KLEBSIELLA PNEUMONIAE FROM MINKS AND ITS APPLICATION
20210030861 ยท 2021-02-04
Assignee
Inventors
- Hu Shan (Qingdao, CN)
- Hongliang Zhang (Qingdao, CN)
- Ruimei Yang (Qingdao, CN)
- Chunyun Gai (Qingdao, CN)
- Xiaoming Song (Qingdao, CN)
- Tingting Zhang (Qingdao, CN)
Cpc classification
A61K39/39
HUMAN NECESSITIES
International classification
Abstract
A SD-1 strain of Klebsiella pneumoniae from mink and its application are disclosed, wherein the collection number of the Klebsiella pneumoniae is CGMCC NO: 17901. The Klebsiella pneumoniae SD-1 strain can be used for preparing a vaccine. The preferred form of the vaccine is an inactivated vaccine. The SD-1 strain of Klebsiella pneumoniae was screened from minks that died after vaccination. Compared with the current Klebsiella pneumoniae, the strain has mutated and is a new type of pathogenic strain. Vaccine prepared from the SD-1 strain provides better immune protection for minks.
Claims
1. A vaccine comprising inactivated Klebsiella pneumonia strain SD-1, wherein the SD-1 strain of Klebsiella pneumonia has been deposited in the China General Microbiological Culture Collection Center with accession number CGMCC NO: 17901.
2. The vaccine according to claim 1, wherein the Klebsiella pneumonia comprises the DNA sequence of SEQ ID NO: 1.
3. The vaccine according to claim 1, wherein the vaccine comprises inactivated antigen and vaccine adjuvant.
4. The inactivated vaccine according to claim 3, wherein the vaccine adjuvant is an aqueous vaccine adjuvant.
5. The inactivated vaccine according to claim 3, wherein the vaccine adjuvant is aluminum hydroxide gel.
6. The vaccine according to claim 5, wherein the Klebsiella pneumonia comprises the DNA sequence of SEQ ID NO: 1.
7-20. (canceled)
Description
Embodiment 1: Analysis of Purification and Physicochemical Properties of Isolation of Strains
[0014] In 2018, the symptoms of hemorrhagic pneumonia in mink appeared in a mink farm in Qingdao, but the affected minks had previously been injected with an officially launched triple inactivated vaccine against hemorrhagic pneumoniae P. aeruginosa in minks, Pasteurella multocida and Klebsiella pneumoniae.
[0015] 1) Take a dead mink and use a scalpel to aseptically open the chest and abdominal cavity of the sick and dead mink. Cut the liver of the sick and dead mink to fully expose its internal tissues. Dip the contents of the liver with a sterile cotton swab and then carry out gradient dilution on it with normal saline, then make a streak on the LB solid agar medium, and culture the culture dish with bacteria at 37 C. for 10-12 h. Select single bacterial colonies. Culture each single colony on the urinary tract flora chromogenic medium.
[0016] 2) Strains showing different colors on the chromogenic medium will be inoculated into LB liquid medium as a group of 3 for expanded culture, and then centrifuge it at 4000 rpm to collect bacterial cells. Resuspend the bacterial cells with 0.5% sterile normal saline, and set the bacterial concentration of the strains as 110.sup.7 CFU/mL by turbidimetric method for injection infection.
[0017] 4) Carry out inject infection experiments with healthy minks that have been inoculated with the triple inactivated vaccine against hemorrhagic pneumoniae P. aeruginosa in minks, Pasteurella multocida and Klebsiella pneumoniae. Inject 0.2 mL of bacterial suspension of different strains to be screened into the abdominal cavity, and inject 0.5% sterile normal saline, of the same volume into the control group. For the affected minks, the three single colonies in the combined bacterial suspension will be separately tested for injection infection.
[0018] Finally, a strain that is blue on the urinary tract flora chromogenic medium is determined. Injection infection shows that it will cause the symptoms of hemorrhagic pneumonia in minks who have been injected with the mink hemorrhagic pneumonia vaccine.
[0019] The strain can form grayish white and round raised colonies on the serum LB agar medium. Grain-negative.
[0020] Extract the bacterial DNA with a bacterial genomic DNA extraction kit, perform PCR amplification with the 16S rRNA bacterial identification primers, then go through electrophoresis, recovery, cloning and sequencing, and analyze the sequencing results. Send the PCR amplification products to the sequencing company for sequencing. After sequence alignment on NCBI, the 16S rRNA sequence has the highest homology with Klebsiella, so it is suspected to belong to Klebsiella.
[0021] Since the Khe gene can be used as a target gene for identifying Klebsiella pneumoniae, primer pairs that amplify the Khe gene are used to detect the genomic DNA of the screened strain. The sequence information of the primer pairs is as follows:
TABLE-US-00001 Upstreamprimer: (SEQIDNO:3) 5-TGATTGCATTCGCCACTGG-3 Downstreamprimer: (SEQIDNO:4) 5-GGTCAACCCAACGATCCTG-3
[0022] The amplification results show that positive fragments appear in the strain, which is consistent with 16S rRNA, confirming that the screened strain is Klebsiella pneumoniae and is named SD-1 strain.
[0023] Considering that SD-1 strain will cause disease in minks that have been vaccinated, in order to verify whether the pathogenic gene of SD-1 strain has been mutated, the Klebsiella pneumoniae SD-1 strain and pathogenesis-related rmpA gene, uge gene, magA gene, wabG gene, capsular polysaccharide K2 gene are amplified and sequenced. Use EasyPure Quick Gel Extraction Kit to recover PCR products, connect to pEASY-Blunt Cloning vector or pMD18-T Vector (Promega) to transform Trans-5 competent cells, and then sequence after identification. Use DNAMAN software to deduce the amino acid sequence.
[0024] Perform amino acid homology comparison of the pathogenesis-related gene fragments with the Klebsiella pneumoniae sequences published on GenBank. The results show that the pathogenesis-related uge gene, magA gene, and wabG gene have multiple mutations at the amino acid level, and the nucleotide sequence of rmpA gene is SEQ ID NO: 1 and the amino acid sequence is SEQ ID NO: 2. Compared with what have been reported, the amino acid homology is only 70%, which may be the reason why the immunity of existing Klebsiella genes is not good.
TABLE-US-00002 (SEQIDNO:1) ACTGGGCTACCTCTGCTTAACAAGACATTTGAAGCAGTAAT TAATAAATCAATATTGATGAAGCACAAAAAAAACATAAGAG TATTGGcTGACTGCGGGtTTTTTTATTCATCCACATGGAGA GGGTACAAAATGTTAAGATCCACATTAcATATGATAAGCCA ATGGAcAcGGCTTcATGTTTCGGGGGGGGGGCGGTTTcACC TTTGcAGCAGGTGTGcTTATTACcTtTATGTTAAaATGCAA GATCCACTAAAAAGTATTGGcTcAAAACTATATcTTGCAcT CTcAAAGAAAAATGTACTGGGAATTGTAAAaCATTATCCtC GGCTAACAAAAAAAGAACAATGGATGCTGCAA (SEQIDNO:2) TGLPLLNKTFEAVINKSILMKHKKNIRVLADCGFFYSSTWR GYKMLRSTLHMISQWTRLHVSGGGRFHLCSRCAYYLYVKMQ DPLKSIGSKLYLALSKKNVLGIVKHYPRLTKKEQWMLQ
Embodiment 2: Detection of the Pathogenic Effect of SD-1 Strain
[0025] First, inoculate Klebsiella pneumoniae SD-1 strain on the LB solid plate medium and cultivate it at 37 C. for 24 hours. Then select single colonies to inoculate into the LB liquid medium, stir it at 37 C. in a ventilated environment and then culture it for 24 h, then centrifuge it at 4000 rpm for 10 min to collect the precipitate, then resuspend the precipitate with sterile normal saline, and count the viable bacteria in the suspension. Prepare for animal injection infection experiments.
[0026] Select twenty heads of 30-40 day-old healthy and susceptible minks and randomly divide them into 4 groups with 5 heads in each group. Dilute the fermentation solution of Klebsiella pneumoniae SD-1 strain into three different gradients of 1.010.sup.6 CFU, 4.010.sup.6 CFU/ml and 6.010.sup.6 CFU/ml, and inoculate 2.0 ml into each of the minks of a group and inject 2.0 l of sterile normal saline, into each of the minks of another group as a control.
[0027] Observe for 7-20 days and record the clinical situation. The results show that most minks in the group injected with the fermentation solution experience clinical symptoms of hemorrhagic pneumonia in minks such as increased body temperature, decreased appetite, abdominal breathing, hemoptysis or red foamy liquid from the nostrils or even death. The body temperature of the minks in the control group does not change significantly, and there are no clinical symptoms or death in the group (Table 1).
TABLE-US-00003 TABLE 1 Infectivity of Klebsiella pneumoniae SD-1 Strain Number Challenged Number of Number of of viral challenged infected Group injections dosage bacteria minks SD-1 5 2 ml 1.0 10.sup.6 CFU 4/5 strain incidence 5 2 ml 4.0 10.sup.6 CFU 5/5 incidence 5 2 ml 6.0 10.sup.6 CFU 5/5 incidence Control 5 2 ml Normal 0/5 group saline 1 incidence
[0028] The above results show that the minimum amount of Klebsiella pneumoniae SD-1 strain that can cause the 5/5 incidence of a healthy and susceptible mink 30 to 40 days old is 4.010.sup.6 CFU/ml, which indicates that the strain selected by the present innovation has strong pathogenicity.
Embodiment 3: Preparation of Vaccines using Klebsiella Pneumoniae SD-1 Strain
[0029] 1. Preparation of Inactivated Vaccines:
[0030] First, inoculate Klebsiella pneumoniae SD-1 strain on the LB solid plate medium and cultivate it at 37 C. for 24 hours. Then select single colonies to inoculate into the LB liquid medium, stir it at 37 C. in a ventilated environment and then culture it for 24 h, then add 0.1% formaldehyde solution to the total amount of the bacterial solution, inactivate it for 24 hours, and stir 3 times during this period. Add aluminum hydroxide gel with a volume percentage of 30% into the obtained inactivated bacterial solution to prepare vaccines. Prepare three batches of vaccines in this way.
[0031] Vaccine inactivation test: Take and add 100 l of formaldehyde-inactivated bacterial solution into 3 ml liquid medium, and take three samples per culture and inoculate each sample in three test tubes and observe for five days for inactivated security test, if the liquid medium in the test tubes remains clear without turbidity after five days, it indicates that the prepared vaccines meet the requirements.
[0032] The prepared vaccines are tested without bacterial growth according to page 42 of Appendix of Veterinary Pharmacopoeia of the People's Republic of China (2010 edition).
[0033] Inject the three batches of prepared vaccines into the inner muscles of the hind limbs of healthy minks with three injection volumes of single dose, single dose repeat and overdose. After 10 days of inoculation, the body temperature and appetite of the inoculated minks are normal, there is no swelling and inflammation in the inoculated area, there is no adverse local and systemic immune reactions, and the inoculated minks eat normally, indicating that the vaccines are safe for minks.
[0034] 2. The Immune Effect of the Vaccines
[0035] Randomly divide the 2-3 month-old healthy minks into six groups, 10 heads in each group. There were 40 heads in the vaccine injection groups and 20 in the control groups. Inject 0.2 ml of the 510.sup.7 cfu/mL mink Klebsiella inactivated vaccine prepared in Embodiment 2 into the inner muscles of the hind limbs of each of the 20 minks in the first vaccine injection group. Inject the commercially available triple inactivated vaccine for hemorrhagic pneumonia in mink into the other 20 minks in the second vaccine injection group, and the minks in the control groups are injected with normal saline, only.
[0036] Thirty days after inoculation, conduct infection experiments using CMCC (B) 46117, the standard strain of Klebsiella pneumoniae, ATCC 13883, the mixed strain of Klebsiella pneumoniae, and SD-1 strain, respectively.
[0037] Inoculate infected bacteria into the muscles of minks in the experimental groups and the control groups, feed and observe the minks for 7 days, and record the attack and mortality of the minks in each group. The experimental results are shown in Table 1 and Table 2.
TABLE-US-00004 TABLE 1 Vaccine Immunization Efficacy Data Sheet for Infection with a Mixed Strain of CMCC (B) 46117 and ATCC 13883 Klebsiella pneumoniae Number of Survival challenged minks number Survival Group (head) (head) rate (%) Vaccine group 1 10 9 90 Vaccine group 2 10 10 100 Control group 10 3 30
TABLE-US-00005 TABLE 2 Vaccine Immunization Efficacy Data Sheet for Infection with QDNDSD-1 Strain Number of Survival challenged minks number Survival Group (head) (head) rate (%) Vaccine group 1 10 10 100 Vaccine group 2 10 6 60 Control group 10 2 20
[0038] Results of the above infection experiments show that the inactivated vaccine prepared by the SD-1 strain of the present innovation can provide complete protection against the infection of SD-1 strain. The minks in vaccine group 1 do not show any clinical symptoms and there is no death phenomenon. However, the commercially available vaccine only provides partial protection against infection with the SD-1 strain. Therefore, the vaccine prepared by existing mink Klebsiella can not sufficiently cross-protect the mink Klebsiella SD-1 strain screened by the present innovation, and combined vaccine is needed to be prepared with the QDNDSD-1 strain to provide more complete protection.