm ZDHHC3 ablation specificity, rescue vector D3.sup.R, containing ZDHHC3 knockdown shRNA, ZDHHC3 cDNA resistant to the shRNA, 2A peptide linker, and GFP tag was designed (
[0211] Recapitulating
Example 10: Disruption of ERGIC3 Upregulates TXNIP
[0212] To understand how ZDHHC3-ablation might upregulate TXNIP, disruption of ERGIC3 (endoplasmic reticulum Golgi intermediate compartment-3) protein, which is known to cause ER stress (Hong et al., 2016 Oncotarget, 7:65335-47), which then upregulates TXNIP was examined (Oslowski et al., 2012 Cell Metab, 16:265-73). First, it was confirmed again that ZDHHC3 ablation in MDA-MB-231 cells upregulates TXNIP (
Example 11: DHHC3 Regulates CMTM6 Palmitoylation and PD-L1 Expression
[0213] Described herein is the identification of drivers of breast cancer growth, and methods of inhibiting breast cancer. Also described herein are revolutionized treatment regimens that are more effective, less toxic, and positively impact survival.
[0214] As described herein, DHHC3 affects breast tumor growth and metastasis. Prior to the invention described herein, it was unknown which of several putative DHHC3 substrates might be important for tumor regulation.
[0215] Direct inhibition of the immune checkpoint molecule, PD-L1, has considerable potential in the treatment of breast cancer (Bertucci F, Goncalves A. 2017 Curr Oncol Rep, 19:64) and other cancers (Homet M B, Ribas A. 2015 Br J Cancer, 112:1421-7). However, because this approach has limitations, alternative and combinatorial approaches are described herein. Described herein is an approach towards simultaneously amplifying a) adaptive anti-tumor immunity, by indirectly down-regulating PD-L; and b) innate anti-tumor immunity, by promoting premature tumor cell senescence (
[0216] It was recently found that cell surface protein, CMTM6, is needed for maintenance of PD-L1 on tumor cells (Mezzadra et al., 2017 Nature, 549:106-10; Burr et al., 2017 Nature, 549:101-5). However, prior to the invention described herein, relatively little was known regarding the properties of CMTM6 and factors that regulate its expression and function. It was identified that CMTM6 is a DHHC3 substrate. As described herein, ablation of the protein acyl transferase, DHHC3, causes a loss of CMTM6 palmitoylation and altered subcellular distribution, thus leading to a marked decrease in PD-L1 expression on breast tumor cells. These results suggest an elevated anti-tumor immunity response (
[0217] The data described herein indicate that DHHC3 ablation should enhance 1) adaptive immunity; and 2) innate immunity; and 3) that DHHC3 is a biomarker/target in human breast cancer. Specifically, it was identified that a) DHHC3 expression is upregulated in multiple human breast cancer subtypes; b) upregulated zDHHC3 expression correlates with diminished survival in human breast cancer patients; and c) ablation of zDHHC3 results in diminished breast cancer growth and metastasis in xenograft models. For these reasons, and because DHHC3 ablation simultaneously amplifies both adaptive and innate anti-tumor immunity, targeting of DHHC3 is particularly effective in breast cancer.
DHHC3 and Adaptive Immunity
[0218] It was identified that CMTM6, a membrane protein, contains at least 1 intracellular membrane-proximal cysteine that is likely be palmitoylated (
[0219] As described in detail below, the effects of DHHC3 ablation on CMTM6 palmitoylation were examined. The results show that DHHC3 ablation reduced CMTM6 palmitoylation. Specifically, it was determined that it is 90% diminished (
[0220] To understand how loss of CMTM6 palmitoylation might affect its role in PD-L1 modulation, effects of DHHC3 ablation on CMTM6 subcellular distribution were analyzed in MDA-MB-231 cells. As indicated (
[0221] Taken together, the results presented herein suggest that CMTM6 palmitoylation is needed for proper localization and support of PD-L1 expression, and that palmitoylation is dependent on an intact active site within the DHHC3 enzyme. Hence, DHHC3 ablation in tumor cells diminishes tumor growth at least in part due to removal of PD-L1, thus enhancing adaptive immunity.
DHHC3 and Innate Immunity
[0222] In vivo xenograft models showed that zDHHC3-ablation causes significant reductions in breast cancer growth in vivo (
DHHC3 Relevance to Human Breast Cancer
[0223] As evidence for DHHC3 having an important role in human breast cancer, and as described in detail herein, DHHC3 expression was upregulated in human malignant and metastatic breast cancer samples, as seen by immunohistochemistry staining (
[0224] The data described herein indicate that ablation of protein acyl transferase, DHHC3, in breast tumor cells may diminish tumor growth by two distinct mechanisms. First, the absence of DHHC3 promotes adaptive immunity, e.g., by causing loss of CMTM6 palmitoylation, leading to diminished expression of PD-L1 on cancer cells, thus enabling the effector functions of antigen-specific CD8+ T cells. DHHC3 ablation causes diminished palmitoylation of CMTM6, resulting in diminished expression of PD-L1 on cancer cells, which is well known to enhance anti-tumor T cell functions. Second, the absence of DHHC3 causes tumor cell senescence, leading to tumor clearance by innate immune cells. The experiments described herein determine the biochemical and cell biological links between DHHC3 ablation, CMTM6 palmitoylation and function, and PD-L1 expression and function, leading to anti-tumor T cell amplification. Also, the individual and combined effects of DHHC3 ablation on adaptive and innate anti-cancer immunity are examined.
[0225] In vitro studies are carried out to determine the biochemical and cell biological mechanisms linking DHHC3 ablation and loss of CMTM6 palmitoylation to A) diminished PD-L1 expression and altered subcellular localization; and B) to diminished PD-L1 functions, as well as amplified T cell function. This is achieved using RNAi knockdowns (of DHHC3, CMTM6), palmitoylation, co-immunoprecipitation, cellular co-localization, and functional studies dependent on PD1 (counterreceptor for PD-L1). Finally, a potential correlation between DHHC3 and PD-L1 upregulation is examined in human breast cancer samples.
[0226] In vivo consequences of DHHC3 ablation on tumor growth in mice are investigated to determine the extent to which reduced breast tumor growth in mice is due to loss of CMTM6 and PD-L1 expression and/or functions, leading to enhanced adaptive immunity. The effects of DHHC3 ablation on adaptive and innate anti-tumor immunity are compared.
In Vitro Links Between DHHC3, CMTM6 and PD-L1
[0227] To assess cell biological and functional links between DHHC3, CMTM6 palmitoylation, PD-L1, and adaptive immunity, the following strategies are employed: RNAi knockdown of DHHC3 and CMTM6; reconstitution with palmitoylation-deficient mutant CMTM6; co-immunoprecipitation, cellular c-localization, and functional studies dependent upon PD1 (counter-receptor for PD-L1). Also, it is determined whether there is a correlation between DHHC3 and PD-L1 upregulation in human breast cancer samples.
[0228] Results show that PD-L1 expression depends on presence of CMTM6 (Mezzadra et al., 2017 Nature, 549:106-10; Burr et al., 2017 Nature, 549:101-5). The results provided herein show that CMTM6 palmitoylation (and to some extent, expression) depends on DHHC3. Consistent with disruption of CMTM6, it was also observed that DHHC3 ablation causes a decrease in PD-L1 expression (
[0229] As described in detail below, it is determined whether decreased PD-L1 in DHHC3-ablated cells is entirely due to disrupted CMTM6. To test this, the following is examined:
[0230] a) Subcellular distribution and PD-L1 maintenance. In MDA-MB-231 cells (DHHC3 ablation; IFN treatment) subcellular and cell surface distributions and co-localization of CMTM6 and PD-L1 are analyzed individually and together, using red and green-conjugated 2nd antibodies as described (Burr et al., 2017 Nature, 549:101-5). Also, PD-L1 is analyzed using standard cell surface internalization and recycling assays (Burr et al., 2017 Nature, 549:101-5) to confirm that effects of DHHC3 ablation mimic effects of CMTM6 ablation (i.e., enhanced PD-L1 internalization, diminished recycling).
[0231] b) Co-immunoprecipitation. MDA-MB-231 cells (DHHC3 ablation; chloroquine or bafilomycin A1 to prevent lysosomal degradation of PD-L1) are lysed in digitonin (Burr et al., 2017 Nature, 549:101-5) or another appropriately mild detergent (e.g. Brij 99), while taking care to remove all insoluble materials (both heavy and light) by centrifuging lysates at 100,000 g. Then, CMTM6 with PD-L1 are reciprocally co-immunoprecipitated.
[0232] c) Mutation of CMTM6 palmitoylation site. Of 6 cysteines present in the CMTM6 sequence, 4 are possibly extracellular and 1 appears to be buried within the 2.sup.nd TM domain (
[0233] d) Determine whether effects of DHHC3 ablation on PD-L1 are dependent on altered CMTM6. MDA-MB-231 cells lacking CMTM6, or reconstituted with mutant or non-mutant CMTM6 are treatedDHHC3 ablation. Cells are then compared, using approaches described herein, with respect to PD-L1 expression, subcellular distribution, internalization, recycling, and co-immunoprecipitation with CMTM6.
[0234] e) Additional controls and confirmatory experiments. DHHC2 is used as a negative enzyme control and MHC-1 is used as a negative cell surface protein control. MHC-1 neither co-localizes nor co-immunoprecipitates with CMTM6, nor is affected by DHHC3 ablation, and knockdown of DHHC2 does not affect CMTM6 or PD-L1 cell biology or functions. Also, all key experiments performed using MDA-MB-231 cells are repeated using a mouse mammary carcinoma cell line, EMT6 (Jiao et al., 2017 Clin Cancer Res, 23:3711-20). It has been confirmed that available anti-mouse DHHC3 and DHHC2 antibodies are adequate for the proposed experiments.
DHHC3 Affects PD-L1-Dependent Functions In Vitro.
[0235] Diminished PD-L1 expression, due to DHHC3 ablation, is accompanied by diminished PD-L1-dependent functions. The following is examined:
[0236] a) Jurkat cell co-culture assays. MDA-MB-231 cells, DHHC3 ablation and pretreated with IFN, are co-cultured with PD-1.sup.+ Jurkat T cells (pre-activated overnight with PHA and PMA). After 48 and 72 h, levels of IL-2 secreted into the supernatant are detected as described (Mezzadra et al., 2017 Nature, 549:106-10).
[0237] b) Effects of rPD1. MDA-MB-231 cells, DHHC3 ablation and pretreated with IFN, are incubated with recombinant soluble PD Iprotein (rPD1, 10 g/ml), and effects on activation of ERK and mTOR are assessed as described (Black et al., 2016 Oncotarget, 7:10557-67).
[0238] c) Cytotoxicity assays. Tumor-specific CTLs are generated by injecting mitomycin-C-treated mouse mammary carcinoma cell line EMT6 intraperitoneally into BALB/c mice. After 2 weeks, CD3+ lymphocytes are isolated and expanded by coculture with mitomycin-C-treated EMT6 cells using standard methods (Barsoum et al., 2014 Cancer Res, 74:7185-90). CTLs are incubated with EMT6 cells, DHHC3 ablation, using various E:T ratios, and cytotoxicity is assessed using a LIVE/DEAD cytotoxicity/cell viability assay (Invitrogen).
[0239] d) Determine whether effects DHHC3 ablation are dependent on loss of CMTM6 palmitoylation. To address this question, the assays above are repeated, except that MDA-MB-231 and/or EMT6 cells stably ablated for CMTM6, reconstitution with non-mutated CMTM6 or palmitoylation deficient CMTM6-C90A are used.
Determine Whether DHHC3 and PD-L1 Levels Correlate in Human Breast Cancer
[0240] Both PD-L1 and DHHC3 (
[0241] The results indicate that DHHC3 ablation mimic effects of CMTM6 ablation on PD-L1 internalization and recycling and also markedly diminish the co-localization and co-immunoprecipitation of CMTM6 with PD-L1. Results suggest that altered CMTM6 distribution makes it less available for direct interaction and PD-L1 stabilization. It is also possible that absence of palmitoylation may more directly contribute to diminished CMTM6 association, but this is difficult to prove if altered distribution prevents opportunity for association. It is expected that the CMTM6-C90A mutant loses nearly all palmitoylation. If this does not occur, a C115A mutation is made (see,
In Vivo Consequences of DHHC3 Ablation
[0242] The consequences of DHHC3 removal on tumor growth in mice are examined. Also, it is determined the extent to which reduced breast tumor growth in mice is due to loss of CMTM6 and diminished PD-L1 expression, leading to enhanced adaptive immunity. Finally, as described herein, the removal of DHHC3 is most effective when it can stimulate the anti-tumor activity of both innate and adaptive immunity.
[0243] Accordingly, EMT6 mouse carcinoma cells, +/DHHC3 ablation, are used to grow tumors in mice containing both adaptive and innate immunity, or innate immunity alone. The removal of PD-L1 or CMTM6 or reconstitution with palmitoylation-deficient CMTM6 is analyzed with respect to mimicking DHHC3 ablation.
[0244] Although DHHC3 ablation was shown herein to promote enhanced innate anti-tumor immunity in mouse xenograft models, prior to the invention described herein, the effects of DHHC3 ablation were not analyzed in fully immunocompetent mouse models. Due to indirect effects of DHHC3 ablation on PD-L1 levels, adaptive tumor immunity is amplified.
[0245] Tumors are established by injecting EMT6 mouse mammary carcinoma cells, DHHC3 stable knockdown, into BALB/c mice. Injected cells express luciferase-neomycin phosphotransferase (neo) fusion protein (EMT6-LucNeo cells). Mice are then monitored for primary tumor size every 3 days, from day 15-40, by quantitative bioluminescence imaging (Rice et al., 2001 J Biomed Opt, 6:432-40; Rehemtulla et al., 2000 Neoplasia, 2:491-5) (IVIS System, Xenogen Co.) as previously described (Kolesnikova et al., 2009 Neoplasia, 11:77-86). Mice are sacrificed if moribund, or tumors reach 2 cm in diameter, or after 40 days. After 40 days, tumor sections are stained for expression of PD-L1 and CMTM6, and for markers of oxidative stress (Toyokuni et al., 1997 Lab Invest, 76:365-74; Toyokuni et al., 1995 FEBS Lett, 359:189-91) and senescence (Althubiti et al., 2014 Cell Death Dis, 5:e1528). Also, tumors are analyzed for infiltration of T cells, NK cells, M1-like macrophages, and MDSC's as described (Sharma et al., 2017 Cancer Research, 77(24): 6880-6890).
Determine to What Extent Diminished Growth of DHHC3-Ablated Tumors is Due to Effects on CMTM6 and PD-L1
[0246] The results presented herein suggest that DHHC3 ablation amplifies anti-tumor adaptive immunity due to loss of CMTM6 palmitoylation, leading to diminished PD-L1 expression. To confirm, two populations of EMT6 tumor cells (with or without DHHC3 ablation) are each treatedPD-L1 ablation, or CMTM6 ablation, or reconstituted with CMTM6 or CMTM6-C90A. Cells are injected into BALB/c mice, and then primary tumor growth is monitored, and tumor sections are analyzed as described above.
Determine to What Extent DHHC3 Ablation Diminishes Growth, Independent of Effects on Adaptive Immunity
[0247] As seen previously (Sharma et al., 2017 Cancer Research, 77(24): 6880-6890), DHHC3 ablation enhanced innate immune clearance of senescent tumor cells. To assess the relative magnitude of enhanced innate immunity (compared to innate plus adaptive immunity described above), EMT6 cellsDHHC3 ablation, are be injected into Rag2-null mice, which lack adaptive immunity. Also, EMT6 cells ablated for CMTM6 are prepared and reconstituted with mutant or non-mutant CMTM6. These cells, DHHC3 ablation, are injected and tested for tumor growth (which should not be affected by CMTM6 alterations). Tumors are analyzed for infiltration of NK cells, M1-macrophages, and MDSCs, to provide evidence for innate immune cell clearance. Also, tumor sections are stained for oxidative stress (Toyokuni et al., 1997 Lab Invest, 76:365-74; Toyokuni et al., 1995 FEBS Lett, 359:189-91) and senescence markers (Althubiti et al., 2014 Cell Death Dis, 5:e1528).
[0248] The results demonstrate that tumor growth and metastasis arising from EMT6 cell injection are substantially reduced, when DHHC3 is ablated, to an extent greater than seen previously (Sharma et al., 2017 Cancer Research, 77(24): 6880-6890). Reduced tumor growth is accompanied by diminished PD-L1 staining, and enhanced T lymphocyte infiltration, consistent with enhanced adaptive immunity. Also, there is enhanced infiltration of innate immune cells (e.g. NK, M1-like macrophages, MDSCs) together with elevated markers for oxidative stress and senescence. The relative amounts of infiltrated cell types (adaptive vs innate) are consistent with the relative magnitudes of these two effects.
[0249] When PD-L1 or CMTM6 is ablated, or tumor cells are reconstituted with CMTM6-C90A, adaptive immunity is constitutively amplified, and not further enhanced by DHHC3 ablation. However, enhanced innate immunity is still evident (see,
[0250] Tumor growth and metastasis in Rag2-null mice are reduced somewhat upon DHHC3 ablation, due to enhanced innate immunity. However, overall growth of DHHC3-ablated tumors remains partly elevated, due to the absence of adaptive immunity (
Statistical Considerations
[0251] For quantitative experiments described above, meanS.D. is determined for N3 samples, and significance is determined using unpaired two-tailed t tests. For correlation studies described above, Pearson's Correlation Coefficients is determined, with r0.4 considered as a strong positive correlation. For examining the in vivo consequences of DHHC3 ablation on tumor growth in mice, 6 mice are initially be used in each experimental group (3M, 3F). 6 mice/group have >80% power to detect 2-standard deviation difference between groups, testing at 0.05, two-sided level of significance. Sample sizes are adjusted accordingly as more data becomes available. Analysis of variance techniques compare 30-day measures (e.g. tumor volume, tumor weight).
Implications of the Results Presented Herein
[0252] The results presented herein 1) establish a means to indirectly target PD-L1 to overcome this immune checkpoint molecule; 2) show the relative effects of DHHC3 ablation on the enhancement of adaptive and innate immunity; and 3) establish the value of DHHC3, which is upregulated in most types of breast cancer, as a useful target for breast cancer therapy. In this regard, DHHC3 is selectively upregulated on malignant and metastatic breast cancer tissue, but is neither upregulated on normal tissue, nor needed for normal mammalian development.
[0253] The results, showing a method to diminish PD-L1 levels, amplify anti-tumor adaptive immunity. Additive (or possibly synergistic) enhancement of both adaptive and innate anti-tumor immunity, due to DHHC3 ablation, emphasizes the value of targeting DHHC3 for therapeutic benefit. Because DHHC3 is an enzyme, it is an excellent candidate for small molecule targeting, which is actively being pursued for various other enzymes in the DHHC protein acyltransferse family (Jennings et al., 2009 J Lipid Res, 50:233-420. DHHC3 ablation has minimal effects on normal mouse cells and on whole animal physiology (Kilpatrick et al., 2016 J Biol Chem, 291:27371-86), thus pointing to the tumor-specific potential of DHHC3 targeting. Finally, the results presented herein link DHHC3 to breast cancer growth, PD-L1 levels, adaptive immunity, senescence and innate immunity. Other DHHC enzymes (e.g., DHHC13, DHHC5) have also been linked to tumor malignancy (Perez et al., 2015 J Invest Dermatol, 135:3133-43; Tian et al., 2015 Mol Cancer Res, 13:784-94).
Example 12: DHHC3 Ablation Causes Diminished PD-L1 Expression on Cancer Cells Both in Presence and Absence of Interferon-Gamma
[0254] To determine if DHHC3 inhibition could diminish PD-L1 in physiologically-relevant concentrations of interferon gamma (IFN-), human breast carcinoma MDA-MB-231 cells were selected to express control shRNA (C), or shRNA (D3) that stably ablated DHHC3 expression. Subsequently, cells were treated with or without IFN- (50 ng/ml) for 48 hrs. Thereafter, cell lysates were prepared, proteins separated on SDS-PAGE, and transferred onto nylon membrane. Finally, PD-L1 and HSP-70 proteins were detected by blotting the membrane with specific antibodies. As shown in
Example 13: DHHC3 Ablation Causes Increased Apoptotic Cell Death in Cells Exposed to Chemotherapeutic Agents
[0255] DHHC3 ablation enhanced sensitivity to chemotherapeutic agents. Efficacy of anti-cancer chemotherapeutic agents is decreased by protective antioxidant proteins in cancer cells in response to increased oxidation. Because zDHHC3 ablation disables palmitoylation and proper function of several antioxidant proteins, it was determined whether zDHHC3 ablation increases sensitivity to chemotherapeutic agents.
[0256] As shown in
[0257] As shown in
Significance
[0258] Because anti-cancer monotherapies have shown limited long-term success, attention has turned to combination therapies. The results presented herein suggest that maximal effects of zDHHC3-ablation include enhanced sensitivity to chemotherapeutic agents combined with enhanced innate and/or adaptive anti-cancer immunity.
Example 14: Protein Acyltransferase, DHHC3, and its Relevance to Cancer
DHHC3 and Adaptive Immunity
[0259] As described herein, ablation of the enzyme, DHHC3, from human mammary carcinoma MDA-MB-231 cells causes a marked decrease in expression of PD-L1, a major negative regulator of adaptive anti-cancer immunity (
[0260] As described herein, an over-expression system was used to further establish that DHHC3 indeed can palmitoylate CMTM6. Specifically, in
[0261] As shown herein, CMTM6 incorporates 3[H]-palmitate when DHHC3 is present (
DHHC3 Redox Regulation and Innate Immunity
[0262] As described herein, ablation of DHHC3 diminished palmitoylation of ERGIC3, a key regulator of oxidative stress/ER stress. Diminished palmitoylation was accompanied by substantial alteration in ERGIC3 subcellular distribution (
[0263] In
[0264] As shown, subcellular distributions of additional DHHC3 substrates involved in redox regulation (PRDX4 and Niemann-Pick C1 (NPC1)), are also markedly altered (
[0265] Altogether, the results presented herein confirm that 4/4 putative DHHC3 substrates (ERGIC3, CMTM6, NPC1, transmembrane protein 192 (TMEM192)) lose substantial palmitoylation when DHHC3 is ablated. Also, 4/4 substrates (ERGIC3, CMTM6, NPC1, PRDX4) show markedly altered subcellular distribution when DHHC3 is ablated. Hence, 50 of the DHHC3 substrates that have been identified using mass spectrometry are indeed likely to be valid DHHC3 substrates. As described herein, CMTM6 palmitoylation contributes to inhibition of adaptive immunity, whereas palmitoylation of several of the other substrates (especially those involved in redox regulation) contributes to inhibition of innate immunity.
Example 15: Targeting of DHHC3 on Tumor Cells Enhances Anti-Tumor Immunity
[0266] Protein palmitoylation affects protein localization, stability, molecular interactions and functions. Palmitoylation is typically mediated by protein acyl transferases containing conserved DHHC (Asp-His-His-Cys) motifs, needed for enzymatic activity. As described herein, DHHC3 (one of 23 mammalian DHHC enzymes) is upregulated in malignant and metastatic human breast cancer, as well as prostate and colon carcinomas. Elevated zDHHC3 expression correlates with diminished survival in breast cancer and six other human cancers. Furthermore, zDHHC3 ablation in human MDA-MB-231 mammary cell xenografts reduced sizes of both primary tumors and metastatic lung colonies.
Effects on Innate Immunity
[0267] As described herein, in zDHHC3-ablated cells, oxidative stress and senescence were both elevated, as demonstrated by gene array data and fluorescence dye assays. Also, a consequence of elevated senescence was enhanced recruitment of innate immune cells (anti-tumor macrophages, NK cells) associated with clearance of senescent tumors. Anti-tumor effects of zDHHC ablation were reversed upon reconstitution with wild type, but not enzyme active site-deficient DHHC3.
Effects on Adaptive Immunity
[0268] As described herein, ablation of zDHHC3 causes a reduction in expression of immune checkpoint molecule, PD-L1, by 90% in breast and prostate cancer cell lines, with or without stimulation by interferon gamma (INF-). Hence, it is determined whether zDHHC3 ablation markedly upregulates adaptive immunity.
[0269] In conclusion, DHHC3 is an important target in breast cancer and other cancers, because: i) it is upregulated in breast cancer and other cancers, ii) it is neither upregulated in normal tissue, nor needed for normal development, and iii) its removal elevates innate anti-tumor immunity and likely adaptive anti-tumor immunity.
OTHER EMBODIMENTS
[0270] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
[0271] The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
[0272] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.