A YEAST PHENOTYPIC SCREENING METHOD FOR ISOLATION OF FUNCTIONAL ANTIBODIES AGAINST G-PROTEIN COUPLED RECEPTORS
20210214719 ยท 2021-07-15
Inventors
Cpc classification
C07K16/14
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C12Q1/025
CHEMISTRY; METALLURGY
C07K2317/14
CHEMISTRY; METALLURGY
G01N33/6845
PHYSICS
International classification
C12N15/10
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
Abstract
The present invention provides a method for identifying a functional antibody or antigen-binding protein or a fragment thereof that is capable of binding to, and stimulating the activity of, a target transmembrane protein comprising the steps of providing yeast cells transformed with yeast expression vectors encoding a library of antibodies or antigen-binding proteins or fragments thereof, wherein said yeast cells express said target transmembrane protein, expressing said library of antibodies or antigen-binding proteins or fragments thereof in the yeast cells, wherein said expressed antibodies or antigen-binding proteins or fragments thereof are secreted into the periplasmic space of said yeast cells, incubating the yeast cells in or on a selective medium or under a restrictive temperature, or a combination thereof, and detecting a predetermined phenotype in the yeast cells, wherein detection or manifestation of the predetermined phenotype is indicative of binding of the functional antibody or antigen-binding protein or a fragment thereof to said target transmembrane protein and stimulation of said target transmembrane protein by the functional antibody or antigen-binding protein or a fragment thereof. Antibodies or antibody fragments that are agonists of G-protein coupled receptors identified by the method of the invention are also provided.
Claims
1-29. (canceled)
30. A method for identifying a functional antibody or antigen-binding protein or a fragment thereof that is capable of binding to, and stimulating the activity of, a target transmembrane protein comprising: a) providing yeast cells transformed with yeast expression vectors encoding a library of antibodies or antigen-binding proteins or fragments thereof, wherein said yeast cells express said target transmembrane protein; b) expressing said library of antibodies or antigen-binding proteins or fragments thereof in the yeast cells, wherein said expressed antibodies or antigen-binding proteins or fragments thereof are secreted into the periplasmic space of said yeast cells; c) incubating the yeast cells in or on a selective medium or under a restrictive temperature, or a combination thereof; and d) detecting a predetermined phenotype in the yeast cells, wherein manifestation of the predetermined phenotype is indicative of binding of the functional antibody or antigen-binding protein or a fragment thereof to said target transmembrane protein and stimulation of the activity of said target transmembrane protein by the functional antibody or antigen-binding protein or a fragment thereof.
31. The method of claim 30, wherein the target transmembrane protein is a G-protein coupled receptor, or GPCR.
32. The method of claim 30, wherein the functional antibody or antigen-binding protein or a fragment thereof is an agonist of GPCR.
33. The method of claim 30, wherein the library of antibodies or antigen-binding proteins or fragments thereof is a single-chain variable fragment (scFv), a single domain (VHH), a Fab, a polypeptide or an oligo-peptide library.
34. The method of claim 30, wherein the yeast cells in step a) comprise one or more reporter genes, wherein expression of the one or more reporter genes is inducible by activation of a GPCR-mediated signal transduction pathway; optionally wherein the GPCR-mediated signal transduction pathway is based on the yeast mating pheromone signaling pathway; optionally wherein the one or more reporter genes is an antibiotic resistance gene, a temperature-sensitivity complementing gene, or a fluorescent protein gene, or combinations thereof; and optionally wherein the antibiotic resistance gene is the G418-resistance gene or the zeocin-resistance gene, or both.
35. The method of claim 34, wherein the fluorescent protein gene is the green fluorescent protein gene GFP or the red fluorescent protein gene RFP or the yellow fluorescent protein gene YFP or the blue fluorescent protein gene BFP, or the cyan fluorescent protein gene CFP.
36. The method of claim 30, wherein the predetermined phenotype is cell growth in the presence of one or more antibiotics, or cell growth at a restrictive temperature, or generation of fluorescence due to expression of a reporter fluorescent protein gene, or combinations thereof.
37. The method of claim 30, wherein the target transmembrane protein is expressed on the plasma membrane of the yeast cells.
38. The method of claim 33, wherein the polypeptide or oligo-peptide library is a random or partially random peptide library that is not derived from antibody sequences; optionally wherein the oligo-peptide library comprises peptides longer than 5 amino acids.
39. The method of claim 30, wherein the yeast is Saccharomyces cerevisiae or Schizosaccharomyces pombe.
40. The method of claim 30, wherein a nucleic acid sequence encoding the antibodies or antigen-binding proteins or fragments thereof is operably linked to a yeast promoter; optionally wherein the nucleic acid sequence encoding the antibodies or antigen-binding proteins or fragments thereof further comprises a secretion signal sequence, which facilitates the localization of the said antibodies or antigen-binding proteins or fragments thereof to the periplasmic space of the yeast cells; and optionally wherein the secretion signal sequence is encoded by the FLO1 gene or the yeast mating pheromone gene MF1.
41. The method of claim 30, wherein the antibodies or antigen-binding proteins or fragments thereof are coupled to an anchor element for localization in the periplasmic space of yeast cells; optionally wherein the anchor element is a glycosylphosphatidylinositol (GPI) attachment protein or a transmembrane domain.
42. The method of claim 30, wherein the selective medium comprises one or more antibiotics; optionally wherein the selective medium is used at a temperature range of 30 to 40 C.
43. The method of claim 30, wherein the functional antibody or antigen-binding protein or a fragment thereof is a monoclonal, recombinant, polyclonal, chimeric, humanised, bispecific and heteroconjugate antibodies, a single variable domain, a domain antibody, antigen-binding fragments, immunologically effective fragments, single-chain variable fragments, a single chain antibody, a univalent antibody lacking a hinge region, a minibody, a diabody, a polypeptide or oligo-peptide comprising an amino acid sequence not derived from an antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0039] The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings, in which:
[0040]
[0041]
[0042]
[0043]
[0044]
[0045] Late log phase cultures of different strains of cells growing in YPD at 28 C. were streaked onto YPD plates that contained Zeocin at the indicated concentrations (Z10=10 g/ml, etc.). In parallel, they were also streaked onto a set of Zeocin-containing plates that were supplemented with -factor at 80 ng/ml (bottom row). All plates were then placed at 28 C. The plates were scanned after 3 days of incubation.
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
DETAILED DESCRIPTION OF THE PRESENT INVENTION
[0054] In a first aspect the present invention refers to a method for identifying a functional antibody or antigen-binding protein or a fragment thereof that is capable of binding to, and stimulating the activity of, a target transmembrane protein comprising: [0055] a) providing yeast cells transformed with yeast expression vectors encoding a library of antibodies or antigen-binding proteins or fragments thereof, wherein said yeast cells express said target transmembrane protein; [0056] b) expressing said library of antibodies or antigen-binding proteins or fragments thereof in the yeast cells, wherein said expressed antibodies or antigen-binding proteins or fragments thereof are secreted into the periplasmic space of said yeast cells; [0057] c) incubating the yeast cells in or on a selective medium or under a restrictive temperature, or a combination thereof; and [0058] d) detecting a predetermined phenotype in the yeast cells, wherein manifestation or detection of the predetermined phenotype is indicative of binding of the functional antibody or antigen-binding protein or a fragment thereof to said target transmembrane protein and stimulation of the activity of said target transmembrane protein by the functional antibody or antigen-binding protein or a fragment thereof.
[0059] In one embodiment, the target transmembrane protein is a G-protein coupled receptor, or GPCR.
[0060] In another embodiment, the functional antibody or antigen-binding protein or a fragment thereof is an agonist of GPCR.
[0061] In one embodiment, the yeast cells in step a) may comprise one or more reporter genes, wherein expression of the one or more reporter genes is inducible by activation of a GPCR-mediated signal transduction pathway. In a preferred embodiment, the GPCR-mediated signal transduction pathway is based on the yeast mating pheromone signaling pathway. It will generally be understood that the one or more reporter genes may be induced by the yeast mating pheromone signaling pathway. In some embodiments, the reporter gene may be an antibiotic resistance gene, a temperature-sensitivity-complementing gene, a fluorescent protein gene, or combinations thereof. Suitable antibiotic resistance genes, temperature-sensitivity-complementing genes and fluorescent genes that may be employed in the present invention would be known to a person skilled in the art. In a preferred embodiment, the antibiotic resistance gene is the G418-resistance gene (neoR) or the zeocin resistance gene (zeoR). In another preferred embodiment, the temperature-sensitivity-complementing gene is CDC26. In yet another preferred embodiment, the fluorescent protein genes are GFP, RFP, YFP, BFP, or CFP. In yet another preferred embodiment, the reporter gene is LacZ.
[0062] In one embodiment, the predetermined phenotype is cell growth in the presence of one or more antibiotics due to expression of the reporter antibiotic resistance genes, cell growth at a restrictive temperature due to expression of the reporter temperature-sensitivity-complementing genes, generation of fluorescence due to expression of the reporter fluorescent protein genes, or combinations thereof. In a preferred embodiment, the reporter antibiotic resistance genes are the G418 resistance gene neoR and the Zeocin resistance gene zeoR. In another preferred embodiment, the reporter temperature-sensitivity-complementing gene is CDC26 and the restrictive temperature may be between about 30 C. and about 40 C. In yet another preferred embodiment, the fluorescent protein genes are GFP, RFP, YFP, BFP, or CFP.
[0063] In some embodiments, the target transmembrane protein in step a) is a G-protein coupled receptor, or GPCR. In one embodiment, the target transmembrane protein is the Ste2 protein of the yeast Saccharomyces cerevisiae. In another embodiment, the target transmembrane protein is the human GPCR receptor GLP-1R.
[0064] In one embodiment, the antigen-binding protein is an antibody-related molecule capable of interacting with target antigens and possesses one or more complementarity-determining regions (CDRs). In another embodiment, the antigen-binding protein is a polypeptide or oligo-peptide capable of interacting with target antigens and comprises of an amino acid sequence not derived from an antibody. In a preferred embodiment, the antigen-binding protein is a single-chain variable fragment (scFv) or an antigen-binding fragment (Fab).
[0065] In one embodiment, the functional antibody or antigen-binding protein or a fragment thereof is a G-protein coupled receptor agonist.
[0066] In one embodiment, the target transmembrane protein (e.g. a GPCR) may be expressed on the plasma membrane of the yeast cells. It will generally be understood that binding of an agonist to the target transmembrane protein stimulates the cellular activity of said target transmembrane protein and elicits downstream cellular responses such as a signal transduction pathway in the case of GPCR which leads to the expression of the one or more reporter genes. Accordingly, in one embodiment, the expression of the one or more reporter genes is induced by binding of an agonist to the target transmembrane protein.
[0067] The method of the invention also involves expressing a library of antibodies or antigen-binding proteins or fragments thereof in yeast cells, particularly in the periplasmic space of the yeast cells. The library of antibodies or antigen-binding proteins or fragments thereof may comprise single-chain variable fragment (scFv), disulfide-linked variable fragment (sdFv), Fab fragments and F (ab) fragments, V.sub.HdAb or cFvs. In one embodiment, the library of antibodies or antigen-binding proteins or fragments thereof may comprise single-chain variable fragment (scFv), single domain (VHH), Fab fragments, polypeptide or oligo-peptides. In another embodiment, the peptide or oligo-peptide library is a random or partially random peptide library that is not derived from antibody sequences.
[0068] In another embodiment, the nucleic acid sequence encoding the antibodies or antigen-binding proteins or fragments thereof further comprises a secretion signal sequence, which facilitates the localization of the said antibodies or antigen-binding proteins or fragments thereof to the periplasmic space of the yeast cells.
[0069] The secretion signal sequence may be that of the yeast mating pheromone alpha factor ( factor) or that of the Flo1p, Suc2p, or Aga2p. In a preferred embodiment, the secretion signal sequence may be encoded by the yeast mating pheromone alpha factor gene MF1 or the FLO1 gene.
[0070] In some embodiments, the antibodies or antigen-binding proteins or fragments thereof may be coupled to an anchor element to be retained in the periplasmic space of the yeast cells. In another embodiment, the antibodies or antigen-binding proteins or fragments thereof may be fused with a transmembrane domain to be retained in the periplasmic space of the yeast cells. In a preferred embodiment, the anchor protein may be a glycosylphosphatidylinositol (GPI)-attachment protein or a transmembrane domain. In one embodiment, the antibodies or antigen-binding proteins or fragments thereof may be further linked to a tag. Examples of such tags include but are not limited to polyhistidine, gluthathione S-transferase, calmodulin binding peptide, intein-chitin binding domain, streptabidin/biotin based tags, tandem affinity purification tags. In a preferred embodiment, the tag is an epitope tag. In a further preferred embodiment, the epitope tag is a FLAG tag or a 6HIS tag.
[0071] Assembly of the library may be performed using methods known in the art. The library of antibodies or antigen-binding proteins or fragments thereof may be inserted into a plasmid vector such as pKT047, pKT103, or pKT131. In one embodiment, the nucleic acid sequence encoding the antibodies or antigen-binding proteins or fragments thereof is operably linked to a yeast promoter. In a preferred embodiment, the promoter may be a constitutive promoter such as the TEF1 promoter, or an inducible promoter such as the GAL1 promoter.
[0072] It will generally be understood that the library may be constructed from a variety of cell sources. For example, the library may be constructed from animal bone marrow cells, spleen and lymph node cells, or circulating white blood cells. In a preferred embodiment, the library may be constructed from human peripheral blood mononuclear cells.
[0073] The library may have a diversity or complexity in the range of 10.sup.5 to 10.sup.12, for example, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, or 10.sup.12. In a preferred embodiment, the diversity of the library of single-chain variable fragment (scFv), single domain (VHH) or Fab fragments is greater than 10.sup.7. In another preferred embodiment, the diversity of the polypeptides or oligo-peptides is greater than 10.sup.5. These numbers refer to the diversity of the original library that has not gone through any forms of target-directed enrichment.
[0074] In some embodiments, the oligo peptide library comprises peptides longer than 5 amino acids.
[0075] The yeast cells of the present invention may be transformed by methods generally known in the art. In one embodiment, the yeast cells may be transformed by gap-repair transformation. In other embodiments, transformation of yeast is done with a pre-made library in a plasmid form by electroporation or the heat-shock method.
[0076] The yeast cells of the present invention may be budding or filamentous yeast cells. Examples of yeast cells include but are not limited to Saccharomyces cerevisiae, Schizosaccharomyces pombe, Candida albicans, Pichia pastoris and Aspergillus species. In one embodiment, the yeast may be Saccharomyces cerevisiae, Schizosaccharomyces pombe or Pichia pastoris. In a preferred embodiment, the yeast is Saccharomyces cerevisiae or Schizosaccharomyces pombe.
[0077] Yeast cells of the present invention may be cultured using media and conditions generally known in the art. Culture media and culture conditions may be modified to select for one or more predetermined phenotypes. Selective media may comprise one or more antibiotics. In one embodiment, the selective media may comprise zeocin and/or G418 antibiotics. Selective media may also be at a temperature range of about 25-40 C., for example, about at least about 25.5 C., about 26 C., about 26.5 C., about 27 C., about 27.5 C., about 28 C., about 28.5 C., about 29 C., about 29.5 C., about 30 C., about 30.5 C., about 31 C., about 31.5 C., about 32 C., about 32.5 C., about 33 C., about 33.5 C., about 34 C., about 34.5 C., about 35 C., about 35.5 C., about 36 C., about 36.5 C., about 37 C., about 37.5 C., about 38 C., about 38.5 C., about 39 C., about 39.5 C. and about 40 C. In a preferred embodiment, the selective media is at a temperature of between about 30 C. to about 40 C.
[0078] In one embodiment, the functional antibody or antigen-binding protein or a fragment thereof is a monoclonal, recombinant, polyclonal, chimeric, humanised, bispecific and heteroconjugate antibodies, a single variable domain, a domain antibody, antigen-binding fragments, immunologically effective fragments, single-chain variable fragments, a single chain antibody, a univalent antibody lacking a hinge region, a minibody, a diabody, a polypeptide or oligo-peptide comprising an amino acid sequence not derived from an antibody.
[0079] The present invention also provides an antibody or antigen-binding protein or a fragment thereof that is an agonist of a GPCR identified according to the method of the present invention, wherein the GPCR is human GLP-1R, or the yeast -factor receptor Ste2p.
[0080] The present invention also provides an antibody or antigen-binding protein identified by the method as disclosed herein comprising (i) a heavy chain variable domain comprising a VHCDR1 having the amino acid sequence GYSFTSYW (SEQ ID NO: 1); a VHCDR2 having the amino acid sequence IYPGDSDT (SEQ ID NO: 2); and a VHCDR3 having the amino acid sequence CARLGYYDSSGYYSEDY (SEQ ID NO: 3); and (ii) a light chain variable domain comprising a VLCDR1 having the amino acid sequence SGRSGFA (SEQ ID NO: 4), a VLCDR2 having the amino acid sequence VNSDGSH (SEQ ID NO: 5), and a VLCDR3 having the amino acid sequence QTWGTGIWV (SEQ ID NO: 6).
[0081] In one embodiment, the antibody or antigen-binding protein comprises a heavy chain variable region which comprises the amino acid sequence
TABLE-US-00001 (SEQIDNO:7) QVQLVQSGAEVKKPGEPLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGI IYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLG YYDSSGYYSEDYWGQGTLVTVSSGSASAPTL,
and a light chain variable region which comprises the amino acid sequence
TABLE-US-00002 (SEQIDNO:8) QPVLTQSSSASASLGASVKLTCTLSSGRSGFAIAWHQQHPEKGPRYLMNV NSDGSHTKGDGIPDRFSGSSSEAERYLTISSLQFDDEVDYYCQTWGTGIW VFGGGTKLTVLRQPKAAPSVTLFPAVL.
[0082] It will be generally understood that variation in the CDR, variable heavy chain and variable light chain sequences can exist. In some embodiments, the antibody or antigen-binding protein or a fragment thereof comprises heavy and light chain CDR regions that are about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98% or about 99% identical to the heavy and light chain CDR regions of (i) and (ii).
[0083] In other embodiments, the antibody or antigen-binding protein, or a fragment thereof comprises a heavy chain variable region and a light chain variable region that are about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98% or about 99% identity to the amino acid sequence set forth in SEQ ID NO: 7 and 8 respectively.
[0084] As used herein, the percent homology between two amino acid sequences is equivalent to the percent identity between the two sequences. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions/total # of positions100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
[0085] The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms comprising, including, containing, etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
[0086] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0087] Other embodiments are within the following claims and non-limiting examples. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.
EXPERIMENTAL SECTION
[0088] Non-limiting examples of the invention and comparative examples will be further described in greater detail by reference to specific Examples, which should not be construed as in any way limiting the scope of the invention.
[0089] Materials and Methods
[0090] Yeast Strains, Vectors, and Growth Conditions
[0091] All yeast strains used in this study were derived from BJ5465, and their genotypes were listed in Table 1. Gene deletions and integrations were done using a recyclable URA3 cassette. For construction of YKT068, the SST2, FAR1, and CDC26 genes in BJ5465 were deleted sequentially, and a 650 bp fragment of the CDC26 gene from the Start codon was amplified from wildtype genomic DNA by PCR and cloned into an integration vector and inserted immediately downstream of the FUS2 promoter in the genome. This was followed by inserting a GFP coding sequence preceded by the FIG1 promoter region (600 to 1) into the HIS3 sequence which was at the pep4 locus in BJ5465. The coding sequence of the STE2 gene in YKT068 was additionally deleted to make YKT069. The promoter region of STE2, however, was not affected by the deletion. The genomic coding sequence of FIG1 in YKT068 was replaced by the LacZ coding sequence to make YKT109. YKT099 and YKT112 were made from YKT068 and YKT069, respectively, by inserting a FIG1 promoter driven-neomycin resistance gene (neoR) at the ADE2 locus. Similarly, YKT113 and YKT114 were made from YKT068 and YKT069, respectively, by inserting a FIG1 promoter driven-Zeocin resistance gene (Sh ble, or zeoR) at the ADE2 locus.
TABLE-US-00003 TABLE 1 summarizes the yeast strains generated in this study. Strain Genotype (BJ5465) MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::HIS3 YKT068 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::his3::pFIG1::GFP sst2far1 cdc26 pFUS2::CDC26 YKT069 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::his3::pFIG1::GFP sst2far1 cdc26 ste2 pFUS2::CDC26 YKT099 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::his3::pFIG1::GFP sst2far1 cdc26 ade2:: pFIG1::neoR pFUS2::CDC26 YKT106 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::his3::pFIG1::GFP sst2far1 cdc26 pFUS2::CDC26 ade2::pFIG1::neoR ste2 pSTE2::GLP-1R YKT109 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::his3::pFIG1::GFP sst2far1 cdc26 pFUS2::CDC26 pFIG1::LacZ YKT112 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::his3::pFIG1::GFP sst2far1 cdc26 ste2 ade2::pFIG1::neoR pFUS2::CDC26 YKT113 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::HIS3 sst2 far1 cdc26 ade2::pFIG1::zeoR pFUS2::CDC26 YKT114 MATa ura3-52 trp1 leu2-1 his3-200 prb1-1.6R can1 pep4::HIS3 sst2 far1 cdc26 ste2 ade2::pFIG1::zeoR pFUS2::CDC26
[0092] To create the GLP-1R expression strains, the last 15 nucleotides of the coding sequence before the stop codon of the GPA1 gene in the chromosomes of YKT069 was changed from AAAATTGGTATTATA (SEQ ID NO: 9) to CAATACGAACTCTTA (SEQ ID NO: 10) by direct replacement using a PCR product. The resulting strain was used for integration of a cloned DNA construct containing the pre-pro alpha factor signal peptide (PPASP) joined to the N-terminus of human GLP-1R without its native signal peptide sequence, and followed by the TEF1 terminator sequence. The integration was directed to occur at the ste2 locus in such a way that the start codon of PPASP-GLP-1R sequence was placed immediately downstream of the STE2 promoter. The resulting strain was subsequently integrated with the FIG1 promoter driven-neoR at the ADE2 locus to generate YKT106.
[0093] All vectors used in this study were derived from the common shuttle vector pRS315, and those with the prefix of pKT were listed in Table 2. To make pKT047, the oligonucleotide sequence encoding the Flo1p signal peptide (Flo1SP) with a PmeI site added immediately upstream of the ATG codon was cloned into the Spe-NotI site of pRS315 with the NotI site downstream of the SP sequence to generate pRS315-Flo1SP. A 490 bp DNA fragment of the TEF1 promoter (pTEF1) was obtained by PCR and cloned into SmaI-Spe site of pRS315-Flo1SP, placing pTEF1 immediately upstream of Flo1SP to generate pTEF1-Flo1SP. pKT047 was completed by cloning a chemically synthesized DNA fragment comprising a 342 bp CH1 domain, followed by a SacII restriction site, a V5 epitope tag, a 171 bp GPI anchor from Flo1p with a flexible linker, and a 146 bp HISS terminator sequence, into the NotI-SacI site of pTEF1-Flo1SP (
TABLE-US-00004 TABLE 2 summarizes the plasmids generated in this study. Name Originated from Description pKT047 pRS315 scFv library expression vector with a GPI anchor. pKT103 pRS315 scFv library expression vector without a GPI anchor. pKT112 pKT103 Q5 in pKT103. pKT113 pKT047 Q5 in pKT047. pKT119 pKT112 Q5 in pKT112 fused with GFP at the C-terminus. pKT131 pKT103 scFv library expression vector with MF1 signal peptide.
[0094] Rich (YPD), synthetic complete (SC), and dropout media were prepared according to the standard methods. Antibiotics were added to the medium shortly after autoclaving. The -factor containing plates were made by spreading aqueous -factor solution on the YPD plates which were estimated to contain 25 ml of medium per plate. The temperature-sensitive mutant was propagated at the permissive temperature of 28 C. and analysed at 37 C. or as indicated in the text.
[0095] RT-qPCR
[0096] The total RNA was isolated from yeast cells using QIAGEN RNeasy minikit following the instruction of the manufacturer. cDNA was synthesized using the iScript reverse transcription supermix for RT-qPCR (Bio-Rad). RT-PCR reactions were performed using SsoAdvanced Universal SYBR Green Supermix and the CFX Connect Real-Time PCR Detection System from Bio-Rad. The amplification conditions was 30 sec at 95 C., followed by 40 cycles of 5 sec at 95 C. and 30 sec at 60 C. The primers used to detect the expression of ACT1 (as the internal control), FUS1 and neoR were: ACT1-RT-5: 5-ATTCTGAGGTTGCTGCTTTGG-3 (SEQ ID NO: 11), ACT1-RT-3: 5-TGTCTTGGTCTACCGACGATAG-3 (SEQ ID NO: 12); FUS1-RT-5: 5-TCGCCGCAATGTCTACTACC-3 (SEQ ID NO: 13), FUS1-RT-3: 5-GCCCAATTGTGCTTGCTGAA-3 (SEQ ID NO: 14); Neo-RT-5: 5-TGCCTGCTTGCCGAATATC-3 (SEQ ID NO: 15), Neo-RT-3: 5-ATATCACGGGTAGCCAACGC-3 (SEQ ID NO: 16), respectively. The delta-delta CT method was used to calculate the relative mRNA expression levels in the test and control cells.
[0097] Construction of Human Antibody Libraries
[0098] The human mononuclear cells (MNCs) were purchased from Stemcell Technologies (Singapore, Cat. 70025). Total RNA was extracted by the TRIzol reagent (Invitrogen, Cat. 15596-026). 10.sup.8 cells were suspended in 1 ml of TRIzol and incubated at room temperature for 5 min with occasional inversion of the tube. 0.2 ml of chloroform was added and the tube was vortexed for 15 seconds and left at room temperature for 3 min before centrifuged at 12,000 g for 15 min at 4 C. The aqueous phase was transferred to a fresh 1.5 ml tube and 0.5 ml of isopropanol was added. After 10 min of incubation at room temperature, RNA was pelleted by centrifugation at 12,000 g for 10 min at 4 C. The pellet was washed with 1 ml of 75% ethanol and recollected by centrifugation at 7,500 g for 5 min at 4 C. The pellet was air-dried for 10 min at room temperature and dissolved in 30 l of DEPC water. The tubes were left at 58 C. in a heat block for 10 min to dissolve the RNA. The mRNA was isolated from the total RNA by using Oligotex mRNA Mini Kit (Qiagen, Cat. 70022) according instructions of the manufacturer.
[0099] Additional polyA-mRNA made from human peripheral leukocytes was purchased from Clontech (Cat. 636170). The mRNAs from both sources were evaluated by PCR of 9 house-keeping gene transcripts and were confirmed to be in a good quality. They were thus combined for use in the library construction.
[0100] PCR and assembly of scFv libraries were essentially according the published protocol. The primers for making scFv libraries were listed in Table 3. First strand cDNA was generated from the mRNA mixtures of the two sources mentioned above, using SuperScript III reverse transcriptase (Life Technologies, Cat. 18080) and random hexamer primers. The genes for variable regions of heavy chain, light chain , and light chain (VH, V, and V) were amplified separately by PCR using GoTaq DNA polymerase (Promega, Cat. M3001). The products of this first round of PCR were then used as the templates for the second round of PCR, in which the 5 primers of the light chain and the 3 primers of the heavy chain shared an overlapping sequence of the linker region. In addition, a FLAG epitope tag was attached to the 3 primers of the light chain, and a partial sequence of the signal peptide of FLO1 was included in the 5 primers of the heavy chain. The PCR reactions for each of the variable regions were performed in a volume of 50 l, and were first heated at 95 C. for 2 min, and then followed by 30 cycles of 95 C. for 30 sec, 57 C. for 1 min, 72 C. for 1 min and finished by a final extension at 72 C. for 5 min. In the third round of PCR, heavy and light chains were assembled and amplified with the 5 and 3 outer primers. The assembly PCR reactions contained equal molar mixture of the pooled heavy (VH) DNA and pooled light (V, or V) gene repertoires from the second round of PCR and was allowed to cycle 8 times (95 C. for 45 sec, 58 C. for 30 sec, and 72 C. for 60 sec) without primers. This was followed by the final round of PCR which was cycled 25 times (95 C. for 30 sec, 58 C. for 30 sec, and 72 C. for 60 sec) with the outer primers, and plus a final extension at 72 C. for 15 min. The final PCR reaction created a full-length scFv gene repertoire. The scFv repertoires were subjected to agarose gel electrophoresis and the DNA bands in the desired length were purified from the gel using the EZ-10 Spin Column DNA Gel Extraction Kit (Bio Basic, Singapore, Cat. B S654).
[0101] Table 3 summarizes the primers for scFv library construction.
TABLE-US-00005 FirstroundPCRprimers(VH): HM1 5-CAGGTBCAGCTGGTGCAGTCTGG-3(SEQIDNO:17) HM1/7 5-CARRTSCAGCTGGTRCARTCTGG-3(SEQIDNO:18) HM2 5-CAGRTCACCTTGAAGGAGTCTGG-3(SEQIDNO:19) HM3A 5-SARGTGCAGCTGGTGGAGTCTGG-3(SEQIDNO:20) HM3B 5-GAGGTGCAGCTGKTGGAGWCYSG-3(SEQIDNO:21) HM4A 5-CAGGTGCARCTGCAGGAGTCGGG-3(SEQIDNO:22) HM4B 5-CAGSTGCAGCTRCAGSAGTSSGG-3(SEQIDNO:23) HM5 5-GARGTGCAGCTGGTGCAGTCTGG-3(SEQIDNO:24) HM6 5-CAGGTACAGCTGCAGCAGTCAGG-3(SEQIDNO:25) HMR 5-AAGGGTTGGGGCGGATGCACT-3(SEQIDNO:26) FirstroundPCRprimers(VLkappa): LCK1A 5-GACATCCAGATGACCCAGTCTCC-3(SEQIDNO:27) LCK1B 5-GMCATCCRGWTGACCCAGTCTCC-3(SEQIDNO:28) LCK2 5-GATRTTGTGATGACYCAGWCTCC-3(SEQIDNO:29) LCK3 5-GAAATWGTGWTGACRCAGTCTCC-3(SEQIDNO:30) LCK4 5-GACATCGTGATGACCCAGTCTCC-3(SEQIDNO:31) LCK5 5-GAAACGACACTCACGCAGTCTCC-3(SEQIDNO:32) LCK6 5-GAWRTTGTGMTGACWCAGTCTCC-3(SEQIDNO:33) LCKR1 5-ACACTCTCCCCTGTTGAAGCTCTT-3(SEQIDNO:34) FirstroundPCRprimers(VLlambda): LCL1A 5-CAGTCTGTGCTGACTCAGCCACC-3(SEQIDNO:35) LCL1B 5-CAGTCTGTGBTGACGCAGCCGCC-3(SEQIDNO:36) LCL2 5-CARTCTGCCCTGACTCAGCCT-3(SEQIDNO:37) LCL3A 5-TCCTATGWGCTGACWCAGCCACC-3(SEQIDNO:38) LCL3B 5-TCTTCTGAGCTGACTCAGGACCC-3(SEQIDNO:39) LCL4A 5-CACGTTATACTGACTCAACCGCC-3(SEQIDNO:40) LCL4B 5-CAGCYTGTGCTGACTCAATCRYC-3(SEQIDNO:41) LCL4C 5-CTGCCTGTGCTGACTCAGCCC-3(SEQIDNO:42) LCL5 5-CAGSCTGTGCTGACTCAGCC-3(SEQIDNO:43) LCL6 5-AATTTTATGCTGACTCAGCCCCA-3(SEQIDNO:44) LCL7/8 5-CAGRCTGTGGTGACYCAGGAGCC-3(SEQIDNO:45) LCL9/10 5-CWGCCWGKGCTGACTCAGCCMCC-3(SEQIDNO:46) LCLR1 5-TGAACATTCTGTAGGGGCCACTG-3(SEQIDNO:47) LCLR2 5-TGAACATTCCGTAGGGGCAACTG-3(SEQIDNO:48) SecondroundPCRprimers(VH): FLO1SP-HM1 5-GCACTAATTAATGTGGCCTCAGGACAGGTBCAGCTGGTGCAGTCTGG-3(SEQIDNO:49) FLO1SP-HM1/7 5-GCACTAATTAATGTGGCCTCAGGACARRTSCAGCTGGTRCARTCTGG-3(SEQIDNO:50) FLO1SP-HM2 5-GCACTAATTAATGTGGCCTCAGGACAGRTCACCTTGAAGGAGTCTGG-3(SEQIDNO:51) FLO1SP-HM3A 5-GCACTAATTAATGTGGCCTCAGGASARGTGCAGCTGGTGGAGTCTGG-3(SEQIDNO:52) FLO1SP-HM3B 5-GCACTAATTAATGTGGCCTCAGGAGAGGTGCAGCTGKTGGAGWCYSG-3(SEQIDNO:53) FLO1SP-HM4A 5-GCACTAATTAATGTGGCCTCAGGACAGGTGCARCTGCAGGAGTCGGG-3(SEQIDNO:54) FLO1SP-HM4B 5-GCACTAATTAATGTGGCCTCAGGACAGSTGCAGCTRCAGSAGTSSGG-3(SEQIDNO:55) FLO1SP-HM5 5-GCACTAATTAATGTGGCCTCAGGAGARGTGCAGCTGGTGCAGTCTGG-3(SEQIDNO:56) FLO1SP-HM6 5-GCACTAATTAATGTGGCCTCAGGACAGGTACAGCTGCAGCAGTCAGG-3(SEQIDNO:57) LLink-HMR 5-GGAAGATCTAGAGGAACCACCAAGGGTTGGGGCGGATGCACT-3(SEQIDNO:58) SecondroundPCRprimers(VLkappa): LLink-LCK1A 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGACATCCAGAT GACCCAGTCTCC-3(SEQIDNO:59) LLink-LCK1B 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGMCATCCRGWT GACCCAGTCTCC-3(SEQIDNO:60) LLink-LCK2 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGATRTTGTGAT GACYCAGWCTCC-3(SEQIDNO:61) LLink-LCK3 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGAAATWGTGWT GACRCAGTCTCC-3(SEQIDNO:62) LLink-LCK4 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGACATCGTGAT GACCCAGTCTCC-3(SEQIDNO:63) LLink-LCK5 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGAAACGACACT CACGCAGTCTCC-3(SEQIDNO:64) LLink-LCK6 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGGAWRTTGTGMT GACWCAGTCTCC-3(SEQIDNO:65) FLAG-LCKR2 5-CTTGTCGTCATCGTCTTTGTAGTCGAAGACAGATGGTGCAGCCACAG7-3 (SEQIDNO:66) SecondroundPCRprimers(VLlambda): LLink-LCL1A 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGTCTGTGCT GACTCAGCCACC-3(SEQIDNO:67) LLink-LCL1B 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGTCTGTGBT GACGCAGCCGCC-3(SEQIDNO:68) LLink-LCL2 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCARTCTGCCCT GACTCAGCCT-3(SEQIDNO:69) LLink-LCL3A 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGTCCTATGWGCT GACWCAGCCACC-3(SEQIDNO:70) LLink-LCL3B 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGTCTTCTGAGCT GACTCAGGACCC-3(SEQIDNO:71) LLink-LCL4A 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCACGTTATACT GACTCAACCGCC-3(SEQIDNO:72) LLink-LCL4B 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGCYTGTGCT GACTCAATCRYC-3(SEQIDNO:73) LLink-LCL4C 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCTGCCTGTGCT GACTCAGCCC-3(SEQIDNO:74) LLink-LCL5 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGSCTGTGCT GACTCAGCC-3(SEQIDNO:75) LLink-LCL6 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGAATTTTATGCT GACTCAGCCCCA-3(SEQIDNO:76) LLink-LCL7/8 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGRCTGTGGT GACYCAGGAGCC-3(SEQIDNO:77) LLink- 5-GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGCWGCCWGKGCT LCL9/10 GACTCAGCCMCC-3(SEQIDNO:78) FLAG-LCLR3 5-CTTGTCGTCATCGTCTTTGTAGTCAGAGGASGGYGGGAACAGAGTGAC-3 (SEQIDNO:79) Outerprimers: 5outer 5-ATCTCAGCGGCCGCACTAATTAATGTGGCCTCAGGA-3(SEQIDNO:80) NotI 3outer 5-CGCAGTAAGCTTGTCGTCATCGTCTTTGTAGTC-3(SEQIDNO:81) HindIII
[0102] To clone the full-length scFv DNA into pRS315, the final scFv PCR products and pRS315 were each digested with NotI and HindIII at 37 C. for overnight. The digested scFv DNA and vector were then purified with EZ-10 Spin Column as mentioned above, and mixed together in a ligation reaction at a vector/insert molar ratio of 1:3, and left at room temperature for overnight with the T4 DNA ligase (NEB, Cat. M0202). The ligated DNA was transduced into the E. coli Top10 cells by electroporation using a MicroPulser Electroporator (Bio-Rad). The cells were then transferred into 2YT broth and incubated with shaking for 1 hr at 37 C. 20 l of the culture was taken for serial dilutions and plating on 2YT plates for colony counting. The rest of the culture was allowed to incubate for additional 2 hrs. The cells were then collected and resuspended in 2YT, aliquoted, and stored at 80 C. as glycerol stocks. Aliquots of the cell were taken for DNA preparation by Gene JET Plasmid Maxiprep Kit (Thermo Fisher Scientific, Cat. K0491) when needed.
[0103] To generate a pre-made antibody library in the yeast vector pKT131, the final PCR reaction that created a full-length scFv gene repertoire described above was performed with outer primers containing NotI and AscI sites, respectively. The PCR product was digested overnight at 37 C. with NotI and AscI, and ligated with the pKT131 vector similarly digested with the restriction enzymes at a vector/PCR product ratio of 1:3. The ligated DNA was then introduced into E. coli Top10 cells by electroporation. 510.sup.9 independent clones were obtained.
[0104] Antibody Library Screening
[0105] Transformation by Gap-Repair:
[0106] The scFv library made in pRS315 was amplified by PCR using the DreamTaq DNA Polymerase (Thermo Fisher Scientific). The following mixtures were prepared in a 50 l of reaction on ice: 5 l of 10 DreamTaq Buffer, 1 l of dNTP Mix (final 200 M), 2.5 l of gap repair forward primer (5ATGTTTTTGGCAGTCTTTACACTTCTGGCACTAATTAATGTGGCCTCAGGA3 (SEQ ID NO: 82), final 0.5 M), 2.5 l of gap repair reverse primer (5GATAAGATTTAAATATAAAAGATATGCAACTAGAAAAGTCTTATCAATCTCCG GATCCTCATTACTTGTCGTCATCGTCTTTGTAGTC3 (SEQ ID NO: 83), final 0.5 M), 10 l (100 ng) of pRS315-scFv library DNA, 0.25 l (1.25 U) of DreamTaq DNA Polymerase, and 28.75 l of H.sub.2O. The mixtures were first heated at 95 C. for 2 min, followed by 5 cycles of 95 C. for 30 sec, 58 C. for 30 sec, 72 C. for 1 min and followed by 25 cycles of 95 C. for 30 sec, 65 C. for 30 sec, 72 C. for 65 sec, and concluded with a final extension at 72 C. for 6 min. The amplified scFv (900 bp) was purified by agarose gel electrophoresis as mentioned above.
[0107] To prepare the host cell for transformation, the overnight cultures of a yeast strain (YKT099, for example) in YPD at 28 C. was diluted into 50 ml of fresh YPD at the density of OD.sub.600=0.3, and was allowed to grow for another 5-6 hrs at 28 C., till OD.sub.600 reached 1.3-1.6. The cells were collected by centrifugation at 3,000 g for 4 min at 4 C. and washed twice with 50 ml of ice-cold water and once with ice-cold electroporation buffer (1 M Sorbitol, 1 mM CaCl.sub.2). The cells were then pelleted and resuspended in 20 ml of 0.1 M LiAc, 10 mM DTT, and incubated at 28 C. with shaking for 30 min. The cells were collected by centrifugation at 3,000 g for 4 min and washed once with the ice-cold electroporation buffer, resuspended in 0.5 ml of the ice-cold electroporation buffer, and kept on ice till use.
[0108] To 400 l of the yeast competent cells add 4 g of the NotI-SacII digested pKT103 DNA and 12 g of the PCR-amplified scFv DNA, and transfer the mixture to a pre-chilled 0.2 cm cuvette. Keep the cuvette on ice for 5 minutes before the electroporation, which was done at 2.5 kV and 25 F with a MicroPulser Electroporator (Bio-Rad). Transfer the cells to 8 ml of 1:1 mix of 1 M sorbitol/YPD media and incubate the cells at 28 C. for 1 hr with mild shaking. The cells were pelleted at 3,000 g for 5 min and resuspended in 20 ml of 2YPD media. Plate 10-fold serial dilutions on Leu-dropout plates for transformation efficiency measurement. The rest of the cells were pelleted and resuspended in 2 ml of leucine dropout medium (SC-Leu) and 200 l of the suspension were taken to spread on each SC-Leu plates supplemented with either 200-400 g/ml of G418 to be incubated at 30 C., or 20-40 g/ml of G418 to be incubated at 37 C.
[0109] Transformation of Pre-Made Libraries:
[0110] Inoculate an aliquot of the overnight culture into 50 ml of YPD media at OD.sub.600=0.4. Grow the cells for 4.5-5 hours. The cells are collected by centrifugation at 3000 g for 3 min and washed twice with ice-cold water and once with ice-cold 1 M Sorbitol. Re-suspend the cell pellet in 20 ml of 0.1 M LiAc/10 mM DTT and incubate at 30 C. for 30 min. Cells are pelleted and washed once with ice-cold 1 M Sorbitol, and re-suspended in 1 M Sorbitol to a final volume of 400 l.
[0111] Add 10 g of library DNA for each 400 l of cells. Mix gently and transfer the mixture to a pre-chilled BioRad GenePulser cuvette (0.2 cm). Leave the cuvette on ice for 5 min until electroporation. Electroporate the cells at 1.5 kV (typically for 3.5 to 4.5 milliseconds). Transfer the cells immediately from the cuvette to 20 ml of YPD containing 0.5 M sorbitol. Incubate the cells at 30 C. for 1 hour before plating on selective media.
Example 1
[0112] Brief Overview of the Platform
[0113] The platform illustrated in
Example 2
[0114] Construction of Library, Vectors and Host Strains
[0115] The scFv repertoire was first made in a common shuttle vector pRS315 at the diversity of >10.sup.10, which is comparable to, or better than, most of the phage display antibody libraries. Sequence analysis of randomly chosen library clones indicated that >80% of the library members contained antibody sequences that were correctly assembled into the vector. When a screen was performed, the repertoire was introduced into the screening cells by PCR and gap-repair with the screening vector pKT103. In the process, the scFv fragments were joined to the FLO1 secretion signal sequence and placed under the TEF1 promoter.
[0116] To construct the strains suitable for the purpose of this platform, some modifications to the Ste2p signaling pathway have to be made. First, like in other experiments in which the yeast pheromone signaling pathway was adopted for studies of heterologous GPCRs, two gene deletions, far1 and sst2, were necessary for perpetuating cell division under the situation of pathway activation and for enhancing the sensitivity of the signal detection, respectively. The multi-functional and non-essential protein Far1p is required for -factor induced cell cycle arrest, which is but one of many consequences of the pathway stimulation. Loss of the SST2 function increases the receptor/G protein coupling and therefore attenuates the down-regulation of the pathway. For sensitive and easy signal reporting, this study used antibiotic resistance genes, neoR or zeoR, and a reporter system conferring temperature sensitivity, cdc26, instead of the commonly followed method of histidine auxotroph. CDC26 encodes a subunit of the anaphase-promoting complex (APC), which is involved in the regulation of metaphase/anaphase transition. Loss of the CDC26 function is lethal at high temperature (37 C.). Cells (YKT068 and YKT099) carrying the cdc26 deletion and wild type CDC26 under the control of the FUS2 promoter were temperature sensitive for growth at 37 C. in the absence of -factor, but grew normally in the presence of the pheromone (
[0117] It should be pointed out that any drug resistance genes and any mutations conferring temperature sensitivity can be used instead of neoR, zeoR, and cdc26, as long as their backgrounds are at low or manageable levels.
Example 3
[0118] Agonistic Antibodies Against Ste2p
[0119] The platform was firstly used to search for antibodies that were able to act as agonists for Ste2p, the yeast GPCR receptor. YKT099 was transformed with the scFv library and the transformed cells were spread on SC-Leu plates (to select for the plasmid) which also contained G418 at 20-40 g/ml or 300-400 g/ml, and were incubated at 37 C. or 30 C., respectively. The high temperature/low drug selection condition was biased towards the CDC26 expression and the low temperature/high drug condition interrogated mainly the neoR expression. The colonies that grew up on the plates under each selection regimen were collected and pooled together with each pool containing 10 or so individual colonies. Plasmids were extracted from pooled cells and used again to transform YKT099. This time, the transformants were screened with a reversed selection protocol. For example, if the first round of screening used the high temperature/low drug selection, the second round will use low temperature/high drug selection, and vice versa. This enrichment procedure was repeated once again. Typically, after three rounds of enrichment, nearly all the transformants became positive for growth on the selection plate. The colonies were collected for the last time and their plasmid DNA was extracted and analyzed.
[0120] From total of 510.sup.8 transformants, a dozen or so plasmids were identified that repeatedly produced colonies on the selection plates.
[0121] The Q5 gene encodes a 308 amino acid protein, including the N-terminal Flo1 signal peptide and the C-terminal FLAG epitope tag. The amino acid sequence of Q5 was given in
[0122] To further demonstrate Q5's function in promoting expression of pheromone-inducible genes, the expression of two other reporter genes were examined: GFP and LacZ in YKT099 and YKT109, respectively, both of which were driven by the FIG1 promoter, and found both genes to be markedly stimulated by the Q5-containing plasmid pKT112 (
[0123] To examine the cellular localization of Q5, the GFP coding sequence was cloned into pKT112 in-frame with, and C-terminal to, Q5. The plasmid so created, pKT119, was introduced into BJ5465 cells and it was found that about 30-50% of the cells clearly showed a cell surface localization of GFP (
[0124] In conclusion, the human antibody fragment Q5 was isolated by the autocrine screening platform as an agonist for the yeast GPCR receptor Ste2p, on the basis of its activity to stimulate the expression of the pheromone-inducible genes and do so in a Ste2p-dependent manner. These data demonstrate that the yeast autocrine screening method is effective and convenient for identifying functional antibodies against GPCR receptors.
Example 4
[0125] The Activity of Q5 was Attenuated by a GPI Anchor
[0126] Previously, Ishii et al. demonstrated an autocrine signaling system in yeast using the human GPCR SSTR5 and its ligand, somatostatin-14, which was anchored on the cell surface by a 41 amino acid glycosylphosphatidylinositol (GPI) attachment domain from the yeast cell wall protein Flo1p (Flo42). The same GPI anchor element (Flo42 with a flexible linker) was used to construct the vector pKT047, which was tested in an antibody library screening in the same way as with pKT103. The positive clones obtained from pKT047-based screening were fewer in number and weaker in activity, compared with the ones yielded from the pKT103-based screening. To directly compare the activity of the anchored and the unanchored agonist antibody, Q5 was transferred from pKT112 to pKT047 to fuse with the Flo42 anchor at the C-terminus of Q5 (pKT113). As shown in
[0127] In summary, a yeast phenotypic screening system was constructed based on autocrine signaling for identification of human antibody molecules that act as agonists of GPCR receptors. The effectiveness of this platform was demonstrated by isolating antibody fragments that can activate the yeast Ste2p-mediated pheromone signaling pathway. Compared with other antibody discovery platforms, the platform described in this study is more convenient, efficient, and uncostly for isolation of functional antibodies targeted at the GPCR proteins. Conceivably, this yeast autocrine screening system can also be used for isolation of antagonistic antibodies, if operated conversely.
EQUIVALENTS
[0128] The foregoing examples are presented for the purpose of illustrating the invention and should not be construed as imposing any limitation on the scope of the invention. It will readily be apparent that numerous modifications and alterations may be made to the specific embodiments of the invention described above and illustrated in the examples without departing from the principles underlying the invention. All such modifications and alterations are intended to be embraced by this application.