MP53 RESCUE COMPONDS AND METHODS OF TREATING A P53 DISORDER

20210205260 ยท 2021-07-08

    Inventors

    Cpc classification

    International classification

    Abstract

    Novel mp53 rescue compounds and the pharmaceutical composition, and methods of treating a p53 disorder.

    Claims

    1-67. (canceled)

    68. A mp53 rescue compound, wherein the compound is a PANDA Agent.

    69. The compound of claim 68, wherein the PANDA Agent is a compound selected from the group consisting of one or more three-valence arsenic compounds, five-valence arsenic compounds, three-valence bismuth compounds, five-valence bismuth compounds, three-valence antimony compounds, and five-valence antimony compounds.

    70. The compound of claim 69, wherein the PANDA Agent excludes CP-31398; PRIMA-1; PRIMA-1-MET; SCH529074; Zinc; stictic acid, p53R3; methylene quinuclidinone; STIMA-1; 3-methylene-2-norbornanone; MIRA-1; MIRA-2; MIRA-3; NSC319725; NSC319726; SCH529074; PARP-PI3K; 5, 50-(2, 5-furandiyl) bis-2-thiophenemethanol; MPK-09; Zn-curc or curcumin-based Zn (II)-complex; P53R3; a (2-benzofuranyl)-quinazoline compound; a nucleolipid compound of 5-fluorouridine; a compound of 2-aminoacetophenone hydrochloride; PK083; PK5174; and PK7088.

    71. A mp53 rescue compound comprising M, wherein M is selected from the group consisting of one or more three-valence arsenic, five-valence arsenic, three-valence bismuth, five-valence bismuth, three-valence antimony, and five-valence antimony.

    72. The compound of claim 71, wherein the group M is capable of forming one or more tight associations with one or more PANDA Cysteines.

    73. The compound of claim 71, having one or more of the following formula: M (Formula I), M-Z (Formula II), wherein: M is an atom selected from a group consisting of As, Sb, and Bi; Z is a functional group comprising a non-Carbon atom that forms a bond with M, wherein the non-Carbon atom is selected from the group consisting of H, D, F, Cl, Br, I, O, S, Se, Te, Li, Na, K, Cs, Mg, Cu, Zn, Ba, Ta, W, Ag, Cd, Sn, X, B, N, P, Al, Ga, In, Tl, Ni, Si, Ge, Cr, Mn, Fe, Co, Pb, Y, La, Zr, Nb, Pr, Nd, Sm, Eu, Gd, Dy, Tb, Ho, Er, Tm, Yb, and Lu; wherein: R1 is selected from 1 to 9 X groups; R2 is selected from 1 to 7 X groups; R3 is selected from 1 to 8 X groups; and wherein each X group comprises an atom that forms a bond with M; and wherein: each of M, the non-Carbon atom, and the atom has the appropriate charge, including no charge, in the compound; each of Z and X is independently selected and can be the same or different from the other Z or X in the compound, respectively; and each of the M, non-Carbon atom and the atom can be a part of a ring member.

    74. The compound of claim 73, wherein the non-Carbon atom is selected from the group consisting of O, S, N, X, F, Cl, Br, I, and H.

    75. A mp53 rescue compound, wherein the compound is selected from Table 1 to Table 7.

    76. The compound of claim 75, wherein the compound is selected from the group consisting of As2O3, As2O5, KAsO2, NaAsO2, HAsNa2O4, HAsK2O4, AsF3, AsCl3, AsBr3, AsI3, AsAc3, As (OC2H5)3, As (OCH3)3, As2 (SO4)3, (CH3CO2)3As, C8H4K2O12As2.xH2O, HOC6H4COOAsO, [O2CCH2C (OH) (CO2) CH2CO2] As, Sb2O3, Sb2O5, KSbO2, NaSbO2, HSbNa2O4, HSbK2O4, SbF3, SbCl3, SbBr3, SbI3, SbAc3, Sb (OC2H5)3, Sb (OCH3)3, Sb2(SO4)3, (CH3CO2)3Sb, C8H4K2O12Sb2.xH2O, HOC6H4COOSbO, [O2CCH2C(OH)(CO2)CH2CO2]Sb, Bi2O3, Bi2O5, KBiO2, NaBiO2, HBiNa2O4, HBiK2O4, BiF3, BiCl3, BiBr3, BiI3, BiAc3, Bi(OC2H5)3, Bi(OCH3)3, Bi2(SO4)3, (CH3CO2)3Bi, C8H4K2O12Bi2.xH2O, HOC6H4COOBiO, C16H18As2N4O2(NSC92909), C13H14As2O6 (NSC48300), C10H13NO8Sb (NSC31660), C6H12NaO8Sb+(NSC15609), C13H21NaO9Sb+(NSC15623), and a combination thereof.

    77. The compound of claim 75, wherein the compound is selected from the group consisting of As2O3, KAsO2, HOC6H4COOBiO, BiI3, SbI3, C8H4K2O12Sb2.H2O, As2S2, As4S4, As2S3, and As2S5.

    78. A pharmaceutical composition for a p53 disorder comprising the compound of claim 73 and a non-toxic, pharmaceutically acceptable carrier or excipient therefor.

    79. The pharmaceutical composition of claim 78, wherein the pharmaceutical composition is formulated for orally administering.

    80. The pharmaceutical composition of claim 79, wherein the compound is selected from the group consisting of As2S3, As2S2, and As2S5.

    81. The pharmaceutical composition of claim 78 further comprising at least one compatible therapeutic agent for p53 disorder, wherein the therapeutic is effective in treating the p53 disorder.

    82. The pharmaceutical composition of claim 81, wherein the compatible therapeutic agent for p53 disorder is selected from the group consisting of decitabine (DAC), cisplatin (CIS), etoposide (ETO), adriamycin (ADM), 5-fluorouracil (5-FU), cytarabine (ARA/araC) and azacitidine (AZA).

    83. A method of treating a p53 disorder in a subject in need thereof, the method comprising the steps: (a) obtaining a sample from the subject; and (b) administering a pharmaceutical composition of claim 78 to the subject if the sample has a p53 mutation.

    84. A method of detecting a rescuable mp53 in a subject comprising the steps: (a) obtaining a sample from the subject; (b) adding a PANDA agent of claim 70 to the sample; and (b) identifying the presence of the rescuable mp53 in the subject if, in the presence of the PANDA Agent (i) the PAb1620 immunoprecipitation signal increase to 1.5 times or more and/or (ii) the luciferase assay of a signal increase to 1.5 times or more.

    85. A method of identifying the presence of a rescuable mp53 in a subject comprising the steps: (a) obtaining a sample from the subject; (b) adding a PANDA Agent of claim 70 to a first portion of the sample; and (c) identifying the presence of a rescuable mp53 in the subject if immunoprecipitation signal of the first portion by PAb1620 at greater than 4 C. is 1.5 times or more than the immunoprecipitation signal of the second portion of the sample without the PANDA Agent.

    86. A method of diagnosing and treating a subject with a p53 disorder comprising the steps: (a) obtaining a sample from the subject; (b) diagnosing the subject is suitable for the pharmaceutical composition of claim 78 if the sample has a rescuable p53 mutation; and (c) treating the subject by administering a pharmaceutical composition of claim 78 to the subject if the sample has a rescuable mp53.

    87. A method of personalized treatment for a p53 related disorder in a subject in need thereof with increased efficacy, the method comprising the steps of: (a) obtaining a p53 DNA sample from the subject; (b) sequencing the p53 DNA sample; (c) determining whether the p53 of the subject is rescuable and identifying one or more PANDA Agent and/or a combination of PANDA Agent of claim 70 that is most appropriate to rescue the p53 in the subject; and (d) administering an effective amount of the PANDA Agent and/or the combination of PANDA Agent to the subject; wherein step (c) includes the step (s) (i) determining in silico whether the sequence of the p53 DNA sample is comparable to a to a database of rescuable p53s and identifying the corresponding PANDA Agent (s) and/or combination of PANDA Agents most appropriate to rescue the p53 using the database; and/or (ii) determining in vitro and/or in vivo whether the p53 of the subject can be rescued by screening it against a panel of PANDA Agents.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0078] FIG. 1 shows p53 mutation hotspots. Top left panel shows p53 mutations with high frequency. Top right panel shows the 3D structure of the p53-DNA complex (PDB accession: 1TUP) generated by Pymol. mp53 function in contacting DNA are in gray solid spheres (R248 and R273). mp53 function in maintaining p53 structure are in black solid spheres (R175, G245, R249, and R282). C### designate the 10 p53 cysteines, which includes the 4 cysteine pairs: C176/C182, C238/C242, C135/C141, and C275/C277, and the PANDA Cysteines (C124, C135, and C141). Lower left panel, schematic of the six mp53 hotspots and DNA overlayed on a PANDA drawing. Lower right panel, schematic of PANDA illustrating the contacting residues R248 and R282 holding and eating the bamboo. PANDA Pocket is depicted as the hind neck known to stabilize a panda cub when being grabbed by its mother.

    [0079] FIG. 2 shows TP53 is the most commonly mutated gene across cancer types and often within cancer types.

    [0080] FIG. 3 shows Kaplan-Meier survival curves shows hazard ratio (HR) and P value (Log-rank test in univariate Cox proportional hazard model) in 18 large-scale TCGA cancer studies (8,810 patients). Of the overall 28 TCGA cancer studies with available patient overall survival data compiled from cBioPortal in November 2018, 10 studies (CESC, KIRC, KIRP, TGCT, THCA, THYM, ACC, CHOL, DLBC, and KICH) with either p53 mutation frequency <5% or patient number <100 were excluded from analysis. b, summarized p53 mutation hazard ratio for above 18 cohorts and 6 MDS/AML cohorts from literatures. Only cohorts with >5% p53 mutation frequency and >100 patients were compiled from literatures.

    [0081] FIG. 4 shows clinical p53 mutations detected by Shanghai Institute of Hematology (SIH) and p53 mutations reported in AML/MDS patients.

    [0082] FIG. 5 shows G150 growth inhibition plot graph (retrieved by CellMiner) of ATO, KAsO.sub.2, Nutiin3, PRIMA-1, and NSC319726 in the NC160 cell panels shows ATO and KAsO.sub.2 selectively targets Structural mp53s when it inhibits maligancies. p53 status was compiled via the IARC TP53 database. Struc. means cell lines expressing structural hotspot mp53 (R175, G245, R249, and R282); WT means cell lines expressing wtp53; Others means the remaining cell lines; Null means truncated p53, frame-shift p53 and null p53; Contact means hotspot mutations on R248 and R273; * means p<0.05.

    [0083] FIG. 6 shows p53-R175H transfected H1299 cells or Trp53-R172H/R172H MEFs were treated with ATO or KAsO.sub.2 for 2 hr, lysed, immunoprecipitated using PAb1620, PAb240, or PAb246 IP, and immunoblotted with p53 antibody.

    [0084] FIG. 7 shows mass spectroscopy analysis of various mp53s in the presence and absence of ATO showing that the As atom bound to the mp53s.

    [0085] FIG. 8 shows deconvoluted mass spectroscopy shows that molecular weights of purified recombinant mp53(94-293) core with an R249S mutation, increased, in the presence of As.sub.2O.sub.3, NaAsO.sub.2, SbCl.sub.3, and HOC.sub.6H.sub.4COOBiO, by approximately 72 Daltons (Da), 72 Da, 119 Da, and 206 Da, respectively, under native denaturing conditions. The increase roughly corresponds to a loss of 3 protons and a gain of an arsenic atom, arsenic atom, antimony atom and bismuth atom respectively. The purified mp53 core was incubated with 1.5 molar ratio of DMSO, As.sub.2O.sub.3, NaAsO.sub.2, SbCl.sub.3, or HOC.sub.6H.sub.4COOBiO overnight.

    [0086] FIG. 9 shows melting temperature of various mp53s in the presence of various compounds. Melting curve of the purified recombinant p53C (p53C-WT, p53C-R175H, p53C-G245S, p53C-R249S and p53C-R282W, 5 M for each reaction) were recorded via differential scanning fluorimetry (DSF) at the indicated ratio of ATO and other compounds. The apparent T.sub.m of the p53C-R175H, p53C-G245S, p53C-R249S, and p53C-R282W can be raised by 1-8C (meanSD, n=3).

    [0087] FIG. 10 shows the gene mutation frequency was derived from TCGA database by using cBioPortal.

    [0088] FIG. 11. shows the p53-DNA complex (PDB accession: 1TUP) generated by Pymol. Left panel shows the 3 clusters of cysteines (C135/C141, C238/C242, C275/C277) and the R175-neighboring C176. Middle panel shows the PANDA complex purified from bacteria expressing p53(94-293)-R249S incubated with Asla (see also FIG. 13). Right panel shows the crystal of purified p53(94-293)-R249S soaked with 2 mM EDTA and 2 mM ATO for 19 h.

    [0089] FIG. 12 shows PANDA Agent mediated functional and structural rescue. For p53 folding assay, H1299 cells transfected with indicated TP53 were treated with 1 g/ml ATO for 2 hr, and cells were lysed followed by immunoprecipitation using PAb1620. Immunoprecipitated p53 was immunoblotted. Experiments are repeated twice. For p53 transcriptional activity assay, H1299 cells were co-transfected with indicated TP53 and PUMA reporter for 24 hr, followed by treatment of 1 g/ml ATO for 24 hr. Plot shows the ATO-mediated mp53 rescue profile, derived from p53 folding assay and transcriptional activity assay. X-axis: PAb1620 IP efficiency; Y-axis: PUMA luciferase report signal. Hollow cycles: without ATO treatment; solid cycles: with ATO treatment.

    [0090] FIG. 13 shows the 3D structure of p53. Upper panel shows the 3D structure of PANDA shown as ribbons. The PANDA Triad and arsenic atom are shown as spheres, the PANDA Pocket are shown in darker color. Middle panel shows the 3D structure of PANDA shown as spheres. The PANDA Pocket are shown in darker color. Lower panel shows the residues of PANDA Pocket. The structure are organized.

    [0091] FIG. 14 Left panel shows H1299 cells were co-transfected with indicated TP53 mutation on p53-G245S plasmid and either PUMA reporter or PIG3 reporter for 24 hr. Bar graph shows the transcriptional activity of p53-G245S with designated SSSMs (meanSD, n=3). Right panel, the upwards arrows and downwards arrows show the locations of mutations tested in left panel. Upwards arrows (S116 and Q136): mutations rescue p53-G245S, Downwards arrows: mutations fail to rescue p53-G245S.

    [0092] FIG. 15 shows ATO efficiently and properly folds mp53s. Left panel, H1299 cells transfected with the p53-R175H DNA were treated with indicated agents for overnight, cells were lysed followed by PAb1620 IP. Right graph shows the normalized change of PAb1620 IP efficiency compared with the one in DMSO group. Numbers in the brackets followed agents indicate the concentration used (g/ml).

    [0093] FIG. 16 shows PANDA regains DNA-binding ability. H1299 cells expressing p53-R175H were treated with indicated agents overnight, and cells were lysed followed by pull-down assay using streptavidin beads in presence of 10 pM of biotinylated double-stranded DNA. p53-R175H was immunoblotted.

    [0094] FIG. 17 shows PANDA regains wildtype-like transcriptional activity, which can be switched off by Dox. In upper left panel, H1299 cells expressing tet-off-regulated p53-R175H were pretreated with/without doxycycline (Dox) for 48 hr, followed by transfection of reporters containing the promoters of p53 targets in the presence/absence of 1 g/ml ATO overnight. Bar graph shows meanSD of luciferase signals from three independent experiments (n=3, **shows p<0.01). Lower left panel shows the rescued p53-R175H was largely depleted by DOX. Middle and right panel shows H1299 cells co-transfected with either p53-R282W DNA and reporters containing the promoters of PUMA or p53-G245S DNA and PIG3 reporter for 24 hr, followed by treatment of indicated agents for 24 hr. Numbers in the brackets indicate the concentration used (g/ml). Bar graph shows normalized changes of transcriptional activity as indicated by luciferase signals (meanSD, n=3).

    [0095] FIG. 18 shows HCT116 cells transfected with indicated mp53s were treated with 1 g/ml ATO for 48 hr. Protein levels of PUMA was determined.

    [0096] FIG. 19 shows PANDA-R175H suppresses cell growth as shown in elevated sensitivity to cell death when ATO is added to H1299 cells expressing tet-off-regulated p53-R175H. Left panel shows MTT cell viability assay and right panel shows colony formation assay (meanSD, n=3, *p<0.05). ATO was added for 48 hr and H1299 cells were pretreated with/without doxycycline (DOX) for 48 hr.

    [0097] FIG. 20 shows PANDA-mediated tumor suppression includes malignancy inhibition. Cell viability (IC50) is for cells expressing Structural mp53s (R175 and R249) is lowered as compared to cells expressing wtp53 or null/truncated p53. Positive control Nutlin (a MDM2 inhibitor and thus a wtp53 reactivator), preferably targeted wtp53 in the cell lines. Cells were treated with ATO or Nutlin for 48 hr. Each value is a mean value of three independent experiments.

    [0098] FIG. 21 shows PANDA-mediated tumor suppression. H1299 cells expressing tet-off-regulated p53-R175H were subcutaneously injected into flanks of nude mice. 5 mg/kg ATO was intraperitoneally injected for 6 consecutive d/week when the tumor area reached 0.1 cm (day 1). In DOX groups, drinking water contained 0.2 mg/ml DOX. Tumor size measurement was repeated every 3 day (left panel). Mice were sacrificed on day 28 and isolated tumors were weighed. Tumors size and weight were suppressed by over 90% according in ATO treated mice (left and lower right panel). Tumor suppression was predominantly PANDA-R175H-dependent, as shown by abrogation of ATO mediated tumor suppression after p53-R175H depletion by doxycycline (compare black solid line to black dot line for tumor size; compare last two bars for tumor weight). p53 IHC staining (right panel, bar=50 m), H&E staining (data not shown), and p53 protein level measurement (data not shown) are also demonstrate ATO mediated tumor suppression. Graphs show meanSEM (*p<0.05, **p<0.01, ***p<0.001, n=4/group).

    [0099] FIG. 22 shows PANDA-mediated tumor suppression. CEM-C1 (hCD45+) cancer cells xenographed by tail vein injection into NOD/SCID mice can be detected on day 22 and reached to 0.1% in PB on day 23. Administering 5 mg/kg of ATO intravenously from day 23 onwards at 6 consecutive days per week significantly slowed the propagation of CEM-C1 cells in PB at day 26 and extended the survival of the injected mice (n=7) as compared to the control (Ctr vehicle, n=6). Samples were obtained from the mice retro-orbital sinus every 3 or 4 days from day 7 to day 26. Left panel, the percentage of mCD45+ and hCD45+ cells in PB on day 16, 22, and 26. Right panel, Mantel-Cox survival curves of vehicle or treated mice.

    [0100] FIG. 23 shows MEFs expressing p53-R172H/R172H DNA or null p53 DNA were treated with ATO for 48 hr, followed by cell viability assay (left panel) and colony formation assay (right panel) (meanSD, n=3, *p<0.05).

    [0101] FIG. 24 shows cell viability assay showing ATO synergizes the effect of other clinical drugs such as the MDM2 inhibitor Nutlin3. H1299 cells cell viability assay of cells with null p53 DNA, p53-R175H DNA, or wtp53 DNA is treated with Nutin the absence or presence of 1 g/ml ATO shows Nutlin dependent inhibition of only cells expressing wtp53 in the absence of ATO. However, in the presence of ATO, Nutlin dependent inhibition is also observed in cells expressing p53-R175. (meanSD, n=3, *p<0.05).

    [0102] FIG. 25 Top panel shows synergic effect of combinational treatment of ATO and the indicated chemotherapy agents (CIS: Cisplatin; ETO: Etoposide; ADM: Adriamycin (Doxorubicin); ARA: Cytarabine; AZA: Azacitidine; DAC: Decitabine.) in vitro. H1299 cells expressing tet-off-regulated p53-R175H were treated for 12 hr and the protein levels were measured. Middle panel shows synergistic effect of ATO and CIS, AZA, and DAC as measured in viability assay of Thp-1 cells transfected with p53-R282.

    [0103] FIG. 26 shows clinical trial of ATO and DNA-damaging agents to treat AML/MDS. 50 MDS patients were recruited for p53 mutation-based personalized clinical trial.

    [0104] FIG. 27 Heatmap shows significantly upregulated targets upon compound treatment. Upregulated targets are shown as grey bars while non-upregulated targets are shown as black bars.

    [0105] FIG. 28 shows ATO is highly efficient and specific to a number of p53 with low off-target potential as shown in Thp-1 cells and U937 cells.

    DETAILED DESCRIPTION

    1.1 Interpretations and Definitions

    [0106] Unless otherwise indicated, this description employs conventional chemical, biochemical, molecular biology, genetics and pharmacology methods and terms that have their ordinary meaning to persons of skill in this field. All publications, references, patents and patent applications cited herein are hereby incorporated herein by reference in their entireties.

    [0107] As used herein, the biological sample corresponds to any sample taken from a subject, and can include tissue samples and fluid samples such as blood, lymph or interstitial fluid and combinations thereof and the like.

    [0108] As used in this specification and the appended claims, the following general rules apply. Singular forms a, an and the include plural references unless the content clearly indicates otherwise. General nomenclature rules for genes and proteins also apply. That is, genes are italicized or underlined (e.g.: TP53 or TP53), but gene products, such as proteins and peptides, are in standard font, not italicized or underlined (e.g.: p53). General rules for nomenclature of amino acid location also applies; that is, the amino acid abbreviation followed by number (e.g.: R175, R 175, R-175), where the amino acid name is represented by the abbreviation (e.g.: arginine by R, arg, Arg any other abbreviations familiar to those skilled in the art) and the location of the amino acid on the protein or peptide is represented by the number (e.g.: 175 for position 175). General rules for nomenclature of mutations also apply; for example, R175H, means arginine at location 175 is substituted by histidine. As another example mutation on p53 at location 175 from R to H can be represented by for example p53-R175H or mp53-R175H. Unless specified otherwise, any amino acid position corresponds to the amino acid location on a wildtype p53, preferably the human wtp53 isoform a listed in Table 14. General nomenclature rules for organism classification also apply. That is order, family, genus and species names are italicized.

    [0109] As used herein, the following terms shall have the specified meaning. The term about takes on its plain and ordinary meaning of approximately as a person of skill in the art would understand, and generally plus or minus 20%, unless specified otherwise. The term comprise, comprising, contain, containing, include, including, include but not limited to, or characterized by is inclusive or open-ended and does not exclude additional, unrecited elements.

    [0110] As used herein, the following terms shall have the specified meaning:

    [0111] expression or level of expression means the level of mRNAs or proteins encoded by the referenced gene.

    [0112] PANDA is abbreviated for 253 AND Agent complex, means a complex comprised of one or more p53s and one or more PANDA Agents.

    [0113] PANDA Agent means a composition of matter capable of forming at least one tight association with the PANDA Pocket and has one or more useful characteristic(s). Exemplary PANDA Agent is listed in Table 1-Table 7.

    [0114] PANDA Pocket means a region consisting essentially of an area of about 7 from a properly folded PANDA Triad, including, all amino acids adjacent to one or more properly folded PANDA Triad, all amino acids that contact with one or more properly folded PANDA Triad, and all PANDA Triad. It is a pocket on p53 that interacts with one or more atoms of the PANDA Agent to form PANDA. Exemplary 3D structures of a PANDA Pockets can be found FIG. 11 and FIG. 13. In an exemplary embodiment, the PANDA Pocket can include all of the above amino acids, a subset of the above amino acids, and possibly other components as long as the resulting tertiary structure comprising the PANDA Pocket exhibits one or more of the useful characteristics described in this application. Thus, the PANDA Pocket can comprise or consist essentially of the above amino acids, or a subset thereof.

    [0115] PANDA Core means the tertiary structure formed on the PANDA Pocket of a p53 when at least one tight association is formed between the PANDA Pocket and one or more atoms of the PANDA Agent.

    [0116] tight association means a bond, covalent bond, a non-covalent bond (such as a hydrogen bond), and combinations thereof formed between PANDA Pocket and PANDA Agent. The tight association is preferably formed between a PANDA Agent and one or more PANDA Cysteines, preferably two or more PANDA Cysteines, and more preferably all three PANDA Cysteines.

    [0117] PANDA Cysteine means a cysteine corresponding to one of the wtp53 positions at cysteine 124 (C124 or cys124), cysteine 135 (C135 or cys135), and cysteine 141 (C141 or cys141) (together the PANDA Triad).

    [0118] p53 means any wildtype p53 (wtp53), including all natural and artificial p53; any mutated p53 (mp53), including all natural and artificial p53, combinations thereof, and the like.

    [0119] wtp53 means all wildtype p53 that is commonly considered as wildtype, or has a wildtype sequence, and includes any commonly acceptable variations, such as variations caused by single nucleotide polymorphism (SNP). Exemplary wtp53 includes p53, p53, p53, 40p53, 40p53, 40p53, and any acceptable variants, such as those with one or more single nucleotide polymorphisms (SNP). Exemplary wtp53 are listed in can be found in Table 14.

    [0120] SNP means single-nucleotide polymorphism, which is a variation in a single nucleotide that occurs at a specific position in the genome, where each variation is presented to some appreciable degree within a population. An exemplary list of known SNP on p53 is Table 13.

    [0121] mp53 means mutated p53, which includes all p53 and p53 like macromolecules that is not a wtp53. mp53 includes, artificial mp53, such as recombinant p53, chimeric p53, p53 derivative, fusion p53, p53 fragment, and p53 peptide. Exemplary mp53 is a rescuable mp53.

    [0122] rescuable mp53 means a p53 with a rescuable mutation that can be rescued by a PANDA Agent (such as ATO), such that one or more of the mp53's wildtype function and/or structure can be rescued. A rescuable mp53 includes a structurally rescuable mp53 and a functionally rescuable mp53. Exemplary rescuable mp53s are provided in Table 8.

    [0123] structurally rescuable mp53 means a mp53 where one or more of the wild type structure can be rescued by a PANDA Agent (such as ATO).

    [0124] functionally rescuable mp53 means a mp53 where one or more of the wild type transcriptional function can be rescued by a PANDA Agent (such as ATO).

    [0125] hotspot mp53 means an mp53 with at least one mutation in mp53 hotspots, namely, R175, G245, R248, R249, R273, R282, combinations thereof, and the like. Examples of hotspot mp53s are listed in FIG. 1.

    [0126] Contacting mp53 means a mp53 that loses its DNA binding ability without drastically affecting the p53 structure. Contacting mp53s are represented by, for example, p53-R273H, p53-R273C, p53-R248Q and p53-R248W.

    [0127] Structural mp53 means a mp53 that has significantly disrupted three-dimensional structure as compared to wtp53. Structural mp53s are represented by, for example, p53-R175H, p53-G245D, p53-G245S, p53-R249S, and p53-R282W.

    [0128] artificial p53 means an artificially engineered p53. Preferred examples of an artificially engineered p53 include a p53 fusion protein, a p53 fragment, a p53 peptide, a p53-derived fusion macromolecule, a p53 recombinant protein, a p53 with second-site suppressor mutation (SSSM), and a super p53.

    [0129] p53 inhibiting protein means a protein that inhibits a function of activity of p53, and includes, for example, murine double minute 2 (MDM2), inhibitor of apoptosis-stimulating protein of p53 (iASPP) and sirtuin-1 (SIRT1).

    [0130] useful characteristic means an ability to efficiently and effectively rescue at least one wildtype structure, transcriptional activity, cell growth inhibition function, and/or tumor-suppressive function in a mp53. Exemplary useful characteristic includes: (a) an ability to substantially increase in the population of properly folded p53, preferably the increase is at least about 3 times more than the increase caused by PRIMA-1, more preferably the increase is at least about 5 times more than the increase caused by PRIMA-1, further preferably the increase is at least about 10 times more than the increase caused by PRIMA-1, further preferably the increase is at least about 100 times more than the increase caused by PRIMA-1; (b) an ability to substantially improve the transcription function of p53, preferably the improvement is at least about 3 times more than the improvement caused by PRIMA-1; more preferably the improvement is at least about 5 times more than the improvement caused by PRIMA-1, further preferably the improvement is at least about 10 times more than the improvement caused by PRIMA-1, further preferably the improvement is at least about 100 times than the improvement caused by PRIMA-1; and (c) an ability to substantially enhance the stability of p53 as measured by, for example, an increase p53 Tm, preferably the enhancement is at least about 3 times more than the enhancement caused by PRIMA-1, more preferably the improvement is at least about 5 times more than the improvement caused by PRIMA-1, further preferably the improvement is at least about 10 times more than the improvement caused by PRIMA-1, further preferably the improvement is at least about 100 times than the improvement caused by PRIMA-1. A preferred PANDA Agent has two or more useful characteristics, and more preferably has three or more useful characteristics. An exemplary PANDA Agent is ATO. Other exemplary PANDA Agent includes As analogs. Additional exemplary PANDA Agents are listed in Table 1-Table 7.

    [0131] efficiently or efficient as used to describe the enhancement for a useful characteristic, rescue at least one wildtype structure, transcriptional activity, cell growth inhibition function, and/or tumor-suppressive function in a mp53, generally means enhancing the useful characteristic by more than about 3 times, as compared to the enhancement by PRIMA-1, preferably by more than about 5 times, more preferably by more than about 10 times, more preferably by about 100 times. For example, an efficient enhancement would be enhancing the T.sub.m of mp53 by about 3-100 times of those of PRIMA-1, and/or folds mp53 by 3-100 times of those of PRIMA-1, and/or stimulates mp53's transcriptional activity by about 3-100 times of those of PRIMA-1.

    [0132] ATO or As.sub.2O.sub.3 means arsenic trioxide and compounds generally understood as arsenic trioxide.

    [0133] analog or analogue means a compound obtained by varying the chemical structure of an original compound, for example, via a simple reaction or the substitution of an atom, moiety, or functional group of the original compound. Such analog may involve the insertion, deletion, or substitution of one or more atoms, moieties, or functional groups without fundamentally altering the essential scaffold of the original compound. Examples of such atoms, moieties, or functional groups include, but are not limited to, methyl, ethyl, propyl, butyl, hydroxyl, ester, ether, acyl, alkyl, carboxyl, halide, ketyl, carbonyl, aldehyde, alkenyl, azide, benzyl, fluoro, formyl, amide, imide, phenyl, nitrile, methoxy, phosphate, phosphodiester, vinyl, thiol, sulfide, or sulfoxide atoms, moieties, or functional groups. Many methods for creating a chemical analog from an original compound are known in the art.

    [0134] p53 disorder means an abnormal physical and/or mental condition caused by a mutation in the TP53 gene and/or p53 protein. The condition can be in a human or another animal, such as a mouse, dog and other companion animals, a cattle and other livestock, a wolf or other zoo animals, and a horse or other equines. Examples of a p53 disorder include cancer, such as carcinoma (for example adenocarcinomas and squamous cell carcinoma), sarcoma, myeloma, leukemia, lymphoma, blastoma, and mixed types cancers (for example, adenosquamous carcinoma, mixed mesodermal tumor, carcinosarcoma, and teratocarcinoma); a tumor (for example, a tumor in connective tissue, endothelium and mesothelium, blood and lymphoid cells, muscle, epithelial tissues, neural, amine precursor uptake and decarboxylation system, other neural crest-derived cells, breast, renal anlage, and/or gonadal); a neurological disease, a developmental disease, an immunological disease, and aging, among others. Additional examples of known p53 disorder are listed in Section 1.2. A p53 cancer and/or tumor is a cancer and/or tumor with at least one p53 mutation. Additional examples of known p53 cancer and/or tumor are listed in Section 1.3.

    [0135] subject means any organism. The subject is preferably an animal, such as a vertebrate; further preferably a mammal, such as a cattle, a horse, a pig, a lamb, and other livestock; further preferably a human, such as a patient, a cancer patient, an unborn child, and any un-conceived, hypothetical child of two parents.

    [0136] a person in need of means an individual who has a p53 disorder, such as a cancer, wherein the cancer expresses a mp53, preferably a rescuable mp53.

    [0137] biological system means a cell, bacteria, artificial system containing p53 pathway and relevant proteins.

    [0138] treatment means the administration and/or application of the therapeutic product or method to a subject with a p53 disorder, and includes, among others, monitoring the efficacy of a type of treatment for the p53 disorder.

    [0139] diagnosis means any method to identify a particular disease, and includes, among others, detecting the symptoms of a disease, assessing the severity of the disease, determining the stages of the disease, and monitoring the progression of the disease.

    [0140] prognosis means any method to determine the likely course of a disease, and includes, among others, determining the predisposition of a disease, determining the likelihood a disease will onset, assessing the likely severity of the disease, determining the likely stages of the disease, and predicting the likely progression of the disease.

    [0141] a therapeutically effective amount is an amount of a compound effective to prevent, alleviate, or ameliorate symptoms of a disorder or prolong the survival of the subject being treated. Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. The effective dosage, level, or amount of a compound to be used in vivo can be determined by those skilled in the art, taking into account the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration, the potency, bioavailability, and metabolic characteristics of the compound, and other factors.

    [0142] screening of effective treatments means screening of effective therapeutic product or method for the treatment of a certain disease. It can involve in vitro and/or ex vivo screening methods, and includes, among others, both the product or composition to treat a disease and the method to prepare the composition for treatment.

    [0143] carrier as used herein can include solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like

    [0144] pharmaceutical carrier as used herein can include, liposomes, albumin microspheres, soluble synthetic polymers, DNA complexes, protein-drug conjugates, carrier erythrocytes, and any other substance that is incorporated to improve the delivery and the effectiveness of drugs. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.

    [0145] compatible therapy for p53 disorder means a therapy (including experimental therapies) compatible and/or synergistic with p53 treatments containing one or more PANDA Agents, The compatible therapy for p53 disorder can include surgery, chemotherapy, and radiation therapy. Experimental therapies include, but are not limited to, expression of wtp53 in tumors based on viral or viral like particle based delivery vectors.

    [0146] p53 cancer therapeutic as used herein include, general chemotherapeutics. Examples of general chemotherapeutics include, but are not limited to, Avastin, Rituxan, Herceptin, Taxol, and Gleevec.

    [0147] DTP means Developmental Therapeutics Program as understood by a person of ordinary skill in the art.

    [0148] DNA damaging agents mean the anti-cancer agents in which the DNA damaging is involved when they function. Examples of a DNA damaging agent include decitabine (DAC), clsplatin (CIS), etoposide (ETO), adriamycin (ADM), 5-fluorouracil (5-FU), cytarabine (ARA/araC), and azactidine (AZA).

    1.2p53 is One of the Most Important Proteins in Cell Biology

    [0149] The 53-kilodalton p53 protein is a transcription factor and one of the most important proteins in cell biology. p53 is the most heavily studied protein in history and it is also the most heavily studied protein in every year since 2001, yet the reusability of mp53 is still largely unknown. Wildtype p53 (wtp53) sequence can be found in public gene banks, such as gene bank, protein bank, and Uniport. Exemplary wtp53 sequences are listed under Table 14. Unless specified otherwise, this application uses the wtp53 sequences of human p53 isoform a listed under Table 14 to reference amino acid locations on p53.

    [0150] The active human wtp53 is a homotetramer of 4393 amino acids with multiple domains including an intrinsically disordered N-terminal transactivation domain (TAD), a proline-rich domain (PRD), a structured DNA-binding domain (DBD) and tetramerization domain (TET) connected via a flexible linker, and an intrinsically disordered C-terminal regulatory domain (CTD) (see FIG. 1). Many TP53 family genes expressing multiple isoforms exist, and often exhibit antagonistic functions.

    [0151] wtp53 plays a central part in the cells and is frequently considered as the most important tumor suppressor. Upon cellular stresses, such as DNA damage or oncogenic stress, p53 is activated and transcriptionally regulates a batch of genes to trigger events including cell-cycle arrest, DNA repair, apoptosis, cell repair, cell death, among others. Examples of genes transcriptionally regulated by p53 include Apaf1, Bax, Fas, Dr5, mir-34, Noxa, TP53AIP1, Perp, Pidd, Pig3, Puma, Siva, YWHAZ, Btg2, Cdkn1a, Mdm2, BBC3/PUMA, Tp53i3, Gadd45a, mir-34a, mir-34b/34c, Prl3, Ptprv, Reprimo, Pai1, Pml, Ddb2, Ercc5, Fancc, Gadd45a, Ku86, Mgmt, Mlh1, Msh2, P53r2, Polk, Xpc, Adora2b, Aldh4, Gamt, Gls2, Gpx1, Lpin1, Parkin, Prkab1, Prkab2, Pten, Sco1, Sesn1, Sesn2, Tigar, Tp53inp1, Tsc2, Atg10, Atg2b, Atg4a, Atg4c, Atg7, Ctsd, Ddit4, Dram1, Foxo3, Laptm4a, Lkb1, Pik3r3, Prkag2, Puma, Tpp1, Tsc2, Ulk1, Ulk2, Uvrag, Vamp4, Vmp1, Bai1, Cx3cl1, Icam1, Irf5, Irf9, Isg15, Maspin, Mcp1, Ncf2, Pai1, Tlr1-Tlr10, Tsp1, Ulbp1, Ulbp2, mir-34a, mir-200c, mir-145, mir-34a, mir-34b/34c, Notch1, combinations thereof and the like. In addition to anti-cancer role, p53 target genes also have important roles in senescence, angiogenesis, and autophagy, connecting, regulating oxidative stress, regulating metabolic homeostasis, stem cell maintenance, among others. Accordingly, a mutation in p53 (i.e. a mutant p53 or mp53) can cause a wide range of health issues, including cancer, tumor, neurological disease, developmental disease, immunological disease, and aging, among others.

    [0152] Examples of known p53 disorders include achalasia, acinar cell carcinoma, acrofacial dysostosis, actinic cheilitis, actinic keratosis, acute lymphocytic leukemia, adenocarcinoma, adenoid cystic carcinoma, adenoma, adenosarcoma, adenosquamous carcinoma, adrenocortical carcinoma, adult hepatocellular carcinoma, adult medulloblastoma, adult t-cell leukemia, aging, agraphia, alpha-thalassemia, alpha-thalassemia/mental retardation syndrome, anal squamous cell carcinoma, anaplastic thyroid cancer, anogenital venereal wart, anterior cranial fossa meningioma, aplastic anemia, ataxia-telangiectasia, atrophic gastritis, atrophy of prostate, atypical follicular adenoma, atypical teratoid rhabdoid tumor, autonomic nervous system neoplasm, autosomal genetic disease, b cell prolymphocytic leukemia, Barrett esophagus, Barrett's adenocarcinoma, Bartholin's duct cyst, Bartholin's gland adenoma, Bartholin's gland benign neoplasm, basal cell carcinoma, basal cell carcinoma, basaloid squamous cell carcinoma, B-cell lymphomas, Beckwith-wiedemann syndrome, bile duct adenocarcinoma, bile duct carcinoma, biliary papillomatosis, biliary tract neoplasm, bladder cancer, bladder carcinoma in situ, bladder papillary transitional cell neoplasm, bladder squamous cell carcinoma, bladder transitional cell papilloma, bladder urothelial carcinoma, bone giant cell sarcoma, bone squamous cell carcinoma, brain cancer, brain ependymoma, brain glioblastoma multiforme, brain glioma, brain stem astrocytic neoplasm, brain stem cancer, brain stem glioma, breast adenocarcinoma, breast benign neoplasm, breast cancer, breast carcinoma in situ, breast disease, breast ductal carcinoma, breast malignant phyllodes tumor, breast squamous cell carcinoma, calcifying epithelial odontogenic tumor, cataract, cell type benign neoplasm, cell type cancer, cellular ependymoma, cellular neurofibroma, cellular schwannoma, central nervous system lymphoma, central nervous system organ benign neoplasm, central nervous system primitive neuroectodermal neoplasm, cerebellar angioblastoma, cerebellar astrocytoma, cerebellar liponeurocytoma, cerebellum cancer, cerebral convexity meningioma, cerebral neuroblastoma, cerebral primitive neuroectodermal tumor, cerebral ventricle cancer, cerebrum cancer, cervical adenocarcinoma, cervical cancer, cervical carcinosarcoma, cervical squamous cell carcinoma, cervix carcinoma, cervix small cell carcinoma, cervix uteri carcinoma in situ, cheilitis, childhood leukemia, cholangiocarcinoma, cholecystitis, chordoid glioma, chordoma, choroid plexus cancer, chromophobe adenoma, chronic salpingitis, clear cell adenocarcinoma, clear cell cystadenofibroma, clear cell ependymoma, clivus meningioma, cl/sll, colorectal adenocarcinoma, colorectal adenoma, colorectal cancer, conjunctival degeneration, conjunctival squamous cell carcinoma, connective tissue cancer, cystadenocarcinoma, cystic teratoma, cystitis, dedifferentiated liposarcoma, dermatofibrosarcoma protuberans, differentiated thyroid carcinoma, diffuse large B-cell lymphoma, ductal carcinoma in situ, dyskeratosis congenita autosomal recessive, dyskeratosis congenita, dyskeratosis congenita, autosomal recessive, eccrine sweat gland neoplasm, ectrodactyly, ectodermal dysplasia, and cleft lip/palate syndrome, embryonal sarcoma, endocervical adenocarcinoma, endocrine gland cancer, endometrial adenocarcinoma, endometrial cancer, endometrial clear cell adenocarcinoma, endometrial stromal sarcoma, endometrium carcinoma in situ, ependymoblastoma, epidermal appendage tumor, epidural neoplasm, epithelial-myoepithelial carcinoma, esophageal basaloid squamous cell carcinoma, esophageal cancer, esophageal disease, esophagitis, esophagus adenocarcinoma, essential thrombocythemia, estrogen-receptor positive breast cancer, Ewing sarcoma, fallopian tube adenocarcinoma, fallopian tube carcinoma, familial adenomatous polyposis, familial colorectal cancer, female breast cancer, female reproductive endometrioid cancer, female reproductive organ cancer, fibrillary astrocytoma, focal cortical dysplasia, type ii, frontal convexity meningioma, gallbladder cancer, gallbladder squamous cell carcinoma, ganglioglioma, gastric adenocarcinoma, gastric adenosquamous carcinoma, gastric cancer, gastric lymphoma, gastric papillary adenocarcinoma, gastroesophageal reflux, gastrointestinal stromal tumor, gastrointestinal system benign neoplasm, gastrointestinal system cancer, germ cell and embryonal cancer, giant cell glioblastoma, glioblastoma multiforme, glioblastoma, gliofibroma, glioma susceptibility, glioma, gliomatosis cerebri, gliosarcoma, glomangiosarcoma, glomus tumor, glycogen-rich clear cell breast carcinoma, grade iii astrocytoma, granulosa cell tumor of the ovary, Helicobacter pylori infection, hematologic cancer, hepadnavirus infection, hepatoblastoma, hepatocellular carcinoma, hereditary breast ovarian cancer syndrome, hidradenocarcinoma, histiocytoma, huntington disease, hydrocephalus, hyperplastic polyposis syndrome, hypoxia, in situ carcinoma, inflammatory myofibroblastic tumor, infratentorial cancer, integumentary system cancer, intestinal benign neoplasm, intestinal disease, intracranial chondrosarcoma, intrahepatic cholangiocarcinoma, invasive bladder transitional cell carcinoma, inverted papilloma, juvenile pilocytic astrocytoma, kaposi sarcoma, keratinizing squamous cell carcinoma, keratoacanthoma, keratocystic odontogenic tumor, larynx cancer, larynx verrucous carcinoma, leiomyosarcoma, leukemia, leukemia, acute lymphoblastic, leukemia, acute myeloid, leukemia, chronic lymphocytic, lichen disease, lichen planus, lichen sclerosus, li-fraumeni syndrome, li-fraumeni syndrome, lip cancer, liposarcoma, liver angiosarcoma, lung benign neoplasm, lung cancer susceptibility, lung cancer, lung occult squamous cell carcinoma, lung papillary adenocarcinoma, lung squamous cell carcinoma, lymph node cancer, lymphoid interstitial pneumonia, lymphoma, non-hodgkin, familial, lynch syndrome, male reproductive organ cancer, malignant ependymoma, malignant giant cell tumor, malignant mesenchymoma, malignant ovarian surface epithelial-stromal neoplasm, malignant peripheral nerve sheath tumor, malignant spiradenoma, mantle cell lymphoma, Marek disease, mature B-cell neoplasm, mature teratoma, maxillary sinus squamous cell carcinoma, medulloblastoma, medullomyoblastoma, megaesophagus, megakaryocytic leukemia, melanoma, melanoma, cutaneous malignant, meningeal melanomatosis, meninges sarcoma, meningioma, familial, merkel cell carcinoma, microglandular adenosis, mixed astrocytoma-ependymoma, mixed cell type cancer, mixed glioma, mixed oligodendroglioma-astrocytoma, mucoepidermoid esophageal carcinoma, multifocal osteogenic sarcoma, multiple cranial nerve palsy, muscle cancer, mutagen sensitivity, mutyh-associated polyposis, myasthenic syndrome, myelodysplastic syndrome, myeloid leukemia, myeloma, multiple, myxoid liposarcoma, myxosarcoma, nasal cavity adenocarcinoma, nasopharyngeal carcinoma, necrotizing sialometaplasia, nervous system cancer, neuroblastoma, nevus of ota, nijmegen breakage syndrome, non-invasive bladder papillary urothelial neoplasm, non-proliferative fibrocystic change of the breast, ocular cancer, olfactory groove meningioma, oligodendroglioma, optic nerve glioma, optic nerve neoplasm, oral cancer, oral cavity cancer, oral leukoplakia, organ system benign neoplasm, oropharynx cancer, osteogenic sarcoma, ovarian cancer, ovarian cancer, ovarian clear cell carcinoma, ovarian serous cystadenocarcinoma, ovary adenocarcinoma, ovary epithelial cancer, pancreas adenocarcinoma, pancreatic cancer, pancreatic ductal carcinoma, papillary adenocarcinoma, papillary serous adenocarcinoma, papilledema, papilloma of choroid plexus, papilloma, parameningeal embryonal rhabdomyosarcoma, parietal lobe neoplasm, penile cancer, penis carcinoma in situ, penis squamous cell carcinoma, periosteal osteogenic sarcoma, peripheral nervous system neoplasm, peripheral T-cell lymphoma, Peutz-jeghers syndrome, pharynx cancer, pigmented villonodular synovitis, pilocytic astrocytoma, pinguecula, plantar wart, pleomorphic adenoma carcinoma, pleomorphic adenoma, pleomorphic carcinoma, pleomorphic xanthoastrocytoma, pleuropulmonary blastoma, pre-malignant neoplasm, primary peritoneal carcinoma, prolactin producing pituitary tumor, prostate cancer, prostate squamous cell carcinoma, protoplasmic astrocytoma, pseudomyxoma peritonei, pulmonary blastoma, rare adenocarcinoma of the breast, recessive dystrophic epidermolysis bullosa, rectal neoplasm, papillary, renal cell carcinoma, respiratory system cancer, retinal cancer, retinoblastoma, rhabdomyosarcoma, Richter's syndrome, rift valley fever, ring chromosome, sarcoma, sarcomatoid squamous cell skin carcinoma, schneiderian carcinoma, sclerosing liposarcoma, scrotal carcinoma, sensory system cancer, serous cystadenocarcinoma, short-rib thoracic dysplasia with or without polydactyly, signet ring cell adenocarcinoma, skin melanoma, skin squamous cell carcinoma, small cell cancer of the lung, small cell carcinoma, small cell sarcoma, soft tissue sarcoma, spinal cancer, spinal cord astrocytoma, spinal cord glioma, spinal cord primitive neuroectodermal neoplasm, spiradenoma, spitz nevus, splenic diffuse red pulp small B-cell lymphoma, split-hand/foot malformation, sporadic breast cancer, squamous cell carcinoma, squamous cell papilloma, submandibular gland cancer, suppression of tumorigenicity, suppressor of tumorigenicity, supratentorial cancer, sweat gland cancer, synchronous bilateral breast carcinoma, teratoma, testicular germ cell tumor, testicular torsion, tetraploidy, thoracic benign neoplasm, thymus cancer, thyroid cancer, thyroid lymphoma, tongue cancer, tongue squamous cell carcinoma, transitional cell carcinoma, ulcerative stomatitis, ureteral obstruction, urinary tract papillary transitional cell benign neoplasm, uterine body mixed cancer, uterine carcinosarcoma, uterine corpus cancer, uterine corpus serous adenocarcinoma, vaccinia, vestibular gland benign neoplasm, vulva cancer, vulva squamous cell carcinoma, vulvar adenocarcinoma, vulvar intraepithelial neoplasia, vulvar sebaceous carcinoma, wilms tumor, xanthogranulomatous cholecystitis, xeroderma pigmentosum, variant type, zika virus infection, combinations thereof and the like.

    [0153] It has been estimated that the direct medical expenses for mp53 patients in 2017 alone amounts to approximately 65 billion USD.

    1.3p53 and Cancer

    [0154] p53 is the most frequently mutated cancer protein (FIG. 2). A p53 mutation can eliminate the tumor suppressive function of wtp53. Additionally, a p53 mutation can gain oncogenic properties. For example, a mutant p53 (mp53) can promote cancer metastasis, confer resistance to treatment, and cause cancer patients to relapse. Accordingly, it is estimated that nearly half of all human cancers has mutated and inactivated p53 gene and/or protein (Vogelstein et al., 2000).

    [0155] Examples of cancers and/or tumors reported to harbor one or more p53 mutations include carcinoma, acinar cell carcinoma, adenocarcinoma, adenoid cystic carcinoma, adenosquamous carcinoma, apocrine adenocarcinoma, basal cell carcinoma, basaloid carcinoma, basosquamous carcinoma, bronchiolo-alveolar adenocarcinoma, carcinoma in pleomorphic adenoma, cholangiocarcinoma, choriocarcinoma, choroid plexus carcinoma, clear cell adenocarcinoma, combined hepatocellular carcinoma and cholangiocarcinoma, comedocarcinoma, cribriform carcinoma, ductal carcinoma, solid type, eccrine adenocarcinoma, endometrioid adenocarcinoma, follicular adenocarcinoma, giant cell and spindle cell carcinoma, giant cell carcinoma, hepatocellular carcinoma, hepatoid adecarcinoma, infiltrating basal cell carcinoma, infiltrating duct carcinoma, infiltrating ductular carcinoma, inflammatory carcinoma, intraductal carcinoma, intraductal carcinoma and lobular carcinoma, intraductal papillary adenocarcinoma, intraductal papillary-mucinous carcinoma, large cell carcinoma, large cell neuroendocrine carcinoma, leiomyosarcoma, lobular carcinoma, medullary carcinoma, merkel cell carcinoma, metaplastic carcinoma, mixed cell adenocarcinoma, mucinous adenocarcinoma, mucinous cystadenocarcinoma, mucoepidermoid carcinoma, multifocal superficial basal cell carcinoma, neuroendocrine carcinoma, non-small cell carcinoma, oat cell carcinoma, papillary adenocarcinoma, papillary carcinoma, papillary cystadenocarcinoma, papillary serous cystadenocarcinoma, papillary transitional cell carcinoma, pituitary carcinoma, plasmacytoid carcinoma, pleomorphic carcinoma, pseudosarcomatous carcinoma, renal cell carcinoma, sebaceous adenocarcinoma, secretory carcinoma of breast, serous cystadenocarcinoma, serous surface papillary carcinoma, signet ring cell carcinoma, small cell carcinoma, solid carcinoma, spindle cell carcinoma, squamous cell carcinoma, sweat gland adenocarcinoma, teratocarcinoma, thymic carcinoma, transitional cell carcinoma, trichilemmocarcinoma, tubular adenocarcinoma, sarcoma, alveolar rhabdomyosarcoma, carcinosarcoma, chondroblastic osteosarcoma, chondrosarcoma, clear cell sarcoma of kidney, dedifferentiated chondrosarcoma, dermatofibrosarcoma, embryonal rhabdomyosarcoma, embryonal sarcoma, Ewing sarcoma, fibrosarcoma, gastrointestinal stromal sarcoma, gliosarcoma, hemangiosarcoma, kaposi sarcoma, liposarcoma, mixed liposarcoma, myxoid liposarcoma, osteosarcoma, periosteal osteosarcoma, pleomorphic liposarcoma, pleomorphic rhabdomyosarcoma, rhabdomyosarcoma, sarcoma, synovial sarcoma, undifferentiated sarcoma, myeloma, multiple myeloma, leukemia, acute leukemia, acute megakaryoblastic leukemia, acute monocytic leukemia, acute myeloid leukemia, acute myeloid leukemia, adult T-cell leukemia/lymphoma, aggressive NK-cell leukemia, B-cell chronic lymphocytic leukemia/small lymphocytic lymphoma, Burkitt cell leukemia, chronic myeloid leukemia, chronic myelomonocytic leukemia, hairy cell leukemia, lymphoid leukemia, myeloid leukemia, plasma cell leukemia, precursor B-cell lymphoblastic leukemia, precursor cell lymphoblastic leukemia, precursor T-cell lymphoblastic leukemia, prolymphocytic leukemia, T-cell large granular lymphocytic leukemia, undifferentiated leukemia, lymphoma, anaplastic large cell lymphoma, angioimmunoblastic T-cell lymphoma, Burkitt lymphoma, cutaneous T-cell lymphoma, follicular lymphoma, Hodgkin lymphoma, malignant lymphoma, mantle cell lymphoma, marginal zone B-cell lymphoma, mature T-cell lymphoma, NK/T-cell lymphoma, precursor cell lymphoblastic lymphoma, primary effusion lymphoma, splenic marginal zone-B-cell lymphoma, ameloblastoma, giant cell glioblastoma, glioblastoma, hepatoblastoma, medulloblastoma, nephroblastoma, neuroblastoma, pleuropulmonary blastoma, and pulmonary blastoma, and retinoblastoma, tumor, adenocarcinoid tumor, atypical carcinoid tumor, Brenner tumor, carcinoid tumor, epithelial tumor, gastrointestinal stromal tumor, giant cell tumor of soft parts, glomus tumor, granulosa cell tumor, Klatskin tumor, malignant peripheral nerve sheath tumor, malignant rhabdoid tumor, mesodermal mixed tumor, mixed tumor, mucinous cystic tumor of borderline malignancy, Mullerian mixed tumor, myofibroblastic tumor, peripheral neuroectodermal tumor, phyllodes tumor, phyllodes tumor, primitive neuroectodermal tumor, serous surface papillary tumor, solitary fibrous tumor, tumor cells, yolk sac tumor, adenoma, adrenal cortical adenoma, atypical adenoma, cystadenoma, atypical adenoma, cystadenoma, fibroadenoma, follicular adenoma, hepatocellular adenoma, intraductal papillary-mucinous adenoma, pleomorphic adenoma, serous cystadenoma, serrated adenoma, tubular adenoma, tubulovillous adenoma, villous adenoma, mixed tumors, angiomyolipoma, astrocytoma, atypical fibrous histiocytoma, Barrett's esophagus, Bowen disease, central neurocytoma, clear cell adenocarcinofibroma, dysgerminoma, dysplasia, embryo fibroblasts, endometriosis, ependymoma, esophagitis, essential thrombocythemia, fibrillary astrocytoma, fibrosis, gemistocytic astrocytoma, germinoma, glandular intraepithelial neoplasia, glioma, gliomatosis cerebri, glucagonoma, goblet cell carcinoid, hemangioendothelioma, hemangiopericytoma, hidrocystoma, hydatidiform mole, hyperplasia, insulinoma, keloid, keratoacanthoma, keratosis, Langerhans cell histiocytosis, lentigo maligna melanoma, leucoplakia, lipoma, malignant fibrous histiocytoma, malignant histiocytosis, malignant melanoma, malignant myoepithelioma, meningioma, mesothelioma, metaplasia, mixed glioma, mycosis fungoides, myelodysplastic syndrome, myelosclerosis with myeloid metaplasia, myoepithelioma, neoplasm, neurilemoma, nodular melanoma, oligodendroglioma, osteochondroma, pheochromocytoma, pigmented nevus, pilocytic astrocytoma, plasmacytoma, pleomorphic xanthoastrocytoma, polycythemia vera, polyp, pterygium, pulmonary sclerosing hemangioma, refractory anemia, seminoma, serous adenocarcinofibroma, Sezary syndrome, squamous intraepithelial neoplasia, superficial spreading melanoma, teratoma, thymoma, urothelial papilloma, Waldenstrom macroglobulinemia, aggressive fibromatosis, lymphomatoid papulosis, combinations thereof and the like.

    1.4 Rescuing mp53

    [0156] Approximately one-third of the p53 mutations are located on one of six mp53 hotspots: R175, G245, R248, R249, R273, and R282, (each a mp53 hotspot) (Freed-Pastor and Prives, 2012). Mutated p53 (or mp53) falls roughly into two categories. Contacting mp53 has lost its DNA binding ability without drastically affecting the p53 structure (Contacting mp53). Examples of Contacting mp53s include p53-R273H (3.0% mutation frequency), p53-R273C (2.5% mutation frequency), p53-R248Q (3.3% mutation frequency) and p53-R248W (2.7% mutation frequency). See also FIG. 1. Structural mp53 has lost its wtp53 3D structure (Structural mp53). Because Structural mp53 has lower thermal stability than wtp53, Structural mp53 has a much higher population of unfolded p53s than wtp53. Examples of Structural mp53s include p53-R175H (4.2% mutation frequency), p53-R175L (0.1% mutation frequency), p53-G245D (0.6% mutation frequency), p53-G245S (1.6% mutation frequency), p53-R249S (1.5% mutation frequency), p53-R249M (0.2% mutation frequency), p53-R282W (2.1% mutation frequency), and p53-R282G (0.2% mutation frequency). See also FIG. 1. Both Contacting mp53s and Structural mp53s has greatly impaired DNA-binding ability and transcriptional activity. Moreover, most of cancer-derived mp53s lose wtp53's tumor-suppressive functions and many also gain oncogenic properties.

    [0157] As seen in its representative member, the R282W mutation disrupts the hydrogen-bond network in the local loop-sheet-helix motif, reducing the melting temperature (T, an index for thermally stability of protein) and cause global, structural destabilization. A broad-spectrum rescue agent would thus need to increase the T.sub.m. We further discovered that four pairs of the 10 mp53 cysteines (C176/C182, C238/C242, C135/C141, and C275/C277) are in close proximity to the Structural mp53 hotspots (FIG. 11) and that covalently crosslinking the cysteine pairs and/or clusters can immobilize the local region and thereafter be enough to off-set the flexibility caused by the nearby hotspot mutation(s).

    [0158] PANDA also regains transcriptional activities on most of the p53 target genes as shown in the heatmap of RNA expression level of a set of 127 p53 targets. RNA sequencing (RNA-seq) data also shows that among the reported 116 genes p53-activated targets, the majority of the target genes were up-regulated by PANDA-R282W, including the well-known p53 targets BBC3, BAX, TP5313, CDKN1A, and MDM2.

    [0159] We solved the 3D structure of at least one mp53 at a resolution of approximately 1-3 (see FIG. 11 shows a 3D structure of the mp53, p53-R249S), identified a druggable pocket on p53 for the restoration of wildtype structure and function (PANDA Pocket) (see FIG. 1 showing the PANDA Pocket is located at the dorsal end of p53), and discovered that the PANDA Pocket is key to p53 structural stability. Importantly, the druggable PANDA Pocket can be used to screen p53 rescue compounds. We further discovered immobilizing the PANDA Pocket with a PANDA Agent would stabilize the mp53 structure. We further discovered that group of key residues played significant role in controlling the stability of PANDA Pocket (FIG. 14). These amino acid residues include S116, F134, Q136, T140, P142, and F270. For example, we found S116N, S116F and Q136R mutations on p53-G245S can rescue PIG3 transcriptional activity. Similarly, S116N and Q136R mutations on p53-G245S can rescue PUMA transcriptional activity. Based on our crystal structure (for example, of p53-R249S; p53-R249S with As; p53-G245S; and p53-G245S with As) and our mass spectroscopy results, we confirmed a single arsenic (or analogue) atom covalently binds the three cysteines C124, C135, and C141 (each a PANDA Cysteine and together a PANDA Triad) within the PANDA Pocket.

    [0160] In certain embodiments, the PANDA Core is produced by a reaction between the PANDA Pocket and the PANDA Agent. Preferably, the reaction is mediated by an As, Sb, and/or Bi group oxidizing one or more thiol groups of PANDA Cysteines (PANDA Cysteines lose between one to three hydrogens) and the As, Sb, and/or Bi group of PANDA Agent is reduced (PANDA Agent loses oxygen). In certain embodiments, the PANDA Agent is the reduzate formed from having tightly associated with p53. In certain embodiments, the PANDA Agent is an arsenic atom, an antimony atom, a bismuth atom, any analogue thereof, combinations thereof, and the like.

    [0161] In certain embodiments, the PANDA Agent transforms cancer-promoting mp53 to tumor suppressive PANDA and have significant advantages over existing therapeutic strategies such as by reintroducing wtp53 or promoting degradation/inactivation of endogenous mp53 in the patient. The PANDA Agent mediated mp53 rescue through PANDA, high rescue efficiency and mp53 selectivity are the two superior characteristics over previously-reported compounds. In certain embodiments, the PANDA Agent ATO can provide a near complete rescue of p53-R175H, from a level equivalent to about 1% of that of wtp53 to about 97% of that of wtp53 using the robust PAb1620 (also for PAb246) IP assay. In certain embodiments, the PANDA Agent ATO also provides a near complete rescue of the transcriptional activity of p53-G245S and p53-R282W on some pro-apoptotic targets, from a level equivalent to about 4% of that of wtp53 to about 80% of that of wtp53, using a standard luciferase reporter assay. In other embodiments, the PANDA Agent ATO can rescue the function of mp53s to a level that exceeds that of the wtp53, as shown, for example, in our luciferase assay for p53-1254T and p53-V272M. We have robustly reproduced these superior results, as compared to existing compounds, in numerous contexts and know no existing compound that can rescue the structure or transcriptional activity of a hotspot mp53 by a level equivalent to about 5% of that of wtp53 in our assays.

    [0162] In certain embodiments, the PANDA Agent ATO and PANDA can selectively target Structural mp53 with strikingly high efficiency. In addition, Contracting mp53s can also be rescued with moderate efficiency. For example, we found a wide range of Structural mpS3s, including a large percentage of hotspot mp53s, can be efficiently rescued by the PANDA Agent ATO through the formation of PANDA. In addition, we also found that the Contacting mp53s can be rescued by ATO through PANDA with a limited efficiency. This remarkable property is not only superior but is conceptually different from most of the reported compounds, including CP-31398 (Foster et al., 1999), PRIMA-1 (Bykov et al., 2002), SCH529074 (Demma et al., 2010), Zinc (Puca et al., 2011), stictic acid (Wassman et al., 2013), p53R3 (Weinmann et al., 2008), and others that are reported to be able to rescue both types of mp53.

    1.5 PANDA Agents, Compounds for Rescuing Mp53

    [0163] As used in this application, PANDA refers to the p53 and arsenic analogue complex. PANDA Cysteine refers to one of C124, C135, or C141. PANDA Triad refers to the C124, C135, C141 together. PANDA Pocket refers to the three-dimensional structure centered around PANDA Triad. The PANDA Pocket includes PANDA Triad and directly contacting residues (S116 contacts C124, C275 and R273 contact C135, Y234 contacts C141), residues adjacent to PANDA Triad (V122, T123, T125, and Y126; M133, F134, Q136, and L137; K139, T140, P142, and V143), and residues in 7-A distance to PANDA Triad (L114, H115, G117, T118, A119, K120, S121, A138, 1232, H233, N235, Y236, M237, C238, N239, F270, E271, V272, V274, A276, C277, P278, G279, R280, D281, and R282) (FIG. 13). PANDA Core refers to the PANDA Pocket with a PANDA Agent bounded to it. PANDA Agent refers to the rescue agent capable of forming at least one tight association with the PANDA Pocket. PANDA Agent can be any compound that efficiently stabilizes mp53 by binding potentials to the PANDA Pocket. Preferably, the PANDA Agent enhances T.sub.m of mp53 by about 3-100 times of those of PRIMA-1, and/or folds mp53 by about 3-100 times of those of PRIMA-1, and/or stimulates mp53's transcriptional activity by about 3-100 times of those of PRIMA-1. Preferably, PANDA Agent has at least one cysteine binding potentials, further preferably two or more cysteine binding potential, and further preferably three or more cysteine binding potential. Further preferably, PANDA Agent is compound containing one or more As, Bi or Sb atom. Further preferably, PANDA Agent can be selected from the thousands of compounds listed in Table 1-Table 6, which we have predicted to efficiently bind PANDA Cysteines and efficiently rescue mp53 in situ. More preferably, PANDA Agent is one of the 33 compounds listed in Table 7, which we had experimentally confirmed to rescue mp53's structure and transcriptional activity. More preferably, PANDA Agent include the arsenic analogues such as As.sub.2O.sub.3, NaAs.sub.2, SbCl.sub.3, and HOC.sub.6H.sub.4COOBiO which we confirmed to directly bind p53-R249S (FIG. 8); and As.sub.2O.sub.3, HOC.sub.6H4COOBiO, Bil.sub.3, SbI.sub.3, and C.sub.6H.sub.4K.sub.2O.sub.12Sb.sub.2.xH2O. which we have shown to stabilize mp53 structure (see discussions in Section 1.5).

    [0164] We discovered that in general, compounds with one or more cysteine-binding potentials on p53, preferably two or more cysteine-binding potential on p53, and more preferably three cysteine-binding potential on p53 are good rescue compounds for a broad spectrum of mp53s. Some of these compounds can rescue mp53 to near wildtype-like conditions (see FIG. 15 and FIG. 17). For example, we showed that of the 47 arsenic-containing compounds in the DTP library, those with one or more cysteine binding potentials have significantly similar NCI60 inhibition profiles as the ATO, an mp53 rescue agent with strong structural and functional rescue capacity (see Table 9, and FIG. 5-FIG. 10). Among these, compounds with three or more cysteine binding potential (e.g.: NSC3060 (KAsO.sub.2, Pearson's correlation 0.837, p<0.01), NSC157382 (Pearson's correlation 0.812, p<0.01), and NSC48300 (4 cysteine-binding potential; Pearson's correlation of 0.627, p<0.01)) have higher similarity to ATO than compounds with two cysteine binding potential (NSC92909, Pearson's correlation 0.797, p<0.01; NSC92915, Pearson's correlation 0.670, p<0.01; NSC33423, Pearson's correlation 0.717, p<0.01), which in turn has higher similarity than compounds with one cysteine binding potential, (NSC727224, Pearson's correlation 0.598, p<0.01; NSC724597, Pearson's correlation 0.38, p<0.01; NSC724599, Pearson's correlation 0.553). We further found that As, Sb, and/or Bi compounds with mono-cysteine binding potential (e.g.: NSC721951), bi-cysteine binding potential (e.g.: NSC92909), or tri-cysteine binding potential (e.g.: NAS3060) can rescue mp53's structure and transcriptional activity (Table 7). Moreover, compounds that has three or more cysteine binding potential having the highest rescue efficiency, followed by compounds with bi-cysteine binding potential, and followed by compounds with mono-cysteine binding potential (see Table 7; see also equations (1)-(6)).

    [0165] We further suggest other non-As, Sb, and Bi compounds can also serve as efficient a PANDA Agent as long as they can bind PANDA pocket which leads to mp53 stability. These compounds can contain group of thiols (e.g.: 1,4-Benzenedithiol), Michael acceptor (e.g.: (1E,6E)-1,7-Diphenyihepta-1,6-diene-3,5-dione), and others which can bind cysteine. These compounds can also lack of cysteine-binding ability, however, they bind other residues of PANDA pocket to stabilize mp53.

    [0166] We further discovered that the preferred rescue compounds for mp53 can (i) upon hydroxylation, simultaneously bind to one or more mp53 cysteines, preferably two or more mp53 cysteines, more preferably three mp53 cysteines; (ii) can form at least one tight bond to PANDA Pocket; (iii) can increase the ratio of folded p53 to unfolded p53 and/or refold mp53 with high efficiency, at levels comparable to that of wtp53 in some cases (as measured by immunoprecipitation with, for example, PAb1620 and/or PAb246); (iv) can rescue the transcriptional activity of mp53s at levels comparable to that of wtp53 in some cases (as measured by, for example, luciferase report assay); (v) can stabilize p53 and increase the melting temperature of mp53; (vi) can selectively inhibit mp53 expressing cell lines, such as the NCI60 cell lines that expresses the Structural hotspot mp53; (vii) can inhibit mouse xenografts dependent on Structural mp53s; and/or (viii) can be used to treat mp53 harboring cancer patients in combination with DNA-damaging agents.

    [0167] We further discovered that elemental arsenic, elemental bismuth, elemental antimony, and compounds containing elemental arsenic, bismuth, and/or antimony are good rescue compounds for mp53. We showed that arsenic, bismuth, and antimony containing compounds can stabilize the structure of mp53s and/or rescue its transcriptional activities (see Table 7). The arsenic-, bismuth-, and antimony-mediated mp53 rescue is achieved by binding of the released arsenic, bismuth, and antimony to mp53. For example, mass spectroscopy data showed arsenic, bismuth, and antimony atom binds to mp53 directly and covalently (see FIG. 8 showing single atom molecular weight increase under denaturing conditions) at 1:1 atom:mp53 ratio (or 0.930.19 arsenic per p53, as measured by inductively coupled plasma mass spectroscopy (ICP-MS)). The arsenic-, bismuth-, and antimony-mediated mp53 rescue also elevates mp53 T.sub.m. For example, mp53 T.sub.m increased by 1 C.-8 C. for As.sub.2O.sub.3, 1.85 C. for HOC.sub.6H.sub.4COOBiO, 0.86 C. for BiI.sub.3, 3.92 C. for SbI.sub.3, 2.95 C. for C.sub.8H.sub.4K.sub.2O.sub.12Sb.sub.2.H2O. Moreover, these rescue compounds can also rescue one or more mp53s. For example, As.sub.203, HOC.sub.6H4000BiO, BiI.sub.3, SbI.sub.3, C.sub.8H.sub.4K.sub.2O.sub.12Sb.sub.2.H2O can rescue at least p53-R175H, p53-V272M, and p53-R282W, and are expected to also rescue the rescuable mp53s in Table 9.

    [0168] We further discovered that the following six classes of compounds are preferred mp53 rescue compounds: a three-valence arsenic containing compound, preferably the compound can be hydrolyzed, further preferably the compound does not have a carbon-arsenic bond, further preferably the compound is one that is listed in Table 1; a five-valence arsenic containing compounds, preferably the compound can be hydrolyzed, further preferably the compound does not have a carbon-arsenic bond, further preferably the compound is one that is listed in Table 2); a three-valence bismuth containing compounds, preferably the compound can be hydrolyzed, further preferably the compound does not have a carbon-bismuth bond, further preferably the compound is one that is listed in Table 3; a five-valence bismuth containing compounds, preferably the compound can be hydrolyzed, further preferably the compound does not have a carbon-bismuth bond, further preferably the compound is one that is listed in Table 4; a three-valence antimony containing compounds, preferably the compound can be hydrolyzed, further preferably the compound does not have a carbon-antimony bond, further preferably the compound is one that is listed in Table 5; and five-valence antimony containing compounds, preferably the compound can be hydrolyzed, further preferably the compound does not have a carbon-antimony bond, further preferably the compound is one that is listed in Table 6. We arrived at the lists of compounds in Table 1-Table 6 by analyzing, in silico, approximately 94.2 million compounds derived from PubChem (https://pubchem.ncbi.nlm.nih.gov/), using the selection criteria of (i) compounds containing elemental arsenic or its analogues, such as antimony, and bismuth and (ii) the capacity to simultaneously bind to 3 cysteines (our compounds listed in Table 1-Table 6 are predicted to rescue mp53 with very high efficiency because they can simultaneously bind 3 cysteines of PANDA triad). These rescue compounds include three-valence and five-valence arsenic, three-valence and five-valence antimony, and three-valence and five-valence bismuth. The discovery of compounds containing Bi and/or Sb, and As, Sb, and/or Bi compounds with mp53 rescue capacity has tremendous clinical value because these compounds generally have lower toxicities than inorganic As compounds in the body.

    [0169] Exemplary embodiments of the rescue compound can include any one of the Formulas I-XV.

    ##STR00007##

    [0170] wherein: [0171] M is an atom selected from a group consisting of As, Sb, and Bi; [0172] Z is a functional group comprising a non-Carbon atom that forms a bond with M, [0173] wherein the non-Carbon atom is preferably selected from the group consisting of H, D, F, Cl, Br, I, O, S, Se, Te, Li, Na, K, Cs, Mg, Cu, Zn, Ba, Ta, W, Ag, Cd, Sn, X, B, N, P, Al, Ga, In, TI, Ni, Si, Ge, Cr, Mn, Fe, Co, Pb, Y, La, Zr, Nb, Pr, Nd, Sm, Eu, Gd, Dy, Tb, Ho, Er, Tm, Yb, and Lu;

    [0174] wherein: [0175] R.sub.1 is selected from 1 to 9 X groups; [0176] R.sub.2 is selected from 1 to 7 X groups; [0177] R.sub.3 is selected from 1 to 8 X groups; and [0178] wherein each X group comprises an atom that forms a bond with M; and

    [0179] wherein: [0180] each of M, the non-Carbon atom, and the atom has the appropriate charge, including no charge, in the compound; [0181] each of Z and X is independently selected and can be the same or different from the other Z or X in the compound, respectively; and [0182] each of the M, non-Carbon atom and the atom can be a part of a ring member.

    [0183] In the preferred embodiment, the non-Carbon atom is selected from the group consisting of O, S, N, X, F, Cl, Br, I, and H.

    [0184] Exemplary rescue compound with the structure of Formula I includes

    ##STR00008##

    As{circumflex over ()}{circumflex over ()}{circumflex over ()} (CID No. 5,359,596), and

    [0185] ##STR00009##

    [0186] Exemplary rescue compound with the structure of Formula II includes

    ##STR00010##

    [0187] Exemplary rescue compound with the structure of Formula III includes As.sup.+(OH).sub.2.

    ##STR00011##

    [0188] Exemplary rescue compound with the structure of Formula V includes

    ##STR00012## ##STR00013##

    [0189] Exemplary rescue compound with the structure of Formula V includes

    ##STR00014##

    and.

    [0190] Exemplary rescue compound with the structure of Formula VI includes

    ##STR00015##

    [0191] Exemplary rescue compound with the structure of Formula VIII includes

    ##STR00016##

    [0192] Exemplary rescue compound with the structure of Formula IX includes.

    ##STR00017##

    [0193] Exemplary rescue compound with the structure of Formula X includes

    ##STR00018##

    [0194] Exemplary rescue compound with the structure of Formula XII includes

    ##STR00019##

    [0195] Exemplary rescue compound with the structure of Formula XIII includes

    ##STR00020##

    [0196] Exemplary rescue compound with the structure of Formula XV includes

    ##STR00021##

    [0197] The following Equation (1) is an reaction for PANDA Agent. A compound containing M group with a Z.sub.1 (a first group with the capacity to bind a first cysteine) and/or a Z.sub.2 (a second group with the capacity to bind a second cysteine) and/or a Z.sub.3 (a third group with the capacity to bind a third cysteine), Examples of Z.sub.1, Z.sub.2, and Z.sub.3 includes O, S, N, X, F, Cl, Br, I, OH, and H. Z.sub.1, Z.sub.2, and/or Z.sub.3 can bind to each other. M group includes for example a metal, such as an bismuth, a metalloid, such as an arsenic and an antimony, a group such as a Michael acceptor and/or a thiol, and/or any analogue with cysteine-binding ability. The PANDA Agent can undergo a hydrolysis before reacting and binding to p53 forming PANDA. In some cases, when a group cannot undergo hydrolysis, and accordingly cannot bind to a cysteine. In such cases, the remaining group(s) with cysteine binding potential binds to p53. X.sub.1 and X.sub.2 represent any groups bound to M. X.sub.1 and/or X.sub.2 can also be empty. X.sub.1 and/or X.sub.2 can also be able to bind cysteine.

    ##STR00022##

    [0198] The following Equations (2) and (3) is an exemplary reaction for a PANDA Agent with tri-cysteine binding potential. 3-valence ATO or KAsO.sub.2 undergoes hydrolysis, covalently binds to three PANDA Cysteines on p53.

    ##STR00023##

    [0199] The following equation (4) is an exemplary reaction for a PANDA Agent with tri-cysteine binding potential. 5-valence As compound undergoes hydrolysis, covalently binds to three PANDA Cysteines on p53.

    ##STR00024##

    [0200] The following equation (5) is an exemplary reaction for a PANDA Agent with bi-cysteine binding potential. The PANDA Agent can bind to PANDA Cysteines, or to PANDA Cysteines (Cys.sub.124, Cys.sub.135, or Cys.sub.141), or Cys.sub.275 and Cys.sub.277 or C.sub.238 and C.sub.242.

    ##STR00025##

    [0201] The following equation (6) is an exemplary reaction for a PANDA Agent with mono-cysteine binding potential. The PANDA Agent can bind to PANDA Cysteines, (i.e. Cys.sub.124, Cys.sub.135, or Cys.sub.141) or the other 3 cysteines on PANDA Pocket (Cys.sub.236, Cys.sub.275, or Cys.sub.277).

    ##STR00026##

    [0202] We further discover that KAsO.sub.2, AsCl.sub.3, HAsNa.sub.2O.sub.4, NaAsO.sub.2, AsI.sub.3, As.sub.2O.sub.3, As.sub.2O.sub.5, KAsF.sub.6, LiAsF.sub.6, SbCl.sub.3, SbF.sub.3, SbAc.sub.3, Sb.sub.2O.sub.3, Sb(OC.sub.2H.sub.5).sub.3, Sb(OCH.sub.3).sub.3, SbI.sub.3, Sb.sub.2O.sub.5, Sb.sub.2(SO.sub.4).sub.3, BiI.sub.3, C.sub.1H.sub.1As.sub.2N.sub.4O.sub.2, C.sub.13H.sub.14As.sub.2O.sub.6, C.sub.17H.sub.28AsClN.sub.4O.sub.6S, C.sub.1OH.sub.13NO.sub.6Sb, C.sub.6H.sub.12NaO.sub.6Sb+, (CH.sub.3CO.sub.2).sub.3Sb, C.sub.6H.sub.4K.sub.2O.sub.12Sb.sub.2.xH.sub.2O, C.sub.13H.sub.21NaO.sub.9Sb+, HOC.sub.6H.sub.4COOBiO, [O.sub.2CCH.sub.2C(OH)(CO.sub.2)CH.sub.2CO.sub.2]Bi, (CH.sub.3CO.sub.2).sub.3Bi, As.sub.2S2, As.sub.2S3, and As.sub.2S.sub.5 are remarkable mp53 rescue compounds, capable of rescuing both the structure and transcriptional function of mp53 in experimental assays (see Table 7). For example, we tested some structural mp53s for their abilities to refold protein, increase T.sub.m, and stimulate transcriptional activity. Among these preferred mp53 rescue compounds, We discovered that As.sub.2O.sub.3 was previously approved by the U.S. Food and Drug Administration to treat acute promyelocytic leukemia (APL) in 2000 as NDA 21-248, but was not approved to treat other cancer types yet, because it did not provide any statistically significant efficacy. Additionally, the PANDA Agent Fowler's solution (KAsO.sub.2) has significant side-effects and are not used in clinical settings any more in past decades, but this may now be overcome by selecting and treating a patient with rescuable mp53, as disclosed in this Application. The PANDA Agent As.sub.4S4 has been shown to be as effective as conventional intravenous ATO in treating APL patients, but unlike ATO, As.sub.4S4 can be conveniently orally administrated (Zhu et al., 2013), making particularly attractive cancer therapy. Furthermore, we also discover that PANDA Agents As.sub.2S3, As.sub.2S2, and As.sub.2S5, which have strong ability to rescue mp53, can also be formulated for oral administration.

    [0203] We further discovered that arsenic trioxide (ATO: NSC92859 & NSC759274) and potassium arsenite (KAsO.sub.2: NSC3060) are two wide-spectrum mp53 rescuing agents with remarkably high rescue efficiency (Table 7, Table 9 and FIG. 12). For example, As.sub.2O.sub.3 increased wtp53-like structures of p53-R175H by approximately 50-100 fold to a level equivalent to about 97% of wtp53 (see FIG. 15); increased wtp53-like transcriptional activity of p53-R282W by approximately 21-fold, to a level equivalent to about 84% of wtp53 (FIG. 12 and FIG. 17); and increased wtp53-like transcriptional activity of p53-G245S by approximately 3-fold, to a level equivalent to about 77% of wtp53 (FIG. 12 and FIG. 17). We demonstrated that both ATO and KAsO.sub.2 can, among others, (i) rescue mp53 structure (see FIG. 6 showing a measurable increase of folded PAb1620 human epitope and PAb246 mouse epitope and a measurable decrease of the PAb240 epitope; see also Table 7); (ii) rescue mp53's DNA binding ability (see FIG. 16, showing ATO rescued p53-R175H DNA binding ability with respect to MDM2, which is involved in p53 self-regulation; CDKN1A, which encoding p21 protein and is involved in senescence, invasion, metastasis, cell stemness and cell cycle arrest; PIG3, which is involved in apoptosis; PUMA, which is involved in apoptosis; BAX, which is involved in apoptosis; and the p53-binding consensus sequence); (iii) rescue mp53's transcriptional activity (see FIG. 5, FIG. 12, and FIG. 17; see also Table 7); (iv) increase the production of p53 downstream mRNA such as MDM2, PIG3, PUMA, CDKN1A, and BAX, in about 24 hr; (v) increase production of downstream p53 protein, such as PUMA, BAX, PIG3, p21, and MDM2 in about 48 hours (see FIG. 18); (vi) rescue mp53's tumor suppressive function in vitro (see FIG. 5), in human cells (see FIG. 19), in mouse cells (see FIG. 23); (vii) rescue mp53's tumor suppressive function in vivo, including in solid tumor xenograft model (see FIG. 21) and hematological malignance xenograft model (FIG. 22); (viii) inhibit malignancies (see FIG. 20); (ix) rescue different mp53s (see FIG. 5, Table 7, Table 9 and FIG. 12); (x) and has remarkable rescue capacity for Structural mp53s (FIG. 5). These experimental data are further supported by our atom-level rescue mechanism, which includes hydrolyzing the rescue agent (see equations (1)-(6)) and binding to p53 (see equations (1)-(6)) and FIG. 7 showing mass spectroscopy data supporting direct and covalent association), thereby increasing the stability of mp53 folded state (see FIG. 9 showing an increase of mp53 T.sub.m by approximately 1 C.-8 C.), and inhibiting the denatured and aggregated state of mp53 (as shown, for example, in non-denaturing PAGE and western blot; see also FIG. 10). Compared to PRIMA-1 and its analogue PRIMA-1MET, which is under phase II clinical trial (Bauer et al., 2016; Joerger and Fersht, 2016), and which increasingly have been suggested to target oxidative stress signaling components, our PANDA Agents are highly effective and specific towards a diverse number of mp53, with low off targeting (see FIG. 28; see also Table 9).

    [0204] The PANDA Agent comprising a three and/or five valence arsenic is generally effective in treating cancer in a subject, including an animal, at a dose at a wide range of dosages by intravenous injection and oral administration. In certain embodiments, the daily dosage is from about 0.5 mg/kg to about 50 mg/kg, preferably from about 0.5 mg/kg to about 25 mg/kg, more preferably from about 1 mg/kg to about 25 mg/kg, more preferably from about 1 mg/kg to about 15 mg/kg, more preferably from about 1.7 mg/kg to about 15 mg/kg, and more preferably from about 1.7 mg/kg to about 5 mg/kg. In certain embodiments, the dose is about 5 mg/kg. In certain embodiments, the PANDA Agent ATO is administered by intravenous injection or by oral administration at 1 mg/ml concentration, at a dose of 5 mg/kg per day.

    [0205] In other embodiments, the daily dosage is from about 10 mg/kg to about 1000 mg/kg, preferably from about 10 mg/kg to about 500 mg/kg, more preferably from about 20 mg/kg to about 500 mg/kg, more preferably from about 20 mg/kg to about 300 mg/kg, more preferably from about 33 mg/kg to about 300 mg/kg, and more preferably from about 33 mg/kg to about 100 mg/kg. In certain embodiments, the dose is about 100 mg/kg. In certain embodiments, the PANDA Agent As.sub.2S2, As.sub.2S3, As.sub.2S5, and As.sub.4S4 is administered by oral administration at 15 mg/L concentration, at a dose of 100 mg/kg

    [0206] The PANDA Agent comprising a three valence and/or five valence antimony is generally effective in treating cancer in a subject, including an animal, at a dose at a wide range of dosages by intravenous injection and oral administration. In certain embodiments, dosage is from about 60 mg/kg to about 6000 mg/kg, preferably from about 60 mg/kg to about 3000 mg/kg, more preferably from about 120 mg/kg to about 3000 mg/kg, more preferably from about 120 mg/kg to about 1500 mg/kg, more preferably from about 150 mg/kg to about 1200 mg/kg, and more preferably from about 300 mg/kg to about 1200 mg/kg. In certain embodiments, the dose is about 600 mg/kg. In certain embodiments, the PANDA Agent is administered by intravenous or oral administration at 100 mg/ml concentration, at a dose of 600 mg/kg per day.

    [0207] The PANDA Agent comprising a three valence and/or five valence bismuth is generally effective in treating cancer in a subject, including an animal, at a dose at a wide range of dosages by intravenous injection and oral administration. In certain embodiments, the daily dosage is from about 60 mg/kg to about 6000 mg/kg, preferably from about 60 mg/kg to about 3000 mg/kg, more preferably from about 120 mg/kg to about 3000 mg/kg, more preferably from about 120 mg/kg to about 1500 mg/kg, more preferably from about 150 mg/kg to about 1200 mg/kg, and more preferably from about 300 mg/kg to about 1200 mg/kg. In certain embodiments, the dose is about 600 mg/kg. In certain embodiments, the PANDA Agent is administered by intravenous or oral administration at 100 mg/ml concentration, at a dose of 600 mg/kg per day.

    [0208] The PANDA Agent comprising a three and/or five valence arsenic is generally effective in treating cancer in a human at a wide range of dosages by intravenous injection and oral administration. In certain embodiments, the effective dose results in a maximum As concentration in the patient's blood (plasma) from about 0.094 mg/L to about 9.4 mg/L, preferably from about 0.094 mg/L to about 4.7 mg/L, more preferably from about 0.19 mg/L to about 4.7 mg/L, more preferably from about 0.31 mg/L to about 2.82 mg/L, more preferably from about 0.31 mg/L to about 1.31 mg/L, more preferably from about 0.57 to about 1.31 mg/L. In certain embodiments, the daily dose is from about 0.67 mg/kg to about 12 mg/kg, more preferably from about 0.2 to about 4.05 mg/kg, wherein the maximum As concentration is about 0.57 mg/L to about 1.31 mg/L, and wherein the platform As concentration in blood (plasma) is from about 0.03 mg/L to about 0.07 mg/L. In certain embodiments, the PANDA Agent is ATO, As.sub.2S.sub.2, As.sub.2S.sub.3, As.sub.2S.sub.5, and As.sub.4S.sub.4.

    [0209] The PANDA Agent comprising a three and/or five valence antimony is generally effective in treating cancer in a human at a wide range of dosages by intravenous injection and oral administration. In certain embodiments, the effective dose results in a maximum Sb concentration in the patient's blood (plasma) from about 3.58 mg/L to about 357.5 mg/L, preferably from about 3.58 mg/L to about 179 mg/L, more preferably from about 7.15 mg/L to about 179 mg/L, more preferably from about 7.15 mg/L to about 107 mg/L, more preferably from about 12 mg/L to about 107 mg/L, more preferably from about 32.7 to about 38.8 mg/L. In certain embodiments, the daily dose is from about 20 mg/kg, wherein the maximum Sb concentration is from about 32.7 mg/L to about 38.8 mg/L, and wherein the platform Sb concentration in blood (plasma) is about 3.5 mg/L.

    [0210] The PANDA Agent comprising a three and/or five valence bismuth is generally effective in treating cancer in a human at a wide range of dosages by intravenous injection and oral administration. In certain embodiments, the effective dose results in a maximum Bi concentration in the patient's blood (plasma) from about 3 mg/L to about 300 mg/L, preferably from about 3 mg/L to about 150 mg/L, more preferably from about 6 mg/L to about 150 mg/L, more preferably from about 6 mg/L to about 90 mg/L, more preferably from about 10 mg/L to about 90 mg/L, more preferably from about 30 mg/mL. In certain embodiments, the daily dose is from about 20 mg/kg, wherein the maximum Bi concentration is from about 32.7 mg/L to about 38.8 mg/L, and wherein the platform Bi concentration in blood (plasma) is about 3.5 mg/L.

    [0211] We further discovered that combining ATO and other approved drugs can be effective to treating cancer. For example, we found the combination therapy of ATO and a DNA-damaging agents can treat patients with AML and MDS. Results from our phase I Decitabine (DAC)ATO combination therapy trial for Myelodysplastic Syndrome (DMS) showed complete remission for the two patients that harbored rescuable mp53s (Table 11 and FIG. 26). DAC is a cytidine analog and first-line drug for MDS patients that binds to, causes damages to, and demethylates DNA. In this ongoing trial, which was approved by hospital ethics committee, we recruited 50 MDS patients, sequenced their TP53 exomes, and found patients #27, #35, and #49 harbored p53 mutations (mp53 variant allele fraction >10%) (Table 11 and FIG. 26). Among them, patients #27 and #35 harbored ATO rescuable p53-S241F and p53-S241C respectively, and are selected to be treated under the trial, while patient #49 harbored non-rescuable p53-R273L, and was not selected for trial treatment (FIG. 26; see also Table 8 and Table 9). Under the trial conditions, patients #27 and #35 were administered a treatment cycle of 25 mg of DAC and 0.2 mg/kg of ATO by intravenous guttae (ivgtt) every four weeks. For each cycle, DAC was administered on days 1, 2 and 3 and ATO was administered on days 3, 4, 5, 6, and 7. Patients #27 and #35 were monitored throughout the treatment and their minimal residual disease (MRD), bone marrow blast cells (BM blast), white blood cell count (WBC), haemagglutinin count (Hb), and platelet count (PLT) were measured periodically (see FIG. 26). Cancer cells were eliminated (blast cells detected to be <5%, i.e. complete remission) for Patient #27 and #35 for about 8 and 7 months respectively (see FIG. 26). In the reported standard DAC mono-treatment, where 101 MDS patients were treated without mp53 selection, only 27 patients achieved complete remission for 4-48 month, while the remaining 74 patients did not achieve complete remission (complete remission duration 0 month) (Chang et al, 2016). Thus, patients benefited statistically significantly more from the DAC-ATO combination regimen judging by the complete remission duration (P=0.0406). In standard DAC mono-treatment for 14 MDS patients expressing mp53, only 9 patients achieved complete remission for 3-14 month (i.e.: 3, 3, 4, 4, 6, 6, 10, 12, and 14 months), while the remaining 5 patients did not achieve complete remission (complete remission duration 0 month). Thus, even patients with mp53s benefited more from the DAC-ATO combination treatment as compared to the DAC mono-treatment (P=0.0013).

    [0212] We also identified patient #19, who harbored wtp53 during initial screening, but later developed DAC treatment related rescuable p53-Q038H and p53-Q375X on the 8th month of the DAC mono-treatment (see FIG. 26). At this time point, disease progression was fast, with the MDS expected to transform to AML in 1 month and patient #19 was expected to not survive beyond 2-4 months. Accordingly, patient #19 was administered a treatment cycle of 25 mg of DAC, 0.2 mg/kg of ATO, and 25 mg of ARA-c of ARA by intravenous guttae (ivgtt) every four weeks. For each cycle, DAC was administered on days 1, 2 and 3; ATO was administered on days 3, 4, 5, 6, and 7; and ARA is administered on days 1, 2, 3, 4, and 5. Like patients #27 and #35, patient #19 was also responsive to the combination therapy. The combination treatment with ATO and ara-C was effective in patient #19 even though the 8-month DAC mono-treatment still resulted in a fast progressed disease. In particular, upon the combination treatment cancer cells did not increases significantly for 6 month.

    [0213] Taken together, we have discovered that ATO is effective in treating cancer patients, such as MDS patients, particularly those harboring mp53s rescuable mutation. We further discovered that the efficacy of treatment can be improved by (1) obtaining a sample from the patient and sequencing patient's p53, (2) determining whether the mp53 is rescuable or not, and (3) administering an effective amount of one or more PANDA Agent, such as ATO and/or other drug candidates alone or in combination with other effective cancer drugs to the patient; selecting patients with p53 mutations on residues most responsive to ATO, such as mutations on S241C and S241F. Importantly, we have determined that the ATO rescuable mp53 includes: R175H, R245S, R248Q, R249S, R282W, I232T, F270C, Y220H, I254T, C176F, H179R, Y220C, V143A, S033P, D057G, D061G, Y126C, L130H, K132M, A138V, G154S, R156P, A159V, A159P, Y163H, Y163C, R174L, C176Y, H179Y, C238Y, G245A, G245D, R248W, G266R, F270S, D281H, D281Y, R283H, F054Y, SO90P, Q375X, Q038H, R156P, A159V, A159P, Y163H, Y163C, R174L, C176Y, H179Y, H179Q, P190L, H193R, R209K, V216E, Y234H, M2371, V272M, S241A, S241C, S241D, S241E, S241F, S241G, S241H, S2411, S241L, S241M, S241N, S241P, S241Q, S241R, S241T, S241V, S241W, and S241Y (see Table 8, mp53s that are indicated as either structurally rescuable or functionally rescuable). Additionally, we have determined that the ATO non-rescuable mp53s includes: R273H, R273C, R278S, S006P, L014P, Q052R, P072A, P080S, T081P, S094P, S095F, R273S, R273L, P278H, L383P, M384T, S241K (see Table 8 mp53s that are indicated as neither structurally rescuable nor functionally rescuable).

    [0214] mp53 is associated with considerably poor overall survival and prognosis of a wide range of cancers, including myeloid leukemia (AML/MDS) patients (Cancer Genome Atlas Research et al., 2013; Lindsley et al., 2017). Under NCCN guidelines, the majority of recommended AMLMDS treatments, aside from APL, are DNA-damaging agents. These DNA-damaging agents are known to activate wtp53 function to kill cancer cells through p53 post-translational modifications (PTMs) (Murray-Zmijewski et al., 2008). These PTMs include, for example, phosphorylation, acetylation, sumoylation, neddylation, methylation, and ubiquitylation.

    [0215] Our discovery further shows that PANDA Agent ATO can be used for a wide range of ATO-responsive cancers in clinical trials. It is preferred that patient recruitment follow a specific, highly precise, recruitment prerequisite, in order to achieve maximum efficacy. While ATO was approved by FDA to treat acute promyelocytic leukemia (APL), a subtype of leukemia and intensively trialed, with the aim to broaden its application to non-APL cancer types over the past two decades, it has not yet been approved for this purpose. This is largely attributed to a failure to reveal an ATO-affecting cancer spectrum. Indeed, no mp53 dependency can be observed in the sensitivity profile of ATO on the NCI60 cell panel simply by differentiating lines into a mp53 group and a wtp53 group. Non-ATO rescue compounds were also extensively researched and some were identified, including, CP-31398; PRIMA-1; PRIMA-1-MET; SCH529074; Zinc; stictic acid, p53R3; methylene quinuclidinone; STIMA-1; 3-methylene-2-norbomanone; MIRA-1; MIRA-2; MIRA-3; NSC319725; NSC319726; SCH529074; PARP-PI3K; 5,50-(2,5-furandiyl)bis-2-thiophenemethanol; MPK-09; Zn-curc or curcumin-based Zn(II)-complex; P53R3; a (2-benzofuranyl)-quinazoline derivative; a nucleolipid derivative of 5-fluorouridine; a derivative of 2-aminoacetophenone hydrochloride; PK083; PK5174; and PK7088. However, they have low rescue efficacy.

    [0216] The PANDA Agents we identified and described herein, including the PANDA Agents with Formulation I-XV, the PANDA Agents listed in Table 1-Table 6, and PANDA Agents listed in Table 7 show exceptional efficacy in rescuing mp53 with rescuable mutations (for example, those listed in Table 8) in vitro and in vivo, among others. Many of them have structures that are significantly different from ATO and have not previously been proposed for use in treating a p53 disorder. By separating rescuable mp53s from in a pool of patients with a p53 disorder, we have, for the first time, discovered a compound and method to effectively treat multiple types of p53 disorders, including multiple classes of cancers. The size of the class is considerably large, covering an estimated amount of 15%-30% cancer cases. As discussed, this is partly because p53 is one of the most important protein in cell biology and is implicated in wide range of disorders. For example, we have identified at least 4 of the 6 hotspot mp53s and a large number of non-hotspot mp53s to be efficiently rescuable by ATO and PANDA.

    [0217] Our personalized treatment separates those patients suitable for treatments with PANDA Agent and those who are not. By selecting those patients with rescuable mp53, we can begin to treat patients based on p53 mutation rather than cancer type. It is known that different missense mutations will confer different activities to mp53 (Freed-Pastor and Prives, 2012), which can lead to different treatment outcomes in patients harboring different mp53s. Accordingly, others like us advocate tailoring treatments to the types of p53 mutations present rather than simply whether mp53 or wtp53 is present (Muller and Vousden, 2013, 2014). However, a compound that can effectively treat and rescue mp53 was not identified until now. Remarkably, our discoveries on the MDS patient-derived p53-S241F, p53-S241C as well as the other artificially generated p53 mutants on S241 support that PANDA Agents rescuing efficiency is determined not only by the p53 mutation site but also by the new residue generated (FIG. 26). Additionally, our results show that PANDA Agents can rescue de novo p53 mutations created by cancer treatment. Accordingly, our PANDA Agents can provide an important complementary treatment to other effective drugs for treating a p53 disorder, including cancer, thereby opening the possibility to use the side effects created by those drugs that are likely to also cause DNA mutation (and therefor p53 mutation) during treatment.

    [0218] We have previously described a method of determining whether a mp53 is rescuable or not by IP or functional assays. However, these procedures must be done in a professional laboratory, and is time consuming and costly. The method of determining whether a mp53 is rescuable by determining whether a rescuable mp53 is present in the subject, as described herein, greatly improves the efficiency and financial burden for the subject.

    [0219] In addition to use in humans, results from our animal studies also support using PANDA agent to treat a p53 disorder, such as cancer, for veterinary use, for example, in such as a mouse, dog, a cat, and other companion animals, a cattle and other livestock, a wolf, a panda bear, or other zoo animals, and a horse or other equines

    [0220] Additionally, we discovered that mp53 (for example, p53-R175H) and PANDA (for example, PANDA-R175H) responded differently to the DNA-damaging agents, such as Cisplatin, Etoposide, Adriamycin/Doxorubicin, 5-Fluorouracil, Cytarabine (ara-C), Azacitidine, and Decitabine(DAC), suggesting they may trigger distinctly treatment outcomes. We discovered Ser15, Ser37, and Lys382 were inertly modified on p53-R175H upon DNA-damaging treatment; however, they behave like wtp53 in that they are actively modified on PANDA-R175H upon DNA-damaging treatment (FIG. 25). We discovered Ser20 was inertly modified on p53-R175H irrespective of DNA-damaging stress; however it is actively modified on PANDA-R175H irrespective of DNA-damaging stress. These results suggest that p53-R175H and PANDA-R175H distinctly respond to therapies and thus may trigger distinctly treatment outcomes This also suggested the PANDA-R175H behave like wtp53 by being actively modified by DNA-damaging agents. These results support a synergetic combination method of treatment using a combination of a PANDA Agent and a DNA-damaging agent, such as DAC and ara-C, to treat a p53 disorder, such as a MDS patient with rescuable mp53. We further saw that the PANDA Agent As.sub.2O.sub.3 structurally and/or transcriptionally rescued a wide-spectrum of mp53s (Table 9), including other commonly occurring mp53s, such as p53-C176F, p53-H179R, and p53-Y220C; mp53s with contacting hotspots, such as mp53-R248Q; and mp53s with mutations outside of DNA-binding region, such as p53-V143A, p53-F270C, and p53-1232T (Table 9 and FIG. 12).

    [0221] The characteristics of PANDA-forming reactions include the following: [0222] (a) prefers to rescue Structural mp53; [0223] (b) works for both human mp53 and mouse mp53; [0224] (c) works in both mammalian cells and bacterial cells; [0225] (d) works in vivo (in cells) and in vitro (in reaction buffer) [0226] (e) mp53 cysteine(s) are involved; [0227] (f) reaction is in a 1:1 molar ratio between mp53 and As atom [0228] (g) direct reaction; and [0229] (h) covalent reaction.

    [0230] The characteristics of ATO mediated folding include: [0231] (a) able to properly fold all tested Structural hotspot mp53s with a range of efficiency, including high to extremely high efficiency; [0232] (b) instant folding (<15 min); [0233] (c) folding is independent of cell types and treatment contexts, including resistant to EDTA in IP buffer; [0234] (d) folding is much more efficient than any of the reported compounds; [0235] (e) p53-R175H is almost fully restored as measured by the PAb1620 epitope; [0236] (f) efficient for both human mp53 and mouse mp53; [0237] (g) works in both mammalian cells and bacterial cells; [0238] (h) can fold mp53 that has been previously unfolded; [0239] (i) inhibits mp53 aggregation; and [0240] (j) Cys135 and Cys141 are involved in As-mediated mp53 folding.

    [0241] As disclosed herein, we discovered that (1) that ATO can function synergistically with other cancer inhibition therapies, (2) that combination anticancer therapy containing ATO has significant promises, and (3) that ATO may increase the efficacy of the wtp53-reactivating agents, such as MDM2 inhibitors, many of which are currently under clinical trials (FIG. 24)

    EXAMPLES

    1.6 Plasmids, Antibodies, Cell Lines, Compounds, and Mice

    [0242] pcDNA3.1 expressing human full length p53 was gift from Prof. Xin Lu (the University of Oxford), pGEX-2TK expressing fusion protein of GST and human full length p53 was purchased from Addgene (#24860), pET28a expressing p53 core was cloned for crystallization experiment without introducing any tag.

    [0243] Primary antibodies were purchased from the following companies: DO1 (ab1101, Abcam), PAb1620 (MABE339, EMD Millipore), PAb240 (OP29, EMD Millipore), PAb246 (sc-100, Santa Cruz), PUMA (4976, Cell signaling), PIG3 (ab96819, Abcam), BAX (sc-493, Santa Cruz), p21 (sc-817, Santa Cruz), MDM2 (OP46-100UG, EMD Millipore), Biotin (ab19221, Abcam), Tubulin (ab11308, Abcam), -actin (A00702, Genscript), p53-S15 (9284, Cell signaling), p53-S20 (9287, Cell signaling), p53-S37 (9289, Cell signaling), p53-S392 (9281, Cell signaling), p53-K382 (ab75754, Abcam), KU80 (2753, Cell signaling). CM5 antibody was gift from Prof. Xin Lu. HRP conjugated secondary antibody specifically reacts with light chain was from Abcam (ab99632).

    [0244] H1299 and Saos-2 cell lines expressing null p53 was gift from Prof. Xin Lu. H1299 cell lines expressing tet-off regulated p53-R175H or tet-on regulated wtp53 were prepared as reported previously (Fogal et al., 2005). MEFs were prepared from E13.5 TP53-/- and TP53-R172H/R172H embryos. The other cell lines were obtained from ATCC.

    [0245] Compounds were purchased from the following companies: DMSO (D2650, sigma), CP31398 (PZ0115, sigma), Arsenic trioxide (202673, sigma), STIMA-1 (506168, Merck Biosciences), SCH 529074 (4240, Tocris Bioscience), PhiKan 083 (4326, Tocris Bioscience), MiRA-1 (3362, Tocris Bioscience), Ellipticine (3357, Tocris Bioscience), NSC 319726 (S7149, selleck), PRIMA-1 (S7723, selleck), RITA (NSC 652287, S2781, selleck), Cycloheximide (C7698, sigma), Biotin (A600078, Sangon Biotech), Doxycycline hyclate (D9891, sigma), Cisplatin (CIS, P4394, sigma), Etoposide (ETO, E1383, sigma), Adriamycin (ADM, S1208, selleck), 5-Fluorouracil (5-FU, F6627, sigma), Cytarabine (ARA, S1648, selleck), Azacitidine (AZA, A2385, sigma), Decitabine (DAC, A3656, sigma). Bio-As and Bio-Dithi-As were gift from Kenneth L. Kirk (NIH; PMID: 18396406).

    [0246] The TP53 wild-type mice, female nude mice and NOD/SCID mice were obtained from the Shanghai Laboratory Animal Center, Chinese Academy of Sciences. TP53-R172H/R172H mice were generated from the parent mice (026283) purchased from Jackson Lab. TP53/ mice (002101) were purchased from National Resource Center of Model Mice of China.

    [0247] DNA samples were sequenced in rainbow-genome technique Ltd (Shanghai) and Shanghai Biotechnology corporation (Shanghai).

    1.7 Preparation of PANDA (without p53's N-Terminus and C-Terminus, without Tag) Formed in Bacteria

    [0248] Constructions expressing recombinant TP53 core domain were transformed into E. coli strain BL21-Gold. Cells were cultured in either LB or M9 medium at 37 C. to mid-log phase. 0.5 mM isopropyl-p-D-thiogalactopyranoside (IPTG) was added in presence/absence of 50 M As/Sb/Bi and 1 mM ZnCl.sub.2 at 25 C. for overnight. Cells were harvested by centrifugation at 4 000 RPM for 20 minutes (10 g cell paste yielded from 1 liter of medium) and then sonicated in lysate buffer (50 mM Tris, pH 7.0, 50 mM NaCl, 10 mM DTT and 1 mM phenylmethylsulfonyl fluoride) in presence/absence of 50 M As/Sb/Bi. Soluble lysate was loaded onto a SP-Sepharose cation exchange column (Pharmacia) and eluted with a NaCl gradient (0-1 M) then, if necessary, additionally purified by affinity chromatography with a heparin-Sepharose column (Pharmacia) in Tris.HCl, pH 7.0, 10 mM DTT with a NaCl gradient (0-1 M) for elution. Future purification was performed by gel-filtration using Superdex 75 column using standard procedure.

    [0249] Processes after cell lysing are done at 4 C. Protein concentration was measured spectrophotometrically by using an extinction coefficient of 16 530 cm.sup.1M.sup.1 at 280 nm. All protein purification steps were monitored by 4-20% gradient SDS-PAGE to ensure they were virtually homogeneous.

    1.8 Preparation of PANDA (with GST Tag) Formed in Bacteria

    [0250] Constructions expressing GST-p53 (or GST-mp53) were transformed into E. coli strain BL21-Gold. Cells were grown in 800 ml LB medium at 37 C. to mid-log phase. 0.3 mM IPTG with/without 50 M As/Sb/Bi was added at 16 C. for 24 h. Cells were harvested by centrifugation at 4 000 RPM for 20 minutes and then sonicated in 30 ml lysate buffer (58 mM Na2HPO4.12H2O, 17 mM NaH2 PO4.12H2O, 68 mM NaCl, 1% Triton X-100) in presence/absence of 50 M As/Sb/Bi. Cell supernatant after 9000 RMP for 1 hour was added with 400 l glutathione beads (Pharmacia) and incubated overnight. Beads were washed with lysate buffer for 3 times. Recombinant protein was then eluted by 300 l elution buffer (10 mM GSH, 100 mM NaCl, 5 mM DTT and 50 mM Tris-HCl, pH 8.0). Processes after cell lysing are done at 4 C. All protein purification steps were monitored by 4-20% gradient SDS-PAGE to ensure they were virtually homogeneous.

    1.9 Preparation of PANDA Formed in Insect Cells

    [0251] Baculovirus infected Sf9 cells expressing recombinant human full-length p53 or p53 core in presence/absence of 50 M As/Sb/Bi were harvested. They lysed in lysate buffer (50 mM Tris-HCl, pH 7.5, 5 mM EDTA, 1% NP-40.5 mM DTT, 1 mM PMSF, and 0.15 M NaCl) in presence/absence of 50 M As/Sb/Bi. The lysates were then incubated on ice for 30 min, followed by centrifuging at 13000 rpm for 30 min. The supernatant was diluted 4-fold using 15% glycerol, 25 mM HEPES, pH 7.6, 0.1% Triton X-100, 5 mM DTT and 1 mM Benzamidine. They were further filtered using a 0.45 mm filter, and purified by Heparin-Sepharose column (Pharmacia). Purified protein was then concentrated using YM30 Centricon (EMD, Millipore). All protein purification steps were monitored by 4-20% gradient SDS-PAGE to ensure they were virtually homogeneous.

    1.10 Preparation of PANDA Formed In Vitro

    [0252] PANDA can be efficiently formed by mixing p53, either purified p53 or p53 in cell lysate, with one or more PANDA Agent. For example, in reaction buffer (20 mM HEPES, 150 mM NaCl, pH 7.5), we mixed purified recombinant p53 core and As/Sb/Bi compounds in a ratio ranging from 10:1-1:100 at 4 C. for overnight. The formed PANDA was then purified using dialysis to eliminate compounds.

    1.11 In Vitro Reaction of Recombinant GST-p53-R175H and as

    [0253] 50 M purified recombinant protein GST-p53-R175H in reaction buffer (10 mM GSH, 100 mM NaCl, 5 mM DTT and 50 mM Tris-HCl, pH 8.0) was added with Biotin-As to obtain arsenic to p53 molar ratio of either 10:1 or 1:1. The mixture solution was incubated at 4 C. for overnight and then divided into three parts. Each part was subjected to SDS-PAGE, followed by Coomassie blue staining (5 g GST-p53-R175H applied), p53 immunoblotting (0.9 g GST-p53-R175H applied) or Biotin immunoblotting (5 g GST-p53-R175H applied), respectively.

    1.12 Immunoprecipitation

    [0254] For immunoprecipitation, mammalian cells or bacteria cells were harvested and lysed in NP40 buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% NP40) with cocktail of protease inhibitors (Roche Diagnostics). Cell lysates were then sonicated for 3 times, followed by spinning at 13,000 RPM for 20 min. Supernatant was adjusted to a final concentration of 1 mg/ml total protein using 450 l NP40 buffer and incubated with 20 l protein G beads and 1-3 g corresponding primary antibody for 2 hr at 4 C. The beads were washed for three times with 20-25 C. NP40 buffer at room temperature. After spinning down, the beads were boiled for 5 min in 2SDS loading buffer, followed by Western blotting.

    1.13 Biotin-Arsenic Based Pull-Down Assay

    [0255] Cells were treated with 4 g/ml Bio-As or Bio-dithi-As for 2 hours. Cells were lysed in NP40 buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% NP40) with cocktail of protease inhibitors (Roche Diagnostics). Cell lysates were then sonicated for 3 times, followed by spinning at 13,000 RPM for 1 hr. Supernatant was adjusted to a final concentration of 1 mg/ml total protein using 450 l NP40 buffer and incubated with 20 l streptavidin beads for 2 hr at 4 C., followed by bead washing and Western blotting.

    1.14 Biotin-DNA Based Pull-Down Assay

    [0256] To prepare double-stranded oligonucleotides, equal amount of complementary single stranded oligonucleotides were heated at 80 C. for 5 min in 0.25 M NaCl, followed by slow cooling to room temperature. Sequences of single stranded oligonucleotides were followed:

    TABLE-US-00001 Consensus 5-Biotin-TCGAGAGGCATGTCTAGGCATGTCTC PUMA 5-Biotin-CTGCAAGTCCTGACTTGTCC PIG3 5-Biotin-AGAGCCAGCTTGCCCACCCATGCTCGC GTG BAX 5-Biotin-TCACAAGTTAAGACAAGCCTGGGCGTG GGC MDM2 5-Biotin-CGGAACGTGTCTGAACTTGACCAGCTC p21 5-Biotin-CGAGGAACATGTCCCAACATGTTGCTC GAG Consensus-R 5-GAGACATGCCTAGACATGCCTCTCGA PUMA-R 5-GGACAAGTCAGGACTTGCAG PIG3-R 5-CACGCGAGCATGGGTGGGCAAGCTGGCTCT BAX-R 5-GCCCACGCCCAGGCTTGTCTTAACTTGTGA MDM2-R 5-GAGCTGGTCAAGTTCAGACACGTTCCG p21-R 5-CTCGAGCAACATGTTGGGACATGTTCCTCG

    [0257] Cells were harvested and lysed in NP40 buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% NP40) with cocktail of protease inhibitors (Roche Diagnostics). Cell lysates were then sonicated for 3 times, followed by spinning at 13,000 RPM for 1 hr. Supernatant was adjusted to a final concentration of 1 mg/ml total protein using 450 l NP40 buffer and incubated with 20 l streptavidin beads (s-951, Invitrogen), 20 pmoles of biotinylated double-stranded oligonucleotides, and 2 g of poly(dl-dC) (sc-286691, Santaz cruz). Lysates were incubated for 2 hr at 4 C., followed by bead washing and immunoblotting.

    1.15 Immunoblotting

    [0258] Immunoblotting was performed as reported previously (Lu et al., 2013).

    1.16 Luciferase Assay

    [0259] Cells were plated at a concentration of 210.sup.4 cells/well in 24-well plates, followed by transfection of luciferase reporter plasmids for 24 hr. All transfection contained 300 ng p53 expressing plasmid, 100 ng of luciferase reporter plasmid and 5 ng of renilla plasmid per well. After agent treatment, cells were lysed in luciferase reporter assay buffer and determined using a luciferase assay kit (Promega). Activities of luciferase were divided by that of renilla to normalize the transfection efficiency. For more details, see (Lu et al., 2013).

    1.17 Colony Formation Assay

    [0260] Treated cells were digested with trypsin. 100, 1000 or 10,000 cells/well were seeded in 12-well plates and kept in culture for 2-3 weeks. Fresh medium was replaced every three days.

    1.18 Non-Denaturing PAGE

    [0261] Cells were lysed in either CHAPS buffer (18 mM 3-[(3-cholamidopropyl) dimethylammonio]-1-propanesulfonic acid in TBS) or M-PER buffer (78501, Invitrogen) containing DNase and protease inhibitors for 15 min at 4 C. or 37 C. Cell lysate was added with 20% glycerol and 5 mM Coomassie G-250 before loading into 3-12% Novex Bis-Tris gradient gels. The electrophoresis was performed at 4 C. according to the manufacturer's instructions. Proteins were transferred onto the polyvinylidene fluoride membranes and fixed with 8% acetic acid for 20 min. The fixed membranes were then air dried and destained with 100% methanol. Membranes were blocked for overnight with 4% BSA in TBS at 4 C. before immunoblotting.

    1.19 Real Time qPCR

    [0262] Total RNA was isolated from cells using Total RNA Purification Kit (B518651, Sangon Biotech). 1 g total RNA was reverse-transcribed using the GoScript Reverse Transcriptase System (A5001, Promega) following manufacturer's protocol. PCR was performed in triplicate using SYBR green mix (Applied Biosystems), and a ViiA 7 Real-Time PCR System (Applied Biosystems) under the following conditions: 10 min at 95 C. followed by 40 cycles of 95 C. for 15 s and 60 C. for 1 min. Specificity of the PCR product was checked for each primer set and samples from the melting curve analysis. Expression levels of targeted genes were normalized relative to levels of -actin adopting comparative Ct method. The primer sequences are as follows: MDM2 forward 5-CCAGGGCAGCTACGGTTTC-3, reverse 5-CTCCGTCATGTGCTGTGACTG-3; PIG3 forward 5-CGCTGAAATTCACCAAAGGTG-3, reverse 5-AACCCATCGACCATCAAGAG-3; PUMA forward 5-ACGACCTCAACGCACAGTACG-3, reverse 5-TCCCATGATGAGATTGTACAGGAC-3; p21 forward 5-GTCTTGTACCCTTGTGCCTC-3, reverse 5-GGTAGAAATCTGTCATGCTGG-3; Bax forward 5-GATGCGTCCACCAAGAAGCT-3, reverse 5-CGGCCCCAGTTGAAGTTG-3; #-actin forward 5-ACTTAGTTGCGTTACACCCTTTCT-3, reverse 5-GACTGCTGTCACCTTCACCGT-3.

    1.20 Xenograft Assay

    [0263] H1299 xenograft. H1299 cells expressing tet-off regulated p53-R175H (1*10.sup.6 cells) suspended in 100 l saline solution were subcutaneously injected into the flanks of 8-9 weeks old female nude mice. When the tumor area reached 0.1 cm (day 1), 5 mg/kg ATO were intraperitoneally injected 6 consecutive days per week. In DOX groups, 0.2 mg/ml doxycycline was added to drinking water. Tumor size was measured every 3 days with vernier callipers. Tumor volumes were calculated using the following formula: (L*W* W)/2, in which L represents the large diameter of the tumor, and W represents the small diameter. When tumor area reached 1 cm diameter in any group, mice were sacrificed and isolated tumors were weighed. The analysis of the differences between the groups was performed by Two-way RM ANOVA with Bonferroni correction.

    [0264] CEM-C1 xenograft. 8-9 week old NOD/SCID mice were intravenously injected through the tail vein with 1*10.sup.7 cells of CEM-C1 T-ALL cells (day 1). After engraftment, peripheral blood samples were obtained from the mice retro-orbital sinus every 3 or 4 days from day 16 to day 26. Residual red blood cells were removed using erythrocyte lysis buffer (NH.sub.4Cl 1.5 mM, NaHCO.sub.3 10 Mm, EDTA-2Na 1 mM). The isolated cells were double stained with PerCP-Cy5.5-conjugated anti-mouse CD45 (mCD45) (BD Pharmigen, San Diego, Calif.) and FITC-conjugated anti-human CD45 (hCD45) (BD Pharmigen, San Diego, Calif.) antibodies before flow cytometric analysis conducted. When the percent of hCD45+ cells in peripheral blood reached 0.1% one mice (day 22), ATO was prepared for injection. On day 23, 5 mg/kg ATO were intravenously injected via tail-vein in 0.1 ml saline solution 6 consecutive days per week. The comparison of the hCD45+ cells percent between the groups was performed by unpaired t test. The life-span of mice was analyzed by Log-rank (Mantel-Cox) test.

    [0265] All statistical analysis was performed using GraphPad Prism 6.00 for Windows (La Jolla Calif., USA). The animals were housed in specific pathogen-free conditions. Experiments were carried out according to the National Institutes of Health Guide for Care and Use of Laboratory Animals.

    1.21 Statistical Analysis

    [0266] Statistical analysis was carried out using Fisher's exact test (two-tailed) unless otherwise indicated. p values less than 0.05 were considered statistically significant unless otherwise indicated.

    TABLE-US-00002 TABLE 1 1.22 1100 three-valence arsenic (As) containing compounds were predicted to efficiently bind PANDA Pock6jet and efficiently rescue Structural mp53. All of the 94.2 million structures recorded in PubChem (https://pubchem.ncbi.nimmih.gov/) were applied for 4C+ screening. In the 4C+ screening, we collected those with more than 2 cysteine-binding potential. Carbon-binding As/Sb/Bi bond has defect in binding cysteine since this bond cannot be hydrolyzed. The other Asi/Sb/Bi bond can be hydrolyzed in cells and thus is able to bind cysteine.Arsenic 3 Valence Panda Agents Arsenic 3 Valence PANDA Agents CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. 544 545 14,770 14,772 19,167 19,541 21,763 23,969 24,569 24,570 24,571 24,575 24,577 24,679 24,967 25,130 25,156 25,214 26,435 33,719 40,516 48,705 61,545 61,738 62,222 62,391 76,591 78,450 82,779 82,780 82,781 82,782 82,783 82,784 82,785 82,786 82,787 82,876 82,877 82,873 82,879 82,880 82,998 82,999 83,000 83,001 83,002 83,003 84,670 89,859 91,500 96,373 109,033 116,252 116,256 116,257 117,908 122,957 138,780 139,279 139,298 139,321 139,322 139,323 139,324 139,773 139,891 139,939 140,012 143,005 145,013 150,167 158,274 159,390 165,514 167,244 167,245 167,445 178,411 178,412 178,413 178,414 178,415 178,416 180,503 184,133 187,781 193,333 197,119 204,633 602,148 606,254 607,452 635,386 2,724,938 2,784,590 3,019,767 3,019,768 3,033,858 3,051,241 3,051,242 3,051,637 3,051,638 3,055,940 3,083,023 3,627,253 4,093,503 4,390,915 4,628,691 5,127,350 5,148,939 5,149,849 5,231,667 5,245,643 5,246,853 5,247,035 5,247,036 5,247,256 5,247,881 5,248,768 5,248,769 5,255,179 5,256,195 5,256,504 5,258,395 5,258,981 5,259,398 5,259,672 5,460,506 5,460,562 5,460,564 5,460,565 5,460,566 5,460,587 5,460,722 5,491,620 5,743,819 5,743,820 6,284,547 6,326,784 6,327,292 6,329,460 6,329,630 6,329,663 6,331,458 6,334,574 6,335,843 6,337,007 6,391,215 6,395,537 6,395,538 6,395,543 6,395,544 6,395,864 6,395,865 6,395,866 6,395,867 6,395,868 6,397,860 6,398,629 6,711,222 6,857,430 6,857,431 6,857,580 6,914,516 6,914,518 6,914,531 9,548,861 9,543,868 9,548,869 9,553,924 9,553,925 9,823,432 9,940,355 10,285,774 10,540,385 10,709,168 10,714,189 10,716,984 10,717,398 10,744,851 10,752,266 10,886,649 10,887,184 10,887,185 10,896,360 10,908,016 10,930,378 10,963,436 11,010,611 11,010,612 11,017,329 11,017,851 11,017,852 11,049,547 11,134,592 11,148,325 11,193,862 11,248,058 11,251,274 11,256,472 11,298,875 11,310,398 11,316,887 11,385,570 11,402,381 11,412,921 11,431,015 11,465,219 11,476,512 11,562,561 11,607,348 11,650,722 11,676,828 11,686,352 11,706,542 11,751,340 11,831,174 11,966,301 11,966,302 11,968,269 11,970,814 11,970,815 11,980,559 12,022,729 12,029,075 12,060,026 12,060,027 12,060,028 12,060,029 12,062,780 12,062,953 12,062,954 12,105,505 12,549,303 12,549,305 12,549,308 12,622,637 12,639,434 12,690,546 12,690,547 12,692,939 12,754,317 12,754,318 12,758,717 12,758,718 12,758,720 12,909,455 12,946,537 12,946,538 12,964,989 12,970,646 13,068,571 13,076,527 13,426,139 13,464,647 13,528,538 13,528,542 13,528,544 13,528,552 13,710,813 13,726,197 13,751,567 14,042,655 14,226,398 14,389,419 14,420,822 14,951,535 14,962,238 15,130,450 15,165,101 15,193,599 15,193,603 15,214,107 15,241,817 15,393,356 15,443,371 15,43,375 15,452,707 15,452,708 15,452,709 15,463,897 15,544,525 15,763,917 15,768,782 15,770,833 15,770,922 15,773,246 15,775,979 15,779,670 15,784,977 15,787,963 15,787,964 15,793,134 15,801,408 15,804,634 15,831,253 15, 831,254 15,836,478 15,836,479 15,836,480 15,845,941 15,902,288 15,909,316 15,911,001 16,103,935 16, 122,615 16,122,617 16,217,311 16,687,467 16,687,468 16,688,418 16,688,647 16,688,985 17,950,332 17,972,457 17,972,458 17,999,318 18,620,370 18,699,306 18,764,508 18,924,269 18,982,511 19,067,450 19,076,933 19,377,136 19,770,611 19,827,518 19,882,979 19,977,769 19,977,790 20,194,853 20,194,857 20,209,387 20,209,339 20,313,265 20,363,283 20,386,190 20,481,422 20,498,187 20,519,997 20,519,998 20,745,926 20,838,028 20,843,076 20,843,447 20,843,448 20,846,387 20,846,388 20,976,124 21,096,828 21,117,048 21,119,276 21,119,939 21,119,940 21,124,621 21,126,002 21,126,578 21,127,708 21,152,268 21,153,195 21,153,196 21,396,696 21,402,593 21,498,356 21,597,738 21,597,741 21,666,086 21,679,197 21,679,198 21,718,489 21,719,691 21,720,503 21,732,336 21,732,337 21,732,338 21,732,339 21,732,340 21,732,341 21,732,582 21,732,691 21,732,985 21,854,934 21,854,935 21,854,936 21,854,937 21,854,938 21,854,939 21,854,940 21,854,941 21,854,942 21,854,943 21,854,944 21,854,945 21,854,946 21,854,947 21,854,948 21,854,949 21,896,088 21,932,415 21,954,723 21,998,317 22,099,016 22,119,650 22,223,246 22,239,183 22,341,918 22,413,077 22,717,370 22,333,492 22,895,349 23,028,044 23,234,053 23,234,054 23,235,595 23,235,987 23,261,952 23,261,953 23,261,954 23,261,955 23,261,956 23,261,957 23,261,958 23,261,959 23,261,960 23,261,961 23,261,962 23,261,963 23,261,964 23,261,965 23,261,966 23,261,967 23,261,968 23,262,012 23,262,763 23,263,174 23,263,178 23,263,198 23,263,199 23,263,239 23,270,086 23,280,718 23,354,875 23,412,685 23,412,687 23,412,683 23,412,690 23,412,691 23,412,692 23,412,693 23,412,694 23,412,695 23,412,696 23,412,697 23,412,725 23,412,739 23,412,743 23,416,402 23,418,415 23,419,990 23,420,083 23,424,003 23,424,004 23,443,680 23,588,764 23,538,768 23,616,631 23,616,677 23,618,364 23,618,423 23,613,916 23,618,935 23,618,936 23,513,946 23,620,087 23,620,337 23,620,895 23,620,896 23,620,897 23,623,772 23,665,003 23,663,346 23,696,518 23,697,313 23,719,535 23,719,541 23,719,552 24,733,960 24,846,178 24,834,190 25,113,239 25,147,458 25,147,462 25,147,473 25,208,316 42,615,748 42,627,489 42,627,490 42,627,491 42,627,492 44,144,454 44,151,659 44,152,997 44,153,294 44,395,086 44,563,905 45,051,723 45,479,364 45,479,365 45,479,524 45.479,525 49,866,861 50,922,181 50,922,452 50,931,488 50,931,515 50,931,522 50,933,634 50,933,999 50,934,000 50,936,983 53,239,239 53,249,217 53,339,027 53,339,028 53,349,346 53,349,347 53,349,348 53,349,349 53,349,350 53,349,351 53,349,352 53,423,860 53,432,730 53,471,870 53,492,526 54,603,741 54,611,691 54,696,380 54,723,496 56,840,839 57,346,053 57,346,345 57,346,984 57,347,790 57,351,126 57,351,127 57,354,213 57,354,214 57,359,120 57,359,121 57,376,611 57,376,762 57,448,761 57,448,769 57,448,813 57,448,860 57,466,141 57,467,921 57,484,655 57,517,166 57,763,376 57,763,404 58,743,125 58,857,119 59,080,074 60,207,945 71,301,049 71,309,374 71,310,805 71,310,806 71,334,864 71,336,057 71,339,387 71,345,105 71,349,031 71,350,771 71,350,783 71,353,378 71,353,379 71,353,399 71,355,900 71,355,927 71,357,772 71,358,656 71,358,665 71,358,778 71,359,001 71,359,074 71,361,408 71,361,450 71,363,675 71,367,036 71,367,054 71,367,078 71,367,094 71,367,112 71,367,851 71,370,608 71,377,166 71,377,167 71,380,410 71,386,575 71,389,205 71,389,206 71,389,207 71,389,208 71,395,187 71,395,375 71,396,322 71,401,400 71,401,410 71,407,586 71,410,644 71,410,645 71,417,968 71,417,969 71,430,842 71,436,452 71,443,407 71,443,408 71,446,592 71,446,618 71,446,960 71,526,741 71,580,995 71,586,773 72,720,419 73,351,195 73,357,742 73,415,825 73,894,232 73,894,234 74,765,958 74,935,276 76,871,762 76,963,989 76,966,440 78,060,866 78,061,006 78,062,686 78,063,158 78,063,159 78,066,382 78,066,392 78,070,72l 85,571,114 85,577,990 85,605,969 85,607,971 85,609,099 85,612,664 85,613,640 85,632,096 85,756,556 85,775,826 85,779,417 85,792,258 85,793,306 85,808,862 85,824,116 85,850,779 85,850,780 85,850,781 85,850,782 85,850,783 85,850,785 85,850,786 85,850,789 85,850,790 85,860,792 85,884,398 85,911,906 85,977,561 85,994,471 86,013,960 86,014,167 86,065,878 86,126,557 86,154,041 86,159,344 86,172,918 86,176,315 86,205,935 86,249,175 86,717,687 87,090,222 87,094,975 87,109,955 87,111,979 87,118,088 87,144,977 87,144,978 87,189,618 87,205,247 87,205,248 87,234,713 87,246,827 87,248,447 87,255,851 87,255,859 87,255,872 87,255,873 87,235,874 87,255,878 87,255,879 87,255,885 87,255,886 87,410,957 87,472,810 87,472,812 87,473,759 87,474,264 87,474,374 87,474,643 87,474,789 87,475,307 87,475,822 87,475,824 87,475,926 87,476,165 87,476,184 87,476,290 87,476,403 87,476,530 87,476,558 87,476,21 87,476,845 87,476,848 87,477,042 87,477,044 87,477,165 87,477,318 87,477,537 37,477,756 87,477,757 87,478,031 87,434,462 87,551,850 87,562,825 87,581,052 87,581,053 87,676,186 87,700,226 87,700,230 87,700,407 87,776,602 87,812,518 87,858,508 87,980,104 87,980,186 87,989,328 88,144,816 88,162,162 88,184,704 88,248,144 88,263,967 88,266,006 88,305,231 88,305,232 88,315,700 88,342,746 88,389,746 88,415,561 88,433,797 88,438,798 88,464,855 88,464,856 88,491,208 88,510,137 88,510,138 88,510,139 88,510,140 88,513,649 88,513,650 88,513,651 88,625,918 88,625,919 88,633,062 88,658,127 88,686,405 88,720,065 88,738,074 88,738,075 88,738,076 88,738,077 88,738,154 88,744,197 88,791,225 88,798,792 88,798,793 88,807,785 88,814,284 88,838,825 88,838,826 89,525,461 89,588,457 89,921,988 90,115,830 90,470,710 90,479,326 91,733,954 91,750,137 91,750,137 91,751,251 91,886,304 91,988,436 91,989,816 91,994,839 91,999,513 91,999,513 92,001,091 92,001,092 92,002,930 92,003,357 92,007,238 92,024,388 92,024,388 92,024,399 92,024,401 92,024,402 92,025,101 92,025,102 92,025,103 92,025,104 92,025,105 92,025,106 92,025,107 92,025,108 92,025,109 92,025,110 92,025,111 92,025,112 92,025,113 92,025,732 92,026,266 92,026,424 92,026,427 92,026,688 92,026,716 92,026,737 92,026,781 92,026,881 92,026,963 92,027,058 92,027,110 92,027,269 92,027,367 92,027,458 92,027,511 92,027,541 92,027,722 92,028,182 92,028,237 92,028,421 92,028,660 92,028,686 92,028,728 92,028,791 92,028,795 92,028,877 92,028,881 92,028,938 92,043,202 100,918,999 100,919,000 100,942,061 100,942,062 100,949,123 100,986,766 100,986,767 100,991,044 100,931,045 100,999,027 101,005,335 101,005,336 101,005,337 101,005,338 101,005,339 101,013,781 101,013,782 101,013,783 101,047,156 101,064,325 101,085,742 101,113,845 101,113,846 101,116,387 101,117,156 101,118,991 101,174,827 101,237,011 101,260,419 101,282,796 101,289,874 101,354,116 101,354,274 101,379,755 101,411,205 101,436,717 101,436,720 101,458,326 101,459,329 101,485,971 101,485,973 101,485,974 101,499,194 101,499,195 101,533,802 101,533,803 101,547,226 101,575,977 101,617,225 101,619,265 101,666,991 101,666,992 101,682,434 101,682,435 101,682,436 101,682,437 101,682,438 101,694,974 101,694,975 101,694,976 101,694,977 101,694,978 101,694,979 101,695,476 101,763,094 101,763,095 101,763,095 101,763,096 101,763,096 101,763,097 102,098,990 102,167,962 101,838,903 101,838,904 101,848,513 101,852,195 101,861,498 101,861,499 101,913,584 101,923,897 101,948,144 102,015,291 102,034,400 102,062,180 102,062,402 102,063,353 102,076,551 102,076,552 102,095,097 102,098,989 102,098,990 102,167,962 102,180,144 102,180,145 102,186,306 102,213,935 102,213,936 102,213,937 102,226,697 102,239,094 102,351,891 102,351,892 102,351,897 102,351,898 102,371,199 102,414,495 102,414,496 102,415,253 102,496,603 102,499,917 102,499,918 102,511,469 102,528,387 102,528,388 102,528,389 102,528,390 102,593,935 102,601,572 119,077,607 122,364,373 122,378,045 122,378,046 123,133,548 123,133,548 129,628,305 129,629,427 129,630,515 129,631,280 129,631,344 129,631,597 129,631,743 129,631,758 129,631,787 129,631,891 129,634,318 129,635,174 129,637,470 129,642,045 129,642,046 129,643,934 129,643,936 129,643,938 129,645,426 129,651,528 129,652,225 129,655,074 129,659,469 129,660,712 129,672,983 129,677,715 129,679,346 129,679,347 129,679,425 129,679,623 129,680,077 129,686,362 129,639,790 129,692,591 129,693,147 129,703,372 129,703,373 129,705,075 129,705,678 129,715,852 129,724,489 129,729,547 129,729,551 129,737,952 129,741,926 129,742,025 129,742,535 129,756,855 129,757,023 129,757,215 129,774,469 129,774,997 129,805,810 129,809,454 129,821,735 129,828,133 129,828,662 129,828,842 129,828,911 129,829,589 129,842,137 129,842,236 129,842,237 129,849,818 129,858,925 129,858,931 129,863,921 129,865,429 129,365,431 129,873,049 129,887,306 129,388,984 129,889,538 129,890,164 129,891,119 129,891,127 129,891,128 129,892,162 131,700,384 131,736,786 131,852,787 131,852,788 131,864,457 131,864,465 131,364,960 131,865,018 131,871,206 131,872,531 131,874,138 131,874,746 131,876,990 131,876,991 131,876,992 131,884,149

    TABLE-US-00003 TABLE 2 1.23 3071 five-valence arsenic (As) containing compounds were predicted to efficiently bind PANDA Pocket and efficiently rescue structural mp53. All of the 94.2 million structures recorded in PubChem (https://pubchem.ncbi.nlm.nih.gov/) were applied for 4C+ screening. In the 4C+ screening, we collected those with more than 2 cysteine-binding potential. Carbon-binding As/Sb/Bi bond has defect in binding cysteine since this bond cannot be hydrolyzed. The other As/Sb/Bi bond can be hydrolyzed in cells and thus is able to bind cysteine. Arsenic 5 Valence Panda Agents CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. 233 234 1,985 2,513 5,104 7,365 7,373 7,389 8,312 8,480 8,802 8,947 8,948 9,313 9,314 9,525 10,799 10,809 10,810 11,453 12,055 13,127 13,479 14,771 15,465 16,555 16,851 17,845 20,770 21,074 21,250 21,251 21,252 21,253 21,511 21,548 21,549 22,193 22,273 22,773 22,874 23,060 23,129 23,514 23,515 23,749 24,262 24,500 24,501 24,572 24,574 24,938 24,943 25,303 25,929 26,065 27,052 27,401 27,817 30,852 30,853 30,854 32,602 36,829 38,223 44,902 45,720 46,313 46,681 46,683 46,684 46,685 46,686 46,840 47,275 52,340 52,503 52,504 52,505 52,506 52,949 52,950 52,951 52,952 52,953 52,954 61,460 61,477 61,617 61,618 61,619 62,043 66,826 66,944 66,945 67,177 67,178 67,782 68,198 68,199 68,532 68,716 72,905 73,161 74,471 77,393 77,588 77,589 79,424 79,425 79,502 79,769 79,849 79,871 80,448 80,568 80,894 81,422 82,223 82,228 84,776 93,839 94,822 94,911 94,933 95,017 95,018 95,019 95,452 95,473 104,785 138,903 113,151 113,152 114,800 115,320 115,371 116,251 116,491 116,504 119,656 120,177 124,738 124,739 124,921 126,669 127,752 128,033 129,501 135,804 135,805 135,806 145,014 145,125 151,614 151,615 151,637 156,005 159,810 160,269 160,801 161,792 165,585 166,814 166,815 166,826 166,828 166,835 167,250 167,617 167,906 169,458 173,497 174,008 174,227 176,957 177,152 177,517 177,518 177,719 178,410 178,417 178,418 182,380 185,520 187,828 187,863 187,864 189,991 189,992 190,282 192,901 193,598 193,853 196,505 197,032 197,906 201,395 202,213 202,581 202,583 203,113 203,535 203,784 219,617 220,597 220,599 220,807 222,574 223,334 223,335 223,336 223,337 223,338 223,339 223,342 223,343 223,344 223,345 223,347 223,349 223,352 223,788 223,789 223,806 223,807 224,248 224,249 224,250 224,251 224,252 224,253 224,255 224,256 224,257 224,258 224,260 224,261 224,262 224,263 224,264 224,265 224,267 224,268 224,270 224,271 224,272 224,273 224,274 224,275 224,276 224,278 224,282 224,283 224,284 224,288 224,289 224,290 224,294 224,295 224,298 224,301 224,309 224,575 224,660 224,877 224,878 224,880 224,881 224,891 224,892 224,893 224,894 224,896 224,897 224,901 224,902 224,903 224,906 224,907 224,908 224,911 224,912 224,914 224,916 224,917 224,918 224,920 224,921 224,922 224,923 224,924 224,925 224,927 224,928 224,929 225,780 225,783 225,785 225,786 225,788 225,789 225,791 225,798 225,799 225,802 225,806 229,965 231,057 231,882 231,895 231,896 231,966 231,967 231,968 231,969 232,560 232,563 232,565 232,566 232,567 233,201 233,281 233,320 233,321 233,324 233,325 233,833 234,155 234,202 234,284 234,285 234,286 234,535 234,536 234,539 234,557 234,559 234,560 234,637 234,639 234,890 236,817 237,668 237,669 237,670 237,671 237,672 237,673 237,674 237,991 238,189 238,195 238,219 233,220 238,221 238,223 238,243 238,244 239,021 239,026 239,027 239,028 239,032 240,762 241,152 241,153 241,156 241,157 241,158 241,631 241,636 241,906 241,907 241,908 241,909 241,911 241,912 241,913 241,918 241,958 241,963 241,964 2,4,263 244,264 244,266 247,798 247,799 247,800 251,060 252,526 256,154 258,099 260,823 260,832 261,003 261,005 261,009 261,010 261,011 261,012 261,013 261,014 261,015 261,016 261,020 261,021 261,022 261,023 261,024 261,025 261,027 261,032 261,033 261,034 261,035 261,041 261,042 261,044 261,045 261,049 261,050 261,227 261,292 263,033 266,086 266,087 266,088 266,089 266,090 256,091 266,093 266,093 266,094 266,095 266,096 266,097 266,098 266,099 266,100 266,101 267,079 267,080 267,081 267,082 267,083 267,084 267,085 267,086 267,087 267,088 268,483 269,333 269,334 269,335 269,336 263,337 271,056 272,658 272,661 276,766 279,132 279,133 279,134 279,135 279,136 279,139 279,140 279,143 279,145 284,458 285,210 290,150 291,940 302,275 302,501 306,424 311,059 312,296 312,297 312,298 312,299 312,300 312,301 312,302 312,303 312,304 312,305 312,306 312,307 312,308 312,309 312,310 312,311 312,312 312,313 312,314 312,315 312,316 312,317 312,313 312,319 312,320 312,321 312,323 312,324 312,325 312,326 312,327 312,328 312,329 312,343 312,344 312,345 312,346 312,347 312,348 312,349 312,350 312,351 312,352 312,353 312,354 312,355 312,356 312,357 312,358 312,359 312,360 312,361 312,362 312,363 312,364 312,365 312,366 312,367 312,368 312,359 312,370 312,371 312,372 312,373 312,374 312,398 312,399 313,155 313,862 313,863 313,902 313,903 313,904 314,151 315,973 315,974 316,130 316,131 316,132 316,133 320,045 320,046 336,175 342,404 343,608 343,707 343,967 345,305 345,306 345,307 345,308 348,593 348,594 349,408 349,409 349,410 349,411 349,412 351,639 352,197 352,198 352,199 352,200 352,201 370,185 370,186 370,137 370,136 375,754 375,755 375,756 375,757 375,758 375,759 408,050 408,051 408,054 408,195 408,316 408,516 408,517 408,519 408,520 408,521 408,738 403,750 408,799 412,896 416,469 416,470 416,631 416,682 417,079 418,983 419,695 421,932 427,855 427,856 427,857 428,063 437,230 437,231 444,541 448,676 459,200 459,202 459,204 459,205 459,206 459,207 459,208 459,210 459,212 459,213 459,215 459,218 459,219 459,220 459,221 459,222 459,223 459,224 459,225 504,158 516,879 516,880 516,881 516,883 517,279 517,280 518,706 520,618 535,512 579,327 579,570 536,279 588,512 607,978 608,363 614,819 617,794 618,159 618,262 618,397 620,441 624,094 2,724,247 2,724,695 2,737,135 2,750,690 3,026,915 3,027,197 3,027,198 3,027,199 3,027,200 3,027,201 3,027,202 3,027,203 3,027,204 3,027,205 3,027,206 3,027,207 3,027,208 3,027,203 3,027,210 3,027,211 3,027,212 3,027,213 3,027,214 3,027,215 3,027,216 3,032,448 3,045,783 3,048,851 3,049,066 3,056,312 3,056,538 3,056,539 3,066,278 3,080,685 3,034,152 3,084,166 3,246,035 3,246,047 3,246,304 3,246,400 3,280,085 3,286,756 3,286,757 3,302,537 3,371,533 3,475,487 3,492,319 3,509,539 3,511,008 3,531,782 3,562,037 3,597,904 13,665,457 3,752,912 3,309,018 4,027,696 4,116,415 4,144,350 4,147,503 4,164,893 4,179,826 4,191,628 4,199,732 4,206,495 4,246,481 4,248,649 4,340,488 4,383,733 4,389,454 4,412,562 4,435,830 4,459,508 4,486,063 4,549,863 4,584,095 4,607,773 4,619,461 4,644,413 4,650,712 4,685,638 4,993,357 5,009,787 5,080,432 5,107,483 5,142,636 5,162,030 5,167,687 5,232,584 5,232,585 5,238,192 5,239,771 5,247,890 5,250,553 5,251,787 5,252,153 5,256,281 5,256,284 5,259,384 5,351,644 5,351,887 5,351,895 5,351,952 5,354,537 5,354,538 5,354,540 5,354,630 5,355,552 5,355,760 5,357,528 5,357,558 5,357,633 5,357,680 5,357,681 5,358,126 5,359,629 5,360,419 5,380,357 5,381,267 5,382,968 5,459,312 5,453,316 5,460,560 5,460,563 5,460,585 5,460,701 5,464,162 5,464,667 5,473,608 5,475,118 5,475,577 5,476,381 5,476,572 5,483,153 5,483,161 5,489,080 5,489,145 5,491,976 5,492,518 5,702,671 5,748,340 5,743,677 5,821,031 5,826,948 5,829,414 5,880,406 5,937,425 5,959,443 5,992,379 6,049,608 6,070,355 6,080,553 6,087,455 6,096,941 6,109,063 6,159,957 6,312,763 6,327,082 6,327,913 6,328,535 6,323,560 6,330,351 6,331,883 6,332,329 6,337,418 6,364,518 6,364,519 6,364,520 6,364,651 6,366,769 6,376,379 6,382,968 6,394,013 6,395,068 6,395,320 6,395,368 6,396,200 6,396,201 6,418,871 6,432,805 6,433,170 6,433,171 6,433,174 6,437,949 6,444,039 6,449,333 6,451,222 6,451,314 6,451,315 6,452,870 6,453,098 6,454,696 6,455,149 6,455,217 6,507,977 6,508,406 6,508,670 6,521,590 6,523,657 6,537,679 6,713,513 6,713,772 6,793,087 6,799,026 6,802,412 6,811,780 6,814,348 6,817,904 6,825,298 6,833,367 6,833,821 6,911,855 9,543,168 9,548,831 9,548,866 9,548,867 9,575,228 9,575,832 9,577,326 9,577,343 9,578,161 9,578,311 9,573,314 9,580,365 9,589,372 9,589,414 9,604,595 9,605,082 9,649,548 9,798,053 9,808,042 9,310,878 9,824,749 9,837,036 9,860,187 9,860,551 9,862,801 9,865,965 9,888,902 9,931,103 9,936,090 9,949,579 9,949,580 9,954,856 10,023,468 10,024,149 10,069,126 10,090,976 10,257,888 10,312,004 10,338,262 10,345,828 10,349,701 10,386,772 10,394,431 10,431,022 10,443,824 10,477,524 10,505,812 10,508,513 10,530,076 10,577,925 10,643,908 10,649,763 10,650,069 10,651,033 10,666,444 10,671,140 10,674,237 10,697,032 10,744,586 10,745,819 10,746,567 10,748,489 10,757,607 10,816,826 10,834,120 10,840,702 10,876,483 10,878,406 10,878,407 10,936,360 10,981,618 11,002,054 11,005,114 11,049,085 11,063,982 11,077,325 11,103,145 11,187,997 11,195,304 11,211,437 11,224,375 11,232,487' 11,251,075 11,269,492 11,311,393 11,334,638 11,336,975 11,369,488 11,371,427 11,403,966 11,435,113 11,452,073 11,468,263 11,559,479 11,560,431 11,624,317 11,738,836 11,750,101 11,800,790 11,801,096 11,813,954 11,813,954 11,949,825 11,949,826 11,949,827 11,949,992 11,949,993 11,949,994 11,949,995 11,949,996 11,949,997 11,950,160 11,952,475 11,952,476 11,952,477 11,971,649 11,971,650 11,980,558 11,985,990 11,986,029 11,987,433 12,049,081 12,049,082 12,049,083 12,112,343 12,305,258 12,305,260 12,485,864 12,485,867 12,485,868 12,485,869 12,485,370 12,595,784 12,645,905 12,654,670 12,736,159 12,736,220 12,747/453 12,756,830 12,795,887 12,824,390 12,832,980 12,832/981 12,884,523 13,047,346 13,050,612 13,134,261 13,212,303 13,212,306 13,212,312 13,302,718 13,302,719 13,416,700 13,443,227 13,443,228 13,516,476 13,613,089 13,643,880 13,678,819 13,678,824 13,678,825 13,683,693 13,726,122 13,734,063 13,743,985 13,750,255 13,765,615 13,765,616 13,305,634 13,805,693 13,812,873 13,813,546 13,829,286 13,909,037 13,955,960 13,980,772 13,981,841 14,009,635 14,066,966 14,066,967 14,094,413 14,122,911 14,178,438 14,205,366 14,205,726 14,205,728 14,205,730 14,205,731 14,223,279 14,389,153 14,401,159 14,401,163 '14,453,762 14,513,380 14,671,601 14,700,083 14,744,953 14,734,649 14,818,755 14,833,399 14,876,330 14,376,967 14,902,319 14,912,293 14,921,144 15,001,088 15,012,428 15,072,186 15,211,288 15,225,244 15,225,439 15,360,813 15,362,043 15,394,753 15,412,253 15,412,285 15,412,290 15,535,760 15,536,995 15,638,459 15,787,841 15,796,321 16,211,134 16,211,720 16,213,153 16,682,839 16,683,367 16,684,317 16,635,520 16,635,995 16,696,532 16,697,858 16,697,859 16,697,860 16,697,861 16,697,362 16,697,863 16,703,059 16,704,216 16,704,429 16,704,431 16,705,057 16,714,200 16,714,201 17,753,879 17,753,924 17,972,451 13,006,662 18,362,488 18,401,442 18,426,515 18,442,047 18,458,521 18,471,244 18,513,358 18,513,372 18,544,746 18,620,404 18,620,407 18,633,056 18,633,053 18,678,997 13,690,655 13,699,569 18,760,606 18,760,618 18,760,569 18,762,179 18,764,458 18,735,193 18,735,194 13,798,734 13,942,540 18,942,541 18,944,705 18,950,086 18,956,772 18,981,320 18,982,476 18,982,574 19,023,078 19,026,428 19,026,430 19,026,432 19,026,436 19,026,437 19,026,438 19,026,441 19,032,110 19,044,210 19,067,415 19,077,033 19,105,252 19,347,785 19,350,187 19,360,272 19,382,081 19,609,626 19,609,639 19,702,616 19,739,449 19,739,453 19,739,455 19,748,686 19,751,144 19,757,136 19,757,143 19,757,145 19,757,146 19,762,759 19,786,074 19,790,659 19,795,274 19,827,519 19,833,769 19,836,514 19,872,105 19,882,894 19,893,232 19,898,354 19,968,620 19,981,220 20,031,692 20,035,298 20,035,299 20,038,204 20,042,688 20,054,866 20,054,981 20,055,037 20,055,252 20,056,599 20,056,600 20,056,785 20,063,715 20,063,742 20,063,039 20,083,766 20,083,785 20,083,796 20,083,797 20,085,186 20,095,232 20,143,803 20,144,054 20,152,548 20,152,549 20,152,701 20,154,552 20,202,607 20,202,656 20,207,034 20,209,276 20,209,388 20,211,642 20,246,464 20,271,624 20,287,272 20,288,961 20,360,926 20,371,762 20,445,407 20,474,394 20,474,403 20,474,405 20,480,138 20,482,994 20,484,753 20,486,182 20,488,746 20,503,507 20,503,509 120,503,51 20,503,512 20,503,514 20,512,536 20,516,635 20,529,308 20,531,312 20,542,969 20,549,509 20,558,446 20,569,120 20,634,001 20,693,889 20,832,953 20,836,092 20,837,621 20,838,029 20,838,030 20,838,042 20,841,764 20,841,765 20,844,702 20,844,703 20,845,094 20,845,106 20,849,356 20,975,696 20,977,035 20,977,049 20,978,299 21,114,753 21,114,754 21,114,763 21,114,764 21,114,783 21,114,860 21,115,629 21,117,047 21,119,391 21,120,402 21,120,735 21,120,889 21,120,928 21,121,096 21,121,135 21,122,097 21,125,668 21,126,516 21,127,315 21,127,316 21,127,707 21,139,502 21,139,503 21,139,534 21,139,535 21,141,030 21,141,081 21,152,149 21,154,358 21,183,466 21,225,639 21,225,707 21,252,377 21,252,378 21,321,841 21,391,529 21,453,257 21,455,200 21,459,652 21,491,032 21,491,033 21,528,715 21,536,734 21,536,760 21,536,766 21,536,770 21,536,773 21,536,775 21,536,777 21,536,779 21,536,783 21,544,015 21,584,652 21,584,653 21,612,055 21,624,658 21,646,552 21,715,449 21,715,463 21,716,090 21,732,898 21,748,563 21,752,591 21,760,500 21,760,511 21,798,783 21,808,506 21,845,204 21,880,523 21,381,274 21,881,315 21,881,945 21,888,690 21,888,691 21,910,092 21,910,161 21,910,167 21,910,205 21,910,220 21,910,731 21,924,641 21,930,582 21,944,883 21,960,621 21,971,281 21,998,298 21,998,316 22,023,671 22,044,206 22,066,493 22,138,168 22,138,169 22,141,747 22,184,136 22,234,755 22,237,127 22,237,128 22,238,516 22,256,074 22,323,793 22,336,054 22,342,054 22,342,102 22,342,120 22,342,127 22,342,155 22,342,157 22,342,208 22,342,232 22,342,254 22,342,255 22,342,257 22,342,266 22,342,270 22,439,115 22,450,932 22,479,650 22,481,576 22,495,054 22,572,164 22,596,865 22,603,871 22,635,575 22,693,028 22,693,029 22,708,915 22,718,963 22,743,281 22,743,405 22,795,593 22,804,163 22,874,163 22,898,390 22,988,986 22,988,999 22,989,035 23,019,778 23,034,996 23,054,262 23,079,060 23,132,927 23,132,935 23,132,951 23,132,964 23,132,971 23,132,989 23,133,025 23,133,075 23,133,081 23,133,107 23,133,123 23,133,145 23,133,154 23,133,219 23,175,350 23,182,090 23,194,872 23,223,696 23,234,551 23,234,552 23,234,553 23,236,023 23,236,101 23,236,101 23,237,635 23,237,636 23,237,637 23,265,870 23,265,878 23,265,893 23,265,971 23,266,003 23,266,004 23,267,272 23,267,743 23,268,153 23,268,251 23,268,362 23,268,493 23,268,536 23,268,879 23,268,994 23,269,122 23,269,200 23,269,208 23,269,478 23,269,479 23,269,535 23,293,286 23,293,287 23,293,288 23,297,479 23,317,906 23,339,742 23,371,233 23,414,025 23,422,913 23,422,919 23,422,971 23,423,076 23,423,302 23,423,303 23,423,304 23,423,305 23,423,306 23,423,307 23,423,308 23,423,309 23,423,310 23,423,311 23,423,384 23,423,385 23,462,625 23,509,052 23,615,241 23,615,242 23,615,614 23,615,615 23,615,616 23,616,635 23,617,006 23,617,095 23,617,096 23,617,097 23,617,098 23,617,099 23,617,100 23,617,156 23,617,157 23,617,770 23,618,480 23,618,483 23,618,434 23,618,493 23,618,494 23,618,537 23,618,592 23,618,632 23,618,633 23,618,636 23,618,697 23,618,805 23,618,840 23,618,850 23,618,351 23,618,852 23,618,853 23,618,854 23,618,910 23,613,953 23,619,068 23,619,958 23,621,942 23,621,970 23,622,126 23,622,688 23,622,689 23,623,716 23,623,741 23,623,742 23,639,731 23,644,513 23,664,719 23,665,572 23,665,811 23,667,268 23,667,269 23,668,632 23,670,523 23,670,848 23,671,187 23,673,647 23,673,838 23,675,353 23,675,510 23,675,762 23,676,536 23,677,060 23,678,030 23,678,031 23,678,498 23,678,861 23,679,054 23,679,059 23,679,327 23,631,930 23,634,591 23,684,831 23,684,835 23,687,156 23,688,636 23,689,040 23,690,436 23,692,071 23,695,993 23,699,679 23,701,920 23,702,397 23,704,689 23,704,946 23,705,691 23,711,769 23,712,046 23,712,047 23,714,612 23,714,613 23,714,614 23,714,615 23,714,616 23,719,509 23,719,536 23,725,018 24,180,936 24,181,706 24,181,707 24,181,708 24,181,711 24,131,835 24,131,841 24,181,927 24,182,103 24,182,110 24,182,111 24,182,114 24,182,116 24,182,325 24,132,334 24,132,367 24,183,873 24,183,928 24,184,262 24,184,949 24,185,838 24,188,024 24,188,025 24,190,450 24,192,474 24,192,485 24,196,464 24,196,465 24,198,998 24,319,283 24,333,845 24,833,846 24,833,847 24,833,848 24,833,849 24,833,850 24,833,851 24,833,852 24,833,853 24,833,854 24,833,855 24,333,856 24,833,857 24,833,858 24,833,359 24,833,860 24,833,861 24,833,862 24,833,863 24,833,864 24,333,865 24,833,866 24,833,867 24,833,368 24,833,869 24,833,870 24,833,871 24,833,872 24,833,873 24,833,874 24,833,875 24,833,876 24,333,877 24,833,878 24,833,884 24,834,489 24,834,490 24,834,491 24,834,492 24,834,493 24,834,494 24,834,495 24,334,496 24,834,497 24,834,498 24,834,499 24,836,124 24,838,478 24,838,850 24,838,851 24,338,852 24,340,406 24,847,717 24,847,718 24,884,165 25,021,277 25,021,716 25,022,094 25,022,139 25,059,847 25,147,438 25,201,247 25,202,100 25,215,427 25,258,926 42,616,376 42,626,516 42,626,649 42,626,869 43,834,996 44,134,551 44,134,552 44,135,769 44,135,770 44,135,830 44,135,912 44,144,455 44,146,053 44,146,486 44,146,567 44,146,730 44,146,916 44,147,059 44,148,502 44,150,404 44,150,532 44,150,701 44,150,943 44,151,798 44,152,237 44,152,840 44,154,459 44,154,433 44,154,512 44,154,561 44,154,582 44,154,630 44,154,866 44,154,920 44,321,327 44,369,986 44,370,063 44,558,881 44,558,882 44,593,649 44,603,086 44,630,230 44,720,830 44,721,082 44,721,083 44,725,754 45,048,798 45,048,892 45,050,564 45,051,682 45,266,914 45,479,758 46,224,551 46,224,552 46,224,593 46,875,030 46,936,754 49,789,061 50,396,934 50,910,470 50,920,338 50,921,205 50,921,206 50,930,983 50,931,253 50,931,674 50,932,276 50,933,749 50,989,345 50,989,963 51,000,486 53,339,029 53,384,454 53,393,493 53,393,598| 53,400,626 53,405,325 53,428,512 53,439,260 53,462,054 53,463,799 53,471,871 53,471,920 54,593,359 54,599,412 54,601,637 54,602,507 54,602,768 54,602,830 54,603,132 54,603,241 54,603,485 54,603,489 54,603,573 54,603,865 54,604,418 54,605,078 54,605,477 54,605,894 54,606,603 54,607,273 54,610,700 54,611,643 54,612,078 54,612,079 56,841,614 56,841,734 56,842,095 56,842,269 56,843,347 56,843,418 56,843,823 56,925,092 56,955,921 56,955,922 56,955,923 56,955,924 57,347,038 57,347,038 57,347,159 57,347,436 57,343,041 57,343,043 57,348,098 57,348,555 57,348,941 57,349,419 57,349,472 57,349,580 57,349,581 57,350,047 57,350,047 57,350,641 57,350,785 57,350,803 57,351,175 57,351,442 57,351,614 57,351,668 57,351,752 57,352,657 57,353,494 57,358,064 57,358,206 57,358,236 57,359,122 57,359,123 57,365,615 57,336,366 57,397,090 57,418,239 57,422,000 57,422,093 57,448,801 57,448,802 57,443,399 57,449,070 57,449,169 57,449,394 57,450,418 57,451,424 57,459,958 57,464,763 57,464,821 57,464,908 57,464,921 57,465,286 57,466,691 57,466,703 57,469,302 57,469,420 57,485,235 57,485,401 57,490,558 57,507,417 57,507,848 57,507,876 57,514,279 57,514,722 57,517,132 57,517,138 57,517,933 57,763,375 58,165,711 58,165,712 58,165,713 58,165,714 58,165,715 58,165,716 58,165,717 58,165,718 58,165,720 58,165,721 58,165,723 58,165,724 58,165,726 58,165,727 58,165,730 58,165,731 58,165,733 58,165,734 58,165,735 58,165,736 58,165,737 58,165,738 58,302,438 58,671,705 58,671,705 58,729,368 58,729,369 58,729,370 58,729,371 58,729,372 58,729,373 58,729,374 53,729,375 58,729,377 58,729,379 58,729,380 58,729,381 58,729,382 58,729,383 53,729,384 58,729,387 53,729,388 58,729,389 58,729,390 58,729,391 58,729,392 58,729,393 58,729,394 53,729,397 58,729,398 58,729,399 58,886,963 59,263,990 59,467,531 59,467,532 59,467,533 59,467,534 59,467,536 59,467,537 59,467,538 59,467,539 59,467,540 59,467,542 59,467,543 59,467/545 59,467,546 59,467,549 59,467,550 59,467,552 59,467,553 59,467,554 59,467,556 59,467,557 59,865,558 59,940,674 59,940,675 60,036,552 60,036,553 60,165,464 60,208,620 60,208,624 60,208,652 66,545,852 70,297,382 70,675,072 70,675,073 70,700,060 70,702,302 71,299,673 71,300,916 71,308,157 71,313,437 71,313,488 71,317,296 71,319,306 7I,319,307 71,319,865 71,327,504 71,328,225 71,330,499 71,331,141 71,332,057 7l,334,109 71,335,003 71,335,466 71,335,471 71,336,056 71,337,069 71,338,314 71,339,210 71,339,611 71,339,840 71,340,597 71,342,472 71,348,363 71,348,670 71,354,187 71,357,095 71,359,057 71,360,254 71,361,127 71,361,431 71,363,441 71,363,442 71,363,446 71,363,802 71,364,348 71,364,378 71,365,365 71,366,353 71,367,154 71,367,770 71,367,894 71,367,895 71,368,197 71,368,508 71,370,280 71,371,122 71,371,820 71,372,565 71,372,674 71,380,037 71,380,573 71,381,041 71,381,042 71,382,184 71,332,439 71,382,445 71,385,726 71,385,727 71,387,140 71,387,143 71,387,509 71,394,297 71,394,403 71,394,404 71,397,369 71,398,232 71,399,333 73,401,268 71,401,326 71,401,532 71,401,921 71,405,075 71,408,659 71,409,840 71,410,005 71,410,222 71,410,223 71,421,391 71,430,951 71,430,977 71,431,024 71,431,066 71,436,586 71,437,827 71,444,769 71,444,988 71,446,559 71,446,674 71,449,004 71,459,631 71,479,335 71,487,561 71,586,823 71,586,365 71,586,922 71,710,894 71,774,626 72,941,434 73,415,795 73,427,316 73,427,319 73,427,321 73,555,192 73,555,265 73,556,100 73,894,235 73,894,259 73,894,260 73,894,261 73,894,262 73,894,263 73,894,264 73,894,265 73,894,266 73,894,267 73,894,268 73,894,269 73,894,270 73,894,271 73,894,272 73,894,273 73,394,274 73,894,275 73,894,276 73,894,277 73,894,273 73,897,259 73,951,871 73,994,974 74,764,745 74,765,628 74,765,632 74,765,637 75,124,214 76,198,490 76,419,686 76,957,520 76,958,471 73,063,565 78,064,930 78,066,137 78,067,178 78,067,215 78,067,216 82,030,612 82,030,683 82,316,598 82,316,626 82,316,722 82,318,949 82,363,720 82,363,766 83,768,323 83,773,659 84,226,900 84,228,930 84,228,952 84,229,512 84,229,564 84,230,181 84,230,317 84,230,491 84,230,496 84,230,505 84,232,747 84,251,193 84,271,289 84,271,519 84,271,720 84,273,649 84,293,452 84,313,624 84,317,251 84,317,410 84,317,582 84,317,592 84,317,617 84,317,748 84,317,859 84,317,938 84,318,269 84,318,352 84,318,548 84,318,697 84,319,320 84,319,537 84,313,696 84,319,949 84,320,164 84,320,412 84,320,471 84,321,900 84,321,961 84,322,271 84,322,555 84,322,803 84,323,164 84,323,196 84,323,348 84,323,444 84,331,163 84,331,138 85,671,405 85,677,163 85,683,074 85,764,410 85,844,805 85,858,957 85,901,868 85,970,572 86,171,938 86,181,093 86,278,207 86,341,919 86,341,922 86,618,681 86,618,633 86,618,685 86,743,524 86,743,525 86,745,607 87,058,047 87,059,370 87,072,965 87,073,127 87,073,128 87,073,129 87,073,143 87,073,508 87,036,209 87,036,388 87,090,261 87,106,887 87,110,451 87,131,993 87,131,994 87,131,995 87,131,996 87,131,997 87,132,131 87,132,524 87,132,525 87,132,526 87,144,976 87,165,315 87,172,195 87,172,196 87,195,630 87,205,220 87,205,221 87,205,976 87,233,402 87,233,403 87,234,663 87,234,712 87,238,627 87,238,628 87,238,633 87,240,211 87,251,088 87,255,861 87,255,862 87,255,870 87,255,875 87,255,880 87,255,881 87,269,470 87,263,477 87,314,093 87,318,793 87,330,514 87,344,746 87,350,630 87,359,256 87,438,458 87,433,459 87,433,573 87,438,574 87,438,777 87,438,779 87,458,202 87,458,203 87,458,204 87,458,727 87,472,400 87,472,523 87,472,811 87,472,864 87,473,748 87,474,375 87,474,815 87,475,704 87,476,010 87,476,169 87,476,500 87,476,559 87,476,847 87,477,538 87,477,549 87,478,368 87,491,392 87,491,700 87,492,961 87,499,136 87,501,741 87,505,017 87,510,533 87,514,724 87,514,827 87,562,629 87,603,632 87,606,799 87,606,893 87,606,894 87,606,895 87,640,134 87,656,152 87,657,080 87,657,747 87,662,947 87,671,297 87,671,298 87,671,912 87,699,275 87,699,545 87,711,479 87,721,746 87,735,226 87,733,731 87,733,732 87,739,172 87,743,549 87,755,255 87,756,357 87,756,359 87,762,269 87,763,110 87,764,999 87,765,000 87,770,098 87,770,571 87,805,032 87,805,033 87,841,306 87,341,308 87,852,890 87,934,277 87,935,205 87,945,130 87,957,607 87,979,929 88,005,023 88,006,712 88,027,044 88,027,224 88,027,225 88,027,247 88,027,249 88,027,349 88,027,898 88,028,174 88,028,175 88,028,382 88,047,523 88,048,162 88,048,239 88,048,240 88,048,687 88,048,639 88,048,692 88,048,693 88,085,429 88,085,430 88,035,672 88,035,673 88,085,737 88,085,790 88,085,832 88,086,427 88,086,990 88,090,309 88,103,022 88,112,731 88,112,732 88,113,921 88,162,367 88,162,370 88,163,324 88,171,189 88,195,082 88,195,499 88,199,335 88,202,050 88,223,011 88,234,680 88,237,233 88,247,261 88,247,263 88,282,576 88,282,578 88,288,218 88,312,532 88,314,934 88,314,935 88,327,893 88,328,145 83,339,646 88,339,769 88,339,770 88,342,230 88,360,632 88,367,464 88,357,467 88,370,013 88,371,460 88,371,540 88,383,641 88,384,192 88,402,848 88,404,033 88,414,089 88,421,853 88,421,854 88,423,689 88,423,693 88,423,694 88,423,747 88,424,044 88,424,045 88,424,429 88,440,204 88,440,205 88,446,062 88,453,441 88,454,696 88,458,282 88,463,436 88,470,125 88,470,129 88,473,659 88,473,660 88,481,422 88,488,676 88,510,887 88,602,316 88,610,141 88,610,142 83,611,072 88,613,537 88,613,538 88,613,539 88,633,323 88,633,324 88,636,491 88,640,649 88,641,981 88,641,982 88,642,858 88,642,860 88,670,623 88,680,217 88,680,218 88,681,635 88,681,637 88,683,805 88,688,468 88,709,342 88,714,945 88,717,455 88,728,174 88,728,830 88,736,668 88,788,483 88,740,953 88,741,022 88,741,024 88,745,619 88,746,538 88,756,177 88,762,995 88,763,319 88,786,396 88,791,224 88,807,784 88,807,786 88,827,124 88,828,033 88,836,636 88,347,453 88,848,338 89,423,442 89,573,826 89,972,012 89,977,504 90,021,411 90,028,968 90,471,423 90,472,865 90,472,953 90,472,954 90,476,144 90,476,459 90,478,957 90,479,639 90,657,387 90,657,388 90,661,369 90,661,495 91,617,718 91,618,135 91,809,010 91,809,010 91,372,575 91,872,576 91,873,289 91,885,296 91,886,247 91,836,305 91,836,306 91,386,379 91,977,524 91,977,525 91,979,699 91,979,700 91,979,701 91,979,702 91,982,311 91,990,907 91,990,908 91,996,625 91,997,872 91,997,873 91,998,119 91,998,120 91,998,157 91,998,324 92,003,746 92,003,947 92,004,943 92,006,598 92,006, 92,006,915 92,006,992 92,006,993 92,006,994 92,006,995 92,006,996 92,006,997 92,006,998 92,006,999 92,007,000 92,007,001 92,007,002 92,007,003 92,007,004 92,007,005 92,007,006 92,007,007 92,007,008 92,007,091 92,007,010 92,007,011 92,007,017 92,007,451 92,008,067 92,008,243 92,008,621 92,009,736 92,010,994 92,010,995 92,010,996 92,010,997 92,013,326 92,022,904 92,024,946 92,024,947 92,025,093 92,025,094 92.025,095 92,025,096 92,025,097 92,025,098 92,025,099 92,025,100 92,025,114 92,025,115 92,025,116 92,025,117 92,025,118 92,025,119 92,025,120 92,025,121 92,025,124 92,026,484 92,026,485 92,026,502 92,026,503 92,026,560 92,026,596 92,026,616 92,027,384 92,027,405 92,027,424 92,027,436 92,028,137 92,028,138 92,028,742 92,028,792 92,028,793 92,028,841 92,028,912 92,038,599 92,042,585 92,043,501 92,043,987 92,131,721 92,135,763 100,919,003 100,931,586 100,934,184 100,952,630 100,963,338 100,963,929 100,986,762 100,986,764 100,993,010 100,999,029 101,005,691 101,006,949 101,009,191 101,009,416 101,015,656 101,025,050 101,025,051 101,046,544 101,052,365 101,053,279 101,053,279 101,053,279 101,053,280 101,064,349 101,071,247 101,093,527 101,100,195 101,100,195 101,116,060 101,118,643 101,118,644 101,122,537 101,127,381 101,136,872 101,137,899 101,139,985 101,139,936 101,200,916 101,211,580 101,230,437 101,230,438 101,230,439 101,243,708 101,255,615 101,257,613 101,261,664 101,288,890 101,298,727 101,313,322 101,340,809 101,348,281 101,354,488 101,354,489 101,357,168 101,357,169 101,357,594 101,357,595 101,377,149 101,397,671 101,409,658 101,415,375 101,415,376 101,440,809 101,458,324 101,458,325 101,458,327 101,478,419 101,495,974 101,504,033 101,522,049 101,533,057 101,564,671 101,586,483 101,599,593 101,599,594 101,611,448 101,614,891 101,616,131 101,625,879 101,625,830 101,625,331 101,625,332 101,635,676 101,652,314 101,652,556 101,652,557 101,652,558 101,652,559 101,664,275 101,664,531 101,664,931 101,667,977 101,674,978 101,674,979 101,674,980 101,674,981 101,674,982 101,674,983 101,686,450 101,689,360 101,691,534 101,691,535 101,691,536 101,691,537 101,691,538 101,691,539 101,691,632 101,691,633 101,691,634 101,691,635 101,691,636 101,691,637 101,699,244 101,708,462 101,708,463 101,715,578 101,716,440 101,723,246 101,786,483 101,786,862 101,786,863 101,805,070 101,846,346 101,847,764 101,883,650 101,889,836 101,889,839 101,895,131 101,895,132 101,913,583 101,916,334 101,928,003 101,929,420 101,930,742 101,946,400 101,970,427 101,972,020 101,978,331 101,978,342 101,978,385 101,988,596 101,993,105 101,996,063 102,012,028 102,013,216 102,013,636 102,039,635 102,054,416 102,072,502 102,075,650 102,129,552 102,137,137 102,160,647 102,171,729 102,215,006 102,239,767 102,248,352 102,261,461 102,279,703 102,279,704 102,279,705 102,279,706 102,279,707 102,279,708 102,279,709 102,283,040 102,283,045 102,283,046 102,326,471 102,393,511 102,409,673 102,413,161 102,416,167 102,438,080 102,439,215 102,533,224 102,595,004 102,595,005 102,601,898 110,210,780 110,210,731 110,431,250 110,499,257 110,499,461 110,499,630 110,499,730 110,499,847 110,500,056 110,500,265 110,500,474 110,500,682 110,500,891 110,501,100 110,501,309 110,501,518 110,501,727 110,501,936 110,502,145 110,502,354 112,501,307 112,501,308 112,501,309 112,501,310 112,501,311 112,501,312 112,501,313 112,501,314 112,501,315 112,501,316 112,501,317 112,501,318 112,501,319 112,501,320 112,501,321 112,501,322 112,501,323 112,501,324 112,501,325 112,501,326 112,501,327 112,501,328 112,501,329 112,501,330 112,501,331 112,501,332 112,501,333 112,501,334 112,501,335 112,501,336 112,501,337 112,501,338 112,501,339 117,059,131 118,984,370 118,985,489 118,985,493 121,233,249 121,233,660 121,233,703 122,201,230 122,228,415 122,363,780 122,363,783 122,403,017 123,394,049 124,204,125 129,318,123 129,318,137 129,627,693 129,629,450 129,629,459 129,629,462 129,629,468 129,629,516 129,629,522 129,629,530 129,630,137 129,631,095 129,632,050 129,632,463 129,632,826 129,633,897 129,636,342 129,636,343 129,636,310 129,636,925 129,641,160 129,648,732 129,652,278 129,653,851 129,656,420 129,656,532 129,657,293 129,657,294 129,657,295 129,657,300 129,657,304 129,657,312 129,657,315 129,657,324 129,657,326 129,657,327 129,657,329 129,657,337 129,657,353 129,664,230 129,664,232 129,664,293 129,666,399 129,667,149 129,667,246 129,667,772 129,668,316 129,669,884 129,672,174 129,672,290 129,672,646 129,673,523 129,673,557 129,674,090 129,675,341 129,676,928 129,677,374 129,677,629 129,677,673 129,677,709 129,678,442 129,680,161 129,680,629 129,686,725 129,687,036 129,687,164 129,687,794 129,689,537 129,690,605 129,690,606 129,693,550 129,693,600 129,695,429 129,699,101 129,699,962 129,703,922 129,704,872 129,704,873 129,704,991 129,705,030 129,710,768 129,712,713 129,712,356 129,713,733 129,713,737 129,713,738 129,713,739 129,717,266 129,718,758 129,719,237 129,719,562 129,719,300 129,719,820 129,720,038 129,722,574 129,722,775 129,722,776 129,723,383 129,723,491 129,723,494 129,723,497 129,729,158 129,731,038 129,733,738 129,735,433 129,735,730 129,736,660 129,738,079 129,761,662 129,773,034 129,774,159 129,777,886 129,778,385 129,779,295 129,779,321 129,798,633 129,803,712 129,804,869 129,805,741 129,311,014 129,812,676 129,812,778 129,812,969 129,813,068 129,821,519 129,827,070 129,830,120 129,831,773 129,831,774 129,834,223 129,837,610 129,837,611 129,841,661 129,841,839 129,841,933 129,844,962 129,846,552 129,847,296 129,847,546 129,849,055 129,849,662 129,850,135 129,850,275 129,857,182 129,864,519 129,885,100 129,838,841 129,889,451 129,891,425 129,893,859 130,476,815 131,664,348 131,667,318 131,693,710 131,704,736 131,706,375 131,707,539 131,726,110 131,726,111 131,734,265 131,842,801 131,853,020 131,853,184 131,854,974 131,855,532 131,856,051 131,856,316 131,858,650 131,859,300 131,861,196 131,861,243 131,861,284 131,861,319 131,861,545 131,861,741 131,861,783 131,861,797 131,861,793 131,861,829 131,861,848 131,861,849 131,861,850 131,861,864 131,861,914 131,862,031 131,862,032 131,862,422 131,862,475 131,862,482 131,862,601 131,862,602 131,864,343 131,864,629 131,364,631 131,872,529 131,872,582 131,872,533 131,872,534 131,372,599 131,872,605 131,872,607 131,872,608 131,872,641 131,873,917 131,874,100 131,874,290 l31,874,697 131,876,571 l31,876,623 131,876,656 131,877,220 131,877,514 131,877,809 131,878,335 131,878,542 131,878,865 131,879,236 131,880,496 131,880,551 131,880,593 131,880,687 131,880,733 131,880,759 131,880,794 131,880,804 131,881,065 131,881,441 131,381,809 131,881,834 131,381,910 131,882,628 131,882,923 131,884,410 131,885,054 131,885,076 131,885,077 131,885,482 131,887,556 131,837,990 131,888,557

    TABLE-US-00004 TABLE 3 1.24 558 three-valence bismuth (Bi) containing compounds were predicted to efficiently bind PANDA Pocket and efficiently rescue Structural mp53. All of the 94.2 million structures recorded in PubChem (https://pubchem.ncbi.nlm.nih.gov/) were applied for 4C+ screening. In the 4C+ screening, we collected those with more than 2 cysteine-binding potential. Carbon-binding As/Sb/Bi bond has defect in binding cysteine since this bond cannot be hydrolyzed. The other As/Sb/Bi bond can be hydrolyzed in cells and thus is able to bind cysteine. Bi 3 Valence PANDA Agents CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. 6,879 9,010 9,242 14,776 24,591 29,573 82,232 82,233 111,041 111,042 273,108 409,574 438,310 554,966 560,564 3,264,969 3,310,373 3,353,258 3,693,500 3,826,913 3,335,619 5,219,607 5,351,543 6,097,053 6,101,599 6,327,012 6,327,096 6,327,902 6,328,044 6,328,058 6,328,061 6,328,064 6,328,110 6,328,152 6,328,166 6,328,191 6,328,192 6,328,644 6,328,667 6,328,676 6,328,741 6,329,119 6,329,123 6,330,910 6,330,912 6,331,875 6,332,255 6,334,573 6,335,194 6,335,198 6,335,206 6,335,254 6,335,359 6,335,607 6,336,257 6,338,042 6,365,054 6,365,215 6,365,241 6,367,060 6,367,061 6,367,062 6,367,063 6,367,235 6,368,739 6,369,167 6,374,651 6,378,840 6,379,155 6,379,269 6,379,609 6,381,732 6,386,980 6,391,530 6,397,242 6,711,587 6,832,148 6,914,522 6,914,523 6,914,524 6,914,525 9,804,891 9,810,547 9,942,004 9,987,441 10,053,092 10,054,529 10,246,425 10,327,332 10,391,773 10,717,929 10,832,460 11,049,781 11,069,084 11,073,147 11,146,955 11,284,230 11,366,706 11,411,567 11,528,063 11,643,620 11,686,583 11,765,348 11,786,056 11,979,775 12,147,504 12,622,640 13,751,291 13,766,272 13,775,335 13,775,336 13,828,286 13,908,690 14,044,341 14,044,344 14,085,833 14,619,600 14,849,493 15,240,258 15,240,263 15,328,170 15,770,557 15,770,559 15,817,730 16,132,801 16,132,845 16,132,857 16,132,866 16,132,889 16,133,169 16,212,591 16,212,592 16,682,734 16,682,825 16,682,928 16,682,937 16,682,955 16,682,959 16,682,960 16,682,976 16,682,977 16,682,999 16,683,015 16,683,017 16,683,095 16,683,098 16,683,103 16,683,121 16,683,563 16,683,564 16,683,565 16,683,566 16,683,596 16,683,686 16,683,874 16,683,875 16,683,958 16,683,961 16,683,963 16,684,025 16,684,114 16,684,115 16,684,274 16,684,350 16,684,468 16,684,575 16,684,578 16,684,580 16,684,582 16,684,785 16,684,795 16,684,898 16,685,021 16,685,033 16,685,173 16,685,257 16,685,276 16,685,277 16,685,391 16,685,632 16,685,998 16,686,097 16,686,099 16,686,175 16,686,256 16,686,258 16,686,506 16,687,246 16,687,501 16,688,082 16,688,103 16,688,295 16,688,699 16,688,996 16,689,505 16,689,550 16,689,947 16,693,013 16,693,015 16,695,048 16,695,049 16,696,198 16,697,869 16,697,870 16,697,871 16,697,873 16,699,463 16,700,590 16,700,595 16,700,901 16,701,354 16,701,355 16,702.113 16,702,492 16,702,987 16,703,065 16,704,191 16,704,973 16,704,976 16,704,977 16,704,984 16,704,997 16,705,083 16,705,860 16,707,734 16,711,827 16,712,566 16,716,635 16,717,608 16,717,608 16,717,622 16,721,198 18,502,954 18,503,058 18,503,101 18,503,123 13,503,172 18,503,263 18,503,264 18,503,288 18,503,517 18,503,857 18,690,641 18,690,642 21,932,960 21,932,966 21,932,967 21,932,971 21,932,934 21,932,998 21,933,008 21,933,012 21,933,025 21,933,028 21,933,044 21,933,048 21,933,092 21,933,118 21,933,120 21,933,124 21,933,126 21,933,129 21,933,167 21,933,168 21,933,169 21,933,179 21,933,244 21,933,252 21,933,277 21,933,284 21,933,317 21,933,328 21,933,329 21,933,331 21,933,335 21,933,358 21,933,362 21,933,365 21,933,367 21,933,368 22,834,097 22,834,234 22,834,266 22,834,406 22,834,407 22,929,628 23,230,204 23,576,945 24,182,960 24,184,948 24,771,807 24,884,204 24,884,205 25,021,316 42,619,967 44,135,860 44,135,899 44,146,529 44,152,487 45,052,077 46,245,067 50,912,221 50,920,714 50,920,757 50,931,875 53,393,588 53,427,529 54,605,444 54,742,562 56,841,599 56,842,096 56,842,896 56,845,529 56,845,924 56,846,073 56,846,074 56,846,075 56,846,076 57,347,031 57,357,928 57,404,116 57,488,589 57,562,349 58,330,672 59,499,197 59,720,413 59,720,414 70,294,115 71,300,497 71,309,993 71,310,157 71,310,700 71,311,500 71,380,213 71,380,459 71,386,040 71,391,524 71,400,325 73,557,522 73,894,347 73,894,349 73,894,350 73,995,040 73,995,041 76,959,357 85,470,850 85,470,850 85,470,851 85,624,350 85,750,126 87,126,125 87,207,683 87,207,773 87,207,774 87,238,523 87,452,858 87,479,654 87,489,025 87,489,305 87,489,320 87,489,335 87,489,593 87,489,619 87,489,650 87,489,777 87,490,196 87,490,221 87,490,477 87,490,638 87,490,646 87,490,651 87,490,697 87,490,956 87,490,958 87,491,355 87,491,335 87,491,423 87,513,516 87,513,517 87,580,507 87,686,514 87,686,718 87,687,197 87,687,712 87,693,276 87,730,138 87,730,829 87,737,505 87,745,214 87,871,946 87,871,947 87,912,467 87,912,468 87,960,355 88,029,006 88,029,007 88,193,567 88,194,406 88,194,416 88,194,477 88,194,479 88,194,481 38,194,539 88,194,861 88,194,864 88,194,865 88,194,870 88,292,939 88,292,940 88,520,030 88,640,276 88,640,277 88,802,217 88,802,218 88,817,848 88,836,364 90,471,463 90,471,464 90,473,777 90,473,778 90,475,361 91,659,154 91,886,165 91,886,166 91,886,248 91,886,395 91,886,591 92,003,295 92,024,600 92,025,641 92,025,642 92,025,643 92,025,667 92,025,668 92,025,669 92,025,670 92,025,671 92,025,673 92,025,675 92,025,675 92,026,749 92,026,962 102,602,549 102,602,549 117,065,228 117,071,502 118,855,609 118,855,610 118,985,207 121,233,070 121,233,129 121,233,209 121,233,210 121,233,689 121,233,709 121,233,710 121,513,973 122,173,805 122,173,806 129,627,851 129,627,851 129,627,852 129,627,852 l29,628,345 129,628,507 l29,630,444 129,631,009 129,631,020 129,631,047 129,632,182 129,632,246 129,632,626 129,632,968 129,634,022 129,636,151 129,636,165 129,636,935 129,636,953 129,637,329 129,643,765 129,643,766 129,644,127 129,651,463 129,651,702 129,651,972 129,660,613 129,661,690 129,661,691 129,661,692 129,662,722 129,665,855 129,670,802 129,671,601 129,672,684 129,676,730 129,692,302 129,693,004 129,693,466 129,696,491 129,713,086 129,713,109 129,713,799 129,719,991 129,722,002 129,734,931 129,738,069 129,738,070 129,738,237 129,759,637 129,759,633 129,760,053 129,760,197 129,760,222 129,760,768 129,761,066 129,761,789 129,761,805 129,761,822 129,768,269 129,769,201 129,772,739 129,772,785 129,772,858 129,773,065 129,793,750 129,796,408 l29,736,934 129,802,846 129,802,847 129,817,421 129,819,068 129,322,257 129,822,258 129,831,438 129,842,132 129,842,163 129,842,182 129,842,230 129,842,243 129,842,265 129,842,280 129,843,462 129,843,543 129,843,683 129,851,323 129,851,730 129,8352,640 129,856,536 129,856,531 l29,865,810 129,880,632 129,880,679 129,887,215 129,890,639 129,891,194 129,891,993 131,864,282 131,875,075

    TABLE-US-00005 Table 4 1.25 125 five-valence bismuth (Bi) structures were predicted to efficiently bind PANDA Pocket and efficiently rescue Structural mp53. All of the 94.2 million structures recorded in PubChem (https://pubchem.ncbi.nlm.nih.gov/) were applied for 4C+ screening. In the 4C+ screening, we collected those with more than 2 cysteine-binding potential. Carbon-binding As/Sb/Bi bond has defect in binding cysteine since this bond cannot be hydrolyzed. The other As/Sb/Bi bond can be hydrolyzed in cells and thus is able to bind cysteine. Bi 5 Valence PANDA Agents CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. 82,993 123,260 366,096 366,097 366,098 366,099 367,796 434,309 438,389 2,734,035 3,301,555 3,336,805 3,538,901 3,653,008 3,687,219 3,783,338 3,914,869 3,992,551 4,063,671 4,271,061 4,441,160 5,254,690 5,256,620 5,257,028 5,257,050 5,257,056 5,257,058 5,257,059 5,257,062 5,257,063 6,327,785 6,334,091 6,372,954 6,373,400 6,377,431 6,386,952 6,392,480 6,392,684 6,392,717 6,392,777 6,394,267 6,394,856 6,394,889 6,395,066 6,395,342 6,395,344 6,395,345 6,395,477 6,396,057 6,356,714 6,397,027 6,397,420 6,397,557 6,711,667 6,711,688 6,711,693 6,850,036 6,850,087 6,850,113 10,907,992 11,188,826, 11,966,239 11,968,204 11,980,596 11,980,909 11,985,775 11,985,985 14,420,964 16,132,606 16,132,606 16,132,662 16,132,822 16,132,858 16,132,869 16,132,960 16,332,965 16,333,022 16,133,325 16,133,326 16,682,751 16,684,917 16,685,090 16,685,106 16,685,289 16,685,303 16,685,390 16,685,453 16,685,454 16,685,455 16,685,456 16,685,573 16,685,574 16,685,631 16,685,637 16,715,250 18,503,128 18,503,206 19,032,053 21,554,417 21,554,418 21,944,623 23,304,890 23,304,944 23,350,967 23,350,968 23,633,148 23,639,873 123,681,527 23,693,098 50,920,763 53,249,975 58,280.986 71,357,908 71,401,130 87,744,887 87,745,037 87,745,510 88,228,697 88,515,761 88,797,100 891,886,318 124,202,748 129,830,992 131,864,281 131,868,916

    TABLE-US-00006 TABLE 5 1.26 937 three-valence antimony (Sb) structures were predicted to efficiently bind PANDA Pocket and efficiently rescue Structural mp53. All of the 94.2 million structures recorded in PubChem (https://pubchem.ncbi.nlm.nih.gov/) were applied for 4C+ screening. In the 4C+ screening, we collected those with more than 2 cysteine-binding potential. Carbon-binding As/Sb/Bi bond has defect in binding cysteine since this bond cannot be hydrolyzed. The other As/Sb/Bi bond can be hydrolyzed in cells and thus is able to bind cysteine. Sb 3 Valence PANDA Agents CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. 9,3839 18,293 24,554 24,615 24,630 24,814 27,652 46,678 61,553 72,062 82,258 83,733 85,159 85,168 91,307 92,908 110,797 110,822 112,343 112,417 116,971 117,333 117,654 120,130 122,445 139,227 172,734 201,832 223,838 231,056 273,193 278,175 292,777 432,482 443,987 2,724,507 3,022,556 3,468,413 3,500,394 3,980,171 4,003,909 4,169,194 4,227,891 4,310,207 4,426,282 4,868,265 5,099,079 5,205,981 5,460,498 5,460,499 5,475,465 6,100,615 6,100,855 6,102.344 6,327,063 6,327,128 6,327,518 6,327,644 6,327,672 6,327,776 6,327,782 6,327,783 6,327,784 6,327,790 6,327,791 6,327,792 6,327,901 6,328,047 6,328,136 6,328,158 6,328,167 6,328,183 6,328,247 6,328,381 6,328,497 6,328,498 6,328,604 6,328,723 6,328,731 6,329,083 6,329,280 6,329.469 6,330,102 6,331.892 6,331,893 6,331,894 6,332,059 6,333,990 6,334,205 6,334,206 6,335,210 6,335,446 6,335,642 6,335,799 6,335,965 6,335,967 6,335,971 6,336,248 6,336,250 6,336,268 6,336,294 6,336,294 6,336,295 6,336,297 6,336,298 6,336,309 6,336,310 6,336,314 6,366,315 6,336,966 6,337,127 6,337,192 6,338,235 6,338,236 6,338,237 6,338,238 6,338,239 6,338,275 6,338,396 6,338,574 6,366,253 6,367,067 6,367,121 6,367,122 6,367,123 6,367,297 6,367,299 6,369,653 6,371,267 6,372,250 6,372,531 6,373,293 6,378,487 6,378,591 6,379,063 6,380,952 6,383,190 6,383,685 6,383,702 6,386,140 6,389,340 6,391,662 6,391,766 6,392,060 6,393,025 6,394,845 6,394,846 6,394,847 6,394,849 6,395,364 6,395,540 6,395,541 6,395,542 6,395,614 6,395,616 6,397,381 6,398,008 6,398,524 6,398,617 6,398,618 6,416,685 6,437,746 6,450,406 6,450,407 6,451,277 6,452,001 6,857,635 6,914,521 6,914,522 6,914,523 6,914,524 6,914,526. 6,914,527 9,986,376 9,988,372 10,078,981 10,440,350 10,508,768 10,604,595 10,652,047 10,723,372 10,818,460 10,876,667 10,887,720 10,939,671 10,953,054 11,005,047 11,018,607 11,028,580 11,038,092 11,039.089 11,088,054 11,091,142 11,181,852 11,193,223 11,215,665 11,216,896 11,400,464 11,416,121 11,479,469 11,489,983 11,542,349 11,600,329 11,643.503 11,801,623 11,824,030 11,954,289 11,968,245 11,969,034 11,979,399 12,545,033 13,100,649 13,165,617 13,706,358 14,085,828 14,085,832 14,766,829 14,923,299 15,165,103 15,246,215 15,274,122 15,630,343 15,773,247 15,779,436 15,815,188 16,132,617 16,132,626 16,132,842 16,132,972 16,682,736 16,682,737 16,682,742 16,682,744 16,682,747 16,682,749 16,682,752 16,682,753 16,682,754 16,682,822 16,682,940 16,682,941 16,682,985 16,682,986 16,682,996 16,683,002 16,683,008 16,683,009 16,683,047 16,683,067 16,683,068 16,683,082 16,683,091 16,683,110 16,683,184 16,683,603 16,683,605 16,683,607 16,683,654 16,683,656 16,683,857 16,683,859 16,683,966 16,683,967 16,684,084 16,684,126 16,684,127 16,684,162 16,684,169 16,684,206 16,684,210 16,684,264 16,684,266 16,684,267 16,684,268 16,684,270 16,684,295 16,684,303 16,684,309 16,684,377 16,684,378 16,684,379 16,684,380 16,684,381 16,684,383 16,684,474 16,684,490 16,684,491 16,684,542 16,684,587 16,684,616 16,684,617 16,684,618 16,684,619 16,684,620 16,684,622 16,684,713 16,684,714 16,684,728 16,684,732 16,684,860 16,684,861 16,684,878 16,684,889 16,685,013 16,685,014 16,685,015 16,685,080 16,685,138 16,685,151 16,684,153 16,685,185 16,685,197 16,685,221 16,685,265 16,685,272 16.685,273 16,685,311 16,685,415 16,685,416 16,685,417 16,685,418 16,685,479 16,685,481 16,685,497 16,685,764 16,686,007 16,686,173 16,686,176 16,686,177 16,686,294 16,686,575 16,686,576 16,687,650 16,687,895 16,688,146 16,683,454 16,688,473 16,688,527 16,688,544 16,688,545 16,688,698 16,688,732 16,688,935 16,688,973 16,688,974 16,688,975 16,689,006 16,689,163 16,689,752 16,691,582, 16,693,615 16,693,637 16,693,639 16,693,641 16,694.223 16,695,174 16,695,175 16,695,950 16,695,951 16,695,952 16,697,056 16,697,515 16,700,667 16,700,668 16,700,670 16,700,811 16,700,812 16,700,896 16,701,020 16,703,714 16,705,235 16,706,597 16,708,103 16,70S,935 16,709,013 16,709,919 16,711,745 16,712,315 16,713,256 16,716,705 16,738,697 16,760,657 17,749,634 17,757,230 17,757,257 17,896,354 17,907,305 18,347,240 18,502,908 13,502,961 18,502,962 18,503,115 18,503,122 IS,503,252 18,503,253 18,503,254 18,503,313 18,503,565 18,503,729 18,503,753 18,690,650 18,690,654 IS,690,656 13,690,658 19,097,033 19,097,037 19,821,447 19,933,062 20,111,700 20,185,678 20,249,102 20,249,105 20,249,108 20,249,113 20,249,115 20,300,474 20,313,258 20,315,019 20,363,281 20,435,550 20,650,165 20,650,168 20,650,130 20,836,036 20,838,936 20,840,786 20,840,787 20,841,413 20,841,414 21,127,957 21,127,960 21,162,914 21,162,915 21,162,916 21,179,954 21,280,137 21,387,935 21,429,702 21,431,092 21,597,739 21,597,740 21,597,742 21,597,743 21,597,747 21,853,875 21,853,876 21,853,877 21,853,378 21,853,880 21,853,882 21,853,384 21,924,199 21,946,953 21,976,042 22,134,008 22,476,815 22,483,778 22,755,405 22,755,406 22,755,407 22,755,408 22,755,409 22,755,410 22,834,430 23,089,770 23,232,432 23,262,264 23,262,275 23,262,289 23,262,291 23,262,328 23,262,329 23,271,407 23,271,424 23,271,440 23,271,479 23,412,698 23,412,699 23,412,700 23,412,701 23,412,702 23,412,703 23,412,704 23,412,705 23,412,706 23,412,707 23,412,708 23,412,709 23,412,710 23,412,711 23,412,744 23,412,745 23,412,746 23,412,747 23,424,127 23,452,096 23,617,918 23,665,405 23,667,272 23,675,780 23,681,183 23,686,990 23,690,288 23,707,960 23,714,520 24,182,330 24,182,331 24,199,786 24,201,065 24,837,728 24,847,360 24,867,558 24,884,257 25,021,693 25,200,065 44,119,133 44,135,767 44,135,895 44,145,400 44,145,839 44,150,046 44,153,415 45,479,364 45,479,524 45,479,539 50,896,902 50,909,120 50,918,374 50,921,100 50,930,621 50,933,843 50,935,021 53,315,432 53,471,862 53,494,194 54,603,506 54,604,975 54,605,443 54,611,195 54,688,499 54,703,985 54,703,986 54,703,987 54,724,826 54,742,027 54,750,834 56,845,640 56,927,675 57,347,421 57,348,872 57,350,497 57,352,871 57,357,960 57,370,241 57,371,215 57,490,232 57,645,580 57,704,204 57,704,207 57,731,111 57,731,115 57,731,116 57,731,118 57,731,120 57,731,121 57,731,122 57,789,471 57,789,472 57,953,647 58,253,024 58,253,026 58,253,027 58,253,029 58,253,030 58,253,031 58,253,032 58,271,553 58,271,555 58,271,564 58,271,575 58,271,579 58,271,583 58,280,987 58,280,983 58,280,990 58,288,679 58,609,137 58,720,422 59,032,477 53,086,320 59,159,833 59,159,383 59,499,187 59,499,195 59,499,196 59,499,199 59,499,204 59,557,632 59,571,971 59,571,972 59,891,573 59,891,601 59,891,603 59,891,640 71,301,022 71,301,023 71,301,024 71,333,883 71,342,634 71,345,945 71,345,945 71,345,946 71,359,975 71,361,093 71,363,456 71,367,105 71,374,340 71,380,591 71,429,674 71,441,094 71,442,382 72,720,464 72,720,4681 73,307,702 73,307,769 73,307,770 73,307,825 73,307,873 73,555,373 73,555,376 73,555,379 73,555,501 73,555,893 73,557,535 73,759,938 73,894,305 73,894,308 73, 894,311 73,394,312 73,894,313 73,394,314 73,894,315 73,894,323 73,952,085 73,995,019 73,995,020 74,040,665 74,765,653 74,933,683 74,935,384 76,037,526 76,960,497 85,551,321 85,609,459 85,618,045 85,750,126 85,750,126 35,863,651 85,863,652 85,907,651 85,976,002 86,101,760 86,101,767 86,101,784 86,246,892 87,138,989 87,186,483 87,202,814 |87,258,578 87,261,615 87,261,620 87,261,624 87,261,630 87,261,631 87,261,715 87,261,713 87,261,720 87,261,724 87,261,726 87,261,729 87,261,732 87,261,737 87,261,749 87,261,752 87,315,219 87,315,760 87,362,495 87,373,499 87,411,324 87,438,483 87,438,929 87,450,539 87,460,730 87,635,564 87,702,251 87,719,536 87,719,533 87,835,653 87,857,783 88,154,076 88,176,411 88,176,414 88,261,066 88,261,223 88,264,017 88,264,710 88,265,017 88,265,019 88,423,296 88,430,055 88,466,104 88,473,381 88,484,275 88,484,276 88,526,235 88,526,236 88,526,238 88,526,252 88,526,253 88,613,920 88,613,921 88,642,592 88,654,956 88,654,957 88,745,663 88,772,726 88,773,222 88,773,337 88,774,019 88,774,061 88,777,596 88,778,787 88,793,603 88,793,935 88,795,315 88,795,398 88,800,757 88,801,147 88,801,216 88,806,743 88,806,751 88,820,185 88,824,737 90,105,233 90,105,284 90,471,546 90 473,139 90,659,538 90,659,541 90,659,637 91,666,614 91,667,987 91,668,102 91,867,127 91,868,149 91,886,487 91,980,813 91,980,814 91,996,065 91,997,283 91,997,284 91,997,363 91,997,683 92,004,432 92,012,267 92,012,268 92,023,437 92,024,179 92,024,528 92,024,529 92,024,531 92,024,534 92,024,536 92,024,556 92,024,935 92,024,944 92,024,955 92,024,957 92,024,958 92,024,961 92,024,968 92,024,970 92,024,971 92,024,972 92,024,973 92,024,976 92,024,977 92,024,980 92,024,981 92,024,982 92,024,985 92,024,986 92,024,987 92,024,983 92,024,990 92,024,991 92,024,997 92,025,001 92,025,002 32,025,003 92,025,020 92,025,024 92,025,025 92,025,026 92,025,027 92,025,028 92,025,031 92,025,050 92,025,051 92,025,052 92,025,053 92,025,054 92,025,055 92,025,056 92,025,057 92,025,058 92,025,059 92,025,063 92,025,064 92,025,065 92,025,066 92,025,067 92,025,069 92,025,077 92,025,079 92,025,082 92,025,083 92,025,084 92,025,035 92,025,086 92,025,087 92,025,089 92,028,426 92,028,427 92,028,428 92,028,429 92,028,430 92,028,791 92,028,940 92,043,602 92,043,603 102,602,109 117,065,228 121,233,627 121,233,623 121,596,016 123,132,499 129,628,368 129,628,369 129,623,470 129,630,336 129,631,714 129,634,074 129,634,980 129,635,876 129,635,919 129,636,319 129,636,320 129,636,621 129,636,622 129,636,709 129,639,940 129,646,351 129,649,988 129,664,755 129,668,929 129,671,029 129,671,731 129,671,732 129,672,175 129,672,177 129,672,415 129,572,416 129,675,055 129,676,925 129,677,475 129,630,159 129,630,177 129,680,187 129,691,639 129,691,640 129,697,639 129,703,076 129,709,779 129,718,867 129,719,189 129,721,729 129,723,651 129,731,772 129,731,773 129,760,451 129,765,173 129,765,222 129,771,692 129,773,098 129,776,810 129,781,425 129,783,529 129,783,530 129,794,056 129,798,979 129,802,873 129,807,640 129,809,238 129,812,117 129,814,318 129,814,352 129,314,419 129,817,665 129,317,666 129,821,032 129,821,963 129,831,304 129,842,135 129,842,264 129,843,508 129,343,687 129,848,944 129,352,227 129,856,127 129,856,231 129,864,503 129,865,814 129,379,550 129,879,554 129,886,985 129,888,228 129,893,705 129,893,706 130,476,776 131,706,152 131,707,327 131,852,287 131,880,394 131,832,596 131,882,949 131,835,062

    TABLE-US-00007 TABLE 6 1.27 1896 five-valence antimony (Sb) structures were predicted to efficiently bind PANDA Pocket and efficiently rescue Structural mp53. An of the 94.2 million structures recorded in PubChem (https://pubchem.ncbi.nlm.nih.govi)were applied for 4C+ screening. In the 4C+ screening, we collected those with more than 2 cysteine-binding potential. Carbon-binding As/Sb/Bi bond has defect in binding cysteine since this bond cannot be hydrolyzed. The other As/SbilBi bond can be hydrolyzed in cells and thus is able to bind cysteine.PD SB 5 Valence PANDA Agents CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. CID No. 11,135 14,813 24,294 24,557 25,463 25,470 28,362 50,592 61,636 64,953 74,002 93,820 95,060 116,495 150,258 157,275 182,263 224,879 324,882 224,884 224,885 224,886 224,889 224,895 224,898 224,899 224,900 224,905 224,909 224,910 224,913 224,915 224,919 224,926 224,930 224,931 225,717 225,790 225,792 225,794 225,795 225,796 225,805 226,567 227,253 240,550 271,854 279,133 279,142 279,144 279,147 284,456 299,579 326,416 408,518 408,544 408,739 408,759 411,587 420,950 420,951 420,952 420,953 420,954 420,955 428,747 432,515 436,771 456,326 2,751,968 2,777,253 3,032,643 3,081,396 3,246,048 3,695,004 3,868,826 3,891,403 3,959,835 4,349,542 4,591,706 5,027,238 5,231,914 5,246,643 5,311,441 5,351,653 5,354,627 5,362,453 5,463,897 5,464,034 5,464,322 5,464,511 5,771,529 6,093,409 6,326,778 6,327,011 6,328,579 6,328,716 6,328,740 6,331,889 6,331,890 6,331,891 6,331,835 6,331,896 6,331,897 6,331,398 6,331,899 6,331,900 6,331,902 6,331,903 6,331,905 6,332,020 6,333,908 6,333,910 6,335,289 6,338,392 6,367,296 6,367,298 6,368,256 6,373,292 6,374,203 6,377,210 6,377,218 6,383,299 6,333,671 6,336,841 6,387,196 6,390,184 6,390,186 6,392,009 6,392,668 6,393,991 6,394,511 6,394,680 6,394,681 6,395,057 6,395,059 6,395,115 6,396,413 6,396,421 6,396,442 6,396,719 5,396,810 6,397,382 6,397,391 6,397,717 6,393,204 6,857,634 6,857,636 9,810,717 9,885,438 9,915,631 10,090,090 10,090,091 10,259,654 10,939,670 10,960,282 10,960,305 11,005,470 11,118,066 11,297,036 11,318,239 11,730,658 11,765,685 11,768,112 11,807,053 11,966,274 11,966,275 11,980,764 11,985,984 12,591,815 12,725,709 13,047,299 13,467,894 13,678,820 13,678,826 13,751,471 13,783,183 13,788,547 13,956,203 14,085,961 14,324,919 15,238,731 15,338,575 15,396,527 15,531,077 15,531,078 15,829,268 15,845,290 15,951,499 16,132,666 16,132,670 16,132,838 16,132,942 16,133,190 16,133,363 16,133,379 16,211,378 16,211,954 16,213,713 16,656,342 16,683,012 16,683,013 16,683,083 16,683,100 16,683,108 16,683,119 16,683,598 16,683,599 16,683,601 16,583,608 16,683,609 16,683,611 16,633,513 16,683,614 16,683,616 16,683,618 16,683,620 16,683,62 16,683,623 16,683,653 16,683,881 16,683,992 16,634,366 16,684,410 16,684,725 16,684,726 16,684,730 16,685,150 16,685,183 16,685,196 16,685,245 16,685,271 16,685,394 16,685,395 16,685,549 16,685,550 16,685,551 16,685,552 16,685,588 16,685,683 16,685,687 16,685,688 16,686,075 16,686,100 16,686,112 l6,686,186 16,686,196 16,686,225 16,686,229 16,686,232 16,686,233 16,686,253 16,686,296 16,686,298 16,686,321 16,686,393 16,686,395 16,686,397 16,686,399 16,686,401 16,686,432 16,686,484 16,686,517 16,686,548 16,686,570 16,686,603 16,686,636 16,686,659 16,606,663 16,636,674 16,686,677 16,686,683 16,686,685 16,686,688 16,686,700 16,686,707 16,686,709 16,686,711 16,686,714 16,686,716 16,686,719 16,686,722 16,686,723 16,686,725 16,686,730 16,686,754 16,686,756 16,686,763 16,686,767 16,686,739 16,686,792 16,686,794 16,686,796 16,636,793 16,636,802 16,686,808 16,686,810 16,686,812 16,686,816 16,686,830 16,686,841 16,686,843 16,686,846 16,686,848 16,686,854 16,686,855 16,686,860 16,686,870 16,686,878 16,686,890 16,686,893 16,686,895 16,686,898 16,686,900 16,686,904 16,686,907 16,686,909 16,686,911 16,686,913 16,686,917 16,686,921 16,686,928 16,686,930 16,686,932 16,686,937 16,686,939 16,686,941 16,686,943 16,686,948 16,686,950 16,686,952 16,686,954 16,686,957 16,686,959 16,636,963 16,636,977 16,686,979 16,686,932 16,686,983 16,686,986 16,686,983 16,636,991 16,687,010 16,637,016 16,687,021 16,687,023 16,687,026 16,687,029 16,687,034 16,687,033 16,687,043 16,687,044 16,687,053 16,687,055 16,687,059 16,687,061 16,687,063 16,637,066 16,687,069 16,687,071 16,687,099 16,687,102 16,587,107 16,687,110 16,687,112 16,687,115 16,637,119 16,687,121 16,687,125 16,687,140 16,687,142 16,587,144 16,687,148 16,687,151 16,637,155 16,637,166 16,687,174 16,687,177 16,687,180 16,637,183 16,687,185 16,687,187 16,637,189 16,687,191 16,637,218 16,687,220 16,687,222 16,687,224 16,687,226 16,687,232 16,687,234 16,687,256 16,687,259 16,687,261 16,687,263 16,687,268 16,687,286 16,687,298 16,687,306 16,687,332 16,687,334 16,687,339 16,687,354 16,687,371 16,687,376 16,687,390 16,637,403 16,637,417 16,687,458 16,687,461 16,687,464 16,687,465 16,687,471 16,637,475 16,687,482 16,687,483 16,687,518 16,687,546 16,687,556 16,687,558 16,687,566 16,687,573 16,637,608 16,687,610 16,687,630 16,687,631 16,687,633 16,687,642 16,687,648 16,637,649 16,687,666 16,687,668 16,687,675 16,687,677 16,687,684 16,687,688 16,687,717 16,637,722 16,637,726 16,687,741 15,687,743 16,687,765 16,687,796 16,687,800 16,687,815 16,637,828 16,687,833 16,637,837 16,687,872 16,687,875 16,687,876 16,687,894 16,687,398 16,687,912 16,637,918 16,687,923 16,637,925 16,687,931 16,687,934 16,687,936 16,687,940 16,687,962 16,687,968 16,687,972 16,687,982 16,687,985 16,687,990 16,688,008 16,688,015 16,688,017 16,638,019 16,688,023 16,688,027 16,683,032 16,583,037 16,688,044 16,688,052 16,688,060 16,638,062 16,638,085 16,688,119 16,683,127 16,683,128 16,688,132 16,688,150 16,638,155 16,688,161 16,688,166 16,688,171 16,688,175 16,683,181 16,688,199 16,688,203 16,688,204 16,638,213 16,688,236 16,688,237 16,688,238 16,688,242 16,688,246 16,688,273 16,688,277 16,688,296 16,688,304 16,688,309 16,688,313 16,688,340 16,688,344 16,688,345 16,688,347 16,688,354 16,688,358 16,688,360 16,688,361 16,688,378 16,688,385 16,688,391 16,638,396 16,688,400 16,688,451 16,688,470 16,688,480 16,688,481 16,688,483 16,688,490 16,688,492 16,688,502 16,688,509 16,688,511 16,688,513 16,688,514 16,688,522 16,688,529 16,688,534 16,688,538 16,688,546 16,688,549 16,688,551 16,688,564 16,688,571 16,688,572 16,688,581 16,688,584 16,688,600 16,688,605 16,688,607 16,688,612 16,688,523 16,638,630 16,688,633 16,688,640 16,638,641 16,688,650 16,688,674 16,683,678 16,683,722 16,688,726 16,688,729 16,688,731 16,688,735 16,688,740 16,688,742 16,688,744 16,688,746 16,688,769 16,688,787 16,688,789 16,688,793 16,688,804 16,688,811 16,688,822 16,688,326 16,688,823 16,688,834 16,688,841 16,688,854 16,688,859 15,688,866 16,588,871 16,688,373 16,688,874 16,638,875 16,688,888 16,688,899 16,688,903 16,688,904 16,688,907 16,688,910 16,688,911 16,688,954 16,688,968 16,638,976 16,689,000 16,689,003 16,689,020 16,689,026 16,689,028 16,689,030 16,689,032 16,689,034 16,689,035 16,689,039 16,689,043 16,689,066 16,689,069 16,689,074 16 689,091 16,689,122 16,689,148 16,689,159 16,689,180 16,689,193 16,689,197 16,639,229 16,689,244 16,689,275 16,689,232 16,689,288 16,689,289 16,689,296 16,639,306 16,689,321 16,689,323 16,689,331 16,689,333 16,689,362 16,689,378 16,689,389 16,689,407 16,689,423 16,689,425 16,689,423 16,689,429 16,689,433 16,689,435 16,689,438 16,689,447 16,689,486 16,639,496 16,689,500 16,689,506 16,689,509 16,689,515 16,689,513 16,639,523 16,689,524 16,689,527 16,689,528 16,689,562 16,689,563 16,689,564 16,689,565 16,689,571 16,689,573 16,689,534 16,689,586 16,689,611 16,689,613 16,689,622 16,689,627 16,689,630 16,689,632 16,689,635 16,689,637 16,689,640 16,689,647 16,689,663 16,689,666 16,689,673 16,689,678 16,689,683 16,689,685 16,689,691 16,689,695 16,689,727 16,689,729 16,689,736 16,689,738 16,689,740 16,689,741 16,689,753 16,689,755 16,689,758 16,689,760 16,690,353 16,692,259 16,693,842 16,693,976 16,694,718 16,694,762 16,695,738 16,696,653 16,696,654 16,696,933 16,637,139 16,697,406 16,697,408 16,697,957 16,657,959 16,697,961 16,698,179 16,699,328 16,699,521 16,700,362 16,700,586 16,700,907 16,700,908 16,701,189 16,701,408 16,701,417 16,701,539 16,702,362 16,702,435 16,703,268 16,703,361 16,703,710 16,704,622 16,705,392 16,705,462 16,705,463 16,705,466 16,705,531 16,705,533 16,705,535 16,705,545 16,705,675 16,706,113 16,706,116 16,706,118 16,706,119 16,706,769 16,707,377 16,707,993 16,708,818 16,710,497 16,710,763 16,711,795 16,711,797 16,715,788 16,715,938 16,717,102 16,717,107 16,717,536 16,717,578 16,717,583 16,717,592 16,717,593 16,717,595 16,717,603 16,717,605 16,717,643 15,717,644 16,717,652 16,717,657 16,717,578 16,726,724 16,726,725 16,726,928 16,727,069 16,742,676 16,750,638 16,750,700 16,750,702 16,750,704 16,750,706 16,751,742 16,752,035 16,752,037 16,752,039 16,752,157 16,752,159 16,752,280 16,752,282 16,752,284 16,752,384 16,752,386 16,752,388 16,752,390 16,752,503 16,752,505 16,752,507 16,752,509 16,760,656 17,757,229 17,757,914 17,764,892 17,778,956 17,778,357 17,736,555 17,786,556 17,817,953 17,822,508 17,822,510 17,826,684 17,849,914 17,884,946 17,897,207 17,917,039 17,936,221 17,945,298 17,964,729 17,976,351 18,000,152 18,006,734 18,182,969 18,350,096 18,350,179 13,350,195 18,350,251 18,350,260 18,350,272 18,352,342 18,352,411 18,352,412 18,362,431 18,364,093 18,364,110 18,369,789 18,377,198 18,387,057 18,387,053 18,337,060 18,387,072 18,401,200 18,458,528 18,453,565 18,468,794 18,502,979 18,503,509 18,503,583 18,503,597 18,503,607 18,503,614 18,503,626 18,503,641 18,503,663 18,503,674 18,503,676 18,503,678 18,503,713 18,503,717 18,503,718 18,503,720 18,503,730 18,503,732 18,503,745 18,503,756 18,503,760 18,503,762 18,503,780 18,503,786 18,503,788 18,503,795 18,503,809 18,503,817 18,503,829 18,503,834 18,503,854 18,503,855 18,503,866 18,513,362 18,513,368 18,513,395 18,517,340 18,517,342 18,517,343 18,533,808 18,619,949 18,620,401 18,698,857 18,698,358 18,698,859 18,698,860 18,719,776 18,755,853 13,759,325 13,764,251 18,764,466 18,794,972 18,801,121 18,801,139 18,931,796 18,951,198 18,954,064 18,963,165 18,968,263 18,972,203 18,981,572 18,982,367 18,982,494 18,982,517 13,986,400 18,986,401 19,019,300 19,042,246 19,044,994 19,045,026 19,068,398 19,073,968 19,073,976 13,083,438 19,093,335 19,097,031 19,097,032 19,097,034 19,097,036 19,347,784 19,349,306 19,351,976 19,354,077 19,366,336 19,366,341 19,366,346 19,366,352 19,372,168 19,372,178 19,373,839 19,373,841 19,373,847 19,373,849 19,379,549 19,417,354 19,432,230 19,594,006 19,594,014 19,594,015 19,594,016 19,609,633 19,638,871 19,700,212 19,734,742 19,734,744 19,734,745 19,739,452 19,748,302 19,762,749 19,762,750 19,762,751 19,762,752 19,762,753 19,762,755 19,774,966 19,795,275 19,795,276 19,795,277 19,795,280 19,795,286 19,795,293 19,795,298 19,795,302 19,821,446 19,840,059 19,877,071 19,887,685 19,887,689 19,887,691 19,887,696 19,887,720 19,887,725 19,899,974 19,913,507 19,969,014 19,969,017 19,969,018 19,969,019 19,969,021 19,969,022 19,969,023 19,969,024 19,969,026 19,969,027 19,969,031 19,969,032 19,969,036 19,969,037 19,969,039 19,969,040 19,969,041 19,969,042 19,969,043 19,971,369 19,975,042 19,981,557 19,983,424 19,991,813 19,993,400 19,993,402 19,993,412 19,993,418 20,038,203 20,056,484 20,056,601 20,063,739 20,063,745 20,083,778 20,084,143 20,084,144 20,084,145 20,146,627 20,146,628 20,186,109 20,195,292 20,235,371 20,259,845 20,291,586 20,291,592 20,314,491 20,391,574 20,401,169 20,443,249 20,443,251 20,463,996 20,474,401 20,474,407 20,474,432 20,474,444 20,493,173 20,529,305 20,829,307 20,529,309 20,549,661 20,554,899 20,562,912 20,658,850 20,669,215 20,670,558 20,835,778 20,835,967 20,836,032 20,836,033 20,836,037 20,836,063 20,836,064 20,836,065 20,836,066 20,S36,067 20,336,069 20,841,651 20,846,195 20,846,196 20,981,344 20,931,345 20,981,346 20,981,347 21,096,833 21,113,938 21,119,588 21,126,179 21,127,108 21,127,109 21,139,532 21,139,533 21,188,886 21,188,887 21,183,889 21,188,390 21,201,179 21,263,248 21,287,599 21,290,433 21,292,545 21,292,548 21,523,241 21,536,746 21,646,515 21,646,518 21,646,549 21,646,556 21,646,561 21,646,575 21,649,357 21,685,678 21,732,577 21,732,578 21,732,579 21,737,067 21,756,111 21,840,658 21,853,879 21,853,881 21,853,883 21,863,617 21,863,626 21,863,638 21,863,662 21,881,458 21,881,691 21,881,814 21,889,414 21,893,958 21,900,090 21,902,214 21,903,750 21,903,777 21,924,639 21,924,665 21,953,576 21,964,863 21,972,194 21,972,202 21,982,758 21,987,541 21,989,411 21,993,039 21,993,041 21,993,046 21,996,680 21,996,687 21,996,691 21,996,700 21,996,702 21,996,706 21,996,719 22,005,423 22,005,428 22,005,432 22,020,061 22,020,062 22,020,065 22,024,009 22,035,134 22,053,046 22,053,047 22,056,400 22,056,405 22,058,812 22,073,265 22,116,673 22,119,339 22,119,529 22,129,262 22,131,377 22,168,435 22,227,347 22,228,659 22,228,668 22,228,669 22,229,092 22,234,749 22,239,852 22,245,544 22,257,403 22,257,408 22,257,416 22,257,444 22,266,542 22,311,743 22,327,955 22,342,067 22,342,072 22,342,089 22,342,093 22,342,111 22,342,138 22,342,145 22,342,158 22,342,172 22,342,180 22,342,188 22,342,193 22,342,196 22,342,197 22,342,212 22,342,213 22,342,223 22,342,226 22,342,228 22,342,235 22,342,237 22,342,243 22,342,246 22,342,251 22,342,260 22,342,268 22,342,271 22,348,440 22,348,441 22,373,310 22,382,064 22,395,621 22,4i6,288 22,476,867 22,476,868 22,476,369 22,476,870 22,476,873 22,476,877 22,559,636 22,593,186 22,593,461 22,597,237 22,617,368 22,619,535 22,619,533 22,619,540 22,619,543 22,619,546 22,619,548 22,619,550 22,619,556 22,619,560 22,619,562 22,619,563 22,619,565 22,619,563 22,619,570 22,619,572 22, 619,575 22,619,577 22,619,579 22,619,583 22,619,586 22,619,595 22,619,597 22,619,599 22,619,601 22,619,605 22,619,610 22,622,810 22,667,472 22,667,473 22,677,101 22,677,105 22,677,107 22,712,891 22,718,954 22,721,302 22,724,594 22,726,239 22,741,572 22,741,573 22,741,582 22,836,337 22,924,281 22,924,283 22,930,289 22,944,824 22,987,297 22,988,973 22,988,978 22,988,989 22,988,998 22,989,008 22,989,019 22,989,021 22,989,034 22,989,043 22,939,045 22,939,047 22,996,790 22,996,913 22,996,914 22,996,922 22,998,772 23,034,978 23,035,001 23,069,406 23,069,577 23,106,338 23,132,928 23,132,939 23,132,954 23,132,960 23,132,976 23,132,994 23,133,066 23,133,035 23,133,104 23,133,103 23,133,111 23,133,135 23,133,208 23,133,220 23,133,233 23,133,240 23,133,243 23,158,323 23,172,887 23,173,756 23,234,545 23,237,442 23,237,443 23,237,638 23,237,639 23,237,640 23,263,168 23,290,347 23,290,357 23,290,626 23,297,456 23,297,457 23,297,458 23,297,460 23,297,461 23,349,105 23,358,537 23,364,976 23,368,821 23,434,970 23,447,009 23,452,070 23,452,071 23,496,438 23,505,292 23,622,502 23,622,503 23,626,513 23,626,673 23,626,677 23,626,679 23,626,680 23,626,842 23,626,844 23,627,000 23,627,001 23,627,004 23,627,005 23,627,157 23,627,158 23,630,531 23,633,149 23,638,203 23,638,567 23,659,334 23,665,040 23,667,254 23,667,270 23,667,271 23,669,627 23,677,988 23,678,227 23,686,987 23,686,988 23,686,989 23,695,002 23,700,084 23,715,661 23,716,568 23,716,909 23,719,542 23,719,543 24,182,112 24,182,113 24,182,140 24,182,326 24,182,329 24,182,333 24,182,335 24,182,336 24,182,337 24,182,338 24,182,339 24,182,340 24,182,341 24,182,342 24,182,343 24,183,194 24,204,782 24,204,783 24,204,784 24,204,785 24,741,041 24,756,103 24,798,913 24,809,138 24,867,560 24,884,187 24,906,211 25,022,171 25,076,497 25,076,666 25,193,242 25,194,794 25,194,796 25,194,798 25,228,294 42,643,355 44,148,022 44,153,142 44,153,290 44,228,599 44,233,597 44,238,265 44,238,631 44,239,672 44,240,267 44,249,223 44,512,541 44,512,542 44,517,919 44,517,925 44,541,942 44,597,116 44,717,411 44,717,411 44,717,411 44,717,573 44,817,506 44,887,160 45,044,973 45,045,138 45,045,192 45,045,193 45,045,194 43,045,196 45,045,199 45,045,200 45,045,210 45,045,211 45,049,019 45,049,600 45,050,451 45,050,453 45,357,504 45,480,132 45,933,604 45,933,659 46,183,771 46,188,363 46,189,690 46,237,239 46,872,310 45,899,649 46,928,906 46,928,909 46,929,660 46,529,662 46,929,564 46,929,767 46,929,769 45,929,771 46,929,773 46,929,775 46,923,877 46,929,879 46,929,881 46,929,883 46,929, 885 46,929,983 46,929,935 46,929,987 46,929,989 46,929,991 46,930,089 46,930,738 46,930,740 46,930,742 46,930,744 46,930,832 46,930,834 46,930,836 46,930,838 46,930,840 46,930,842 46,930,931 46,930,933 46,930,335 49,793,478 49,836,322 49,853,493 49,874,343 |49,874,344 49,874,345 49,874,346 50,905,225 50,905,228 50,905,230 50,907,557 50,907,559 50,907,773 50,907,775 50,907,777 50,907,779 50,908,230 50,908,463 50,908,465 50,908,469 50,908,470 50,911,248 50,911,456 50,933,198 50,934,395 50,942,467 50,942,549 51,031,263 51,050,603 52,951,663 52,952,662 53,297,348 53,443,043 53,465,423 53,469,680 53,471,861 54,599,893 54,600,651 54,602,403 54,605,141 54,605,327 54,607,458 54,607,453 54,607,892 54,609,460 54,609,451 54,690,107 54,690,110 54,690,112 56,603,832 56,641,575 56,642,813 56,642,814 56,642,815 56,649,287 56,649,288 56,649,289 56,649,290 56,649,291 56,649,292 56,649,293 56,650,053 56,838,736 56,842,480 56,927,674 56,931,004 56,954,063 57,347,420 57,348,099 57,348,139 57,348,242 57,350,786 57,353,046 57,369,581 57,369,582 57,370,240 57,371,214 57,404,131 57,404,132 57,404,141 57,404,144 57,479,380 57,479,381 57,801,122 57,801,123 58,271,550 58,271,568 58,271,571 58,708,617 58,954,727 58,981,248 59,423,141 59,469,260 59,862,225 59,876,870 59,941,562 59,945,033 59,945,049 59,953,892 60,153,069 60,203,006 70,682,647 71,295,992 71,300,790 71,301,085 71,301,086 71,301,087 71,301,088 71,301,100 71,301,433 71,306,778 71,306,778 71,306,979 71,311,282 71,312,650 71,340,449 71,345,114 71,361,359 71,372,842 71,430,991 71,434, 327 71,434,328 71,447,128 71,475,865 71,479,473 71,500,253 71,517,948 71,528,218 71,578,862 71,658,082 71,732,632 71,732,634 71,741,547 72,164,734 72,203,693 72,736,046 72,736,768 72,941,503 73,212,144 73,307,636 73,555,299 73,555,452 73,555,495 73,556,093 73,557,134 73,780,045 73,894,307 73,894,317 73,894,318 73,394,319 74,082,032 75,412,563 76,963,945 77,620,826 84,819,435 85,524,452 85,770,041 85,787,724 85,396,371 85,896,374 85,972,541 86,154,368 86,600,076 86,600,078 86,600,080 86,629,112 86,638,468 86,633,469 36,658,470 86,642,991 86,664,723 86,738,015 86,745,982 86,745,983 36,745,984 86,748,578 86,748,579 86,755,560 87,109,675 87,148,513 87,261,616 87,261,618 87,261,627 87,261,632 87,261,634 87,261,636 87,261,637 87,261,659 87,261,710 87,261,723 87,261,725 87,261,733 87,261,734 37,261,733 87,261,740 87,261,750 87,261,751 87,261,753 87,261,754 87,261,758 87,273,635 87,315,251 37,315,420 87,315,759 87,357,341 87,357,342 87,372,967 87,439,741 87,475,080 87,475,225 87,477,991 87,574,556 87,574,667 87,575,532 87,575,818 87,575,929 87,625,935 87,684,551 87,634,552 87,702,250 87,740,953 87,743,651 87,386,395 87,930,618 87,932,050 87,950,566 87,973,266 88,095,364 88,096,059 88,104,535 88,157,706 88,176,249 88,193,568 88,222,470 88,254,467 88,258,496 88,296,023 88,374,845 88,413,526 88,435,151 88,445,516 88,445,518 88,473,380 83,473,411 88,473,438 88,473,759 88,492,068 88,492,070 88,499,769 88,607,097 88,619,303 88,622,678 88,624,465 88,624,466 88,626,735 88,633.060 88,643,234 88,689,628 88,701,486 88,735,730 88,738,422 88,747,108 88,749,053 88,749,265 88,749,279 88,749,282 88,760,630 88,760,633 88,760,930 88,775,758 88,304,969 90,471,465 90,472,492 90,472,811 90,473,364 90,473,686 90,476,658 90,476,658 90,477,046 90,478,732 90,659,536 90,661,669 91,654,628 91,666,506 91,666,539 91,668,039 91,668,040 31,867,184 91,868,044 91,868,424 91,836,666 91,979,898 91,996,051 91,996,299 91,997,848 92,004,796 92,026,277 92,028,425 92,028,431 92,029,717 92,043,174 102,600,862 102,601,227 102,601,620 102,602,550 117,064,703 117,064,732 117,064,750 117,064,773 117,064,814 117,064,943 117,065,015 117,065,049 117,065,281 117,065,286 117,065,352 117,065,353 117,094,805 118,855,762 118,856,320 119,025,724 119,075,307 119,075,410 119,075,411 119,075,412 119,075,413 113,075,414 l21,225,415 121,233,523 121,235,197 121,513,981 122,129,633 122,129,634 122,404,843 122,409,375 124,219,876 127,262,626 127,262,627 129,627,836 129,627,337 129,628,445 129,631,374 129,631,549 129,631,550 129,632,304 129,636,318 129,637,112 129,637,113 129,640,894 129,655,635 129,655,962 129,656,034 129,656,045 129,656,052 129,663,025 129,663,276 129,664,704 129,664,993 129,666,672 129,666,688 129,665,712 129,666,726 129,672,591 129,672,604 129,672,603 129,672,616 129,677,390 129,677,407 129,673,204 129,681,485 129,681,498 129,681,530 129,684,391 129,684,392 129,691,988 129,692,842 129,708,928 129,723,561 129,738,338 129,741,653 123,760,359 129,762,840 129,772,466 129,784,023 129,794,466 129,801,784 129,801,784 129,801,784 129,809,167 129,809,204 129,809,234 129,809,241 129,809,273 129,809,286 129,809,383 129,815,113 129,815,572 129,815,618 129,815,644 129,815,671 129,816,899 129,821,553 129,821,554 129,826,505 129,827,852 129,851,725 129,852,375 129,875,229 129,885,650 129,890,416 129,893,591 129,893,718 129,896,656 131,635,452 131,697,748 131,707,326 131,707,326 131,712,430 131,713,084 131,719,336 131,731,322 131,738,151 131,739,790 131,739,792 131,842,086 131,842,288 131,845,348 131,870,833 131,873,231 131,876,773 131,878,506 131,380,760 131,883,481 131,383,482 131,883,905 131,883,906 131,834,069 131,834,369 131,884,370

    TABLE-US-00008 TABLE 7 1.28 Exemplary PANDA Agents with structural and transcriptional activity rescue verified by our experiments. Compounds were randomly selected from Table 1-Table 6, together with other compounds having only one or two cysteine-binding potential and experimentally tested their ability in folding p53- R175H and transcriptionally activating p53-R175H on PUMA promoter using the PAb1620 IP assay and luciferase reporter assay, respectively. Increasing + represents increasing transcriptional activity of p53-R175H on PUMA promoter upon compound treatment. Degree of NSC No. Degree mp53 or of mp53 transcriptional Sigma structural activity Formula Structure Cat No. CID No. rescue rescue KAsO.sub.2 [00027]embedded image NSC3060 23,668,346 + +++++ AsCl.sub.3 [00028]embedded image Sigma 200077 24,570 + +++++ HAsNa.sub.2O.sub.4 [00029]embedded image Sigma A6756 61,460 + +++++ NaAsO.sub.2 [00030]embedded image Sigma S7400 443,495 + +++++ AsI.sub.3 [00031]embedded image Sigma 401145 24,575 + +++++ As.sub.2O.sub.3 [00032]embedded image Sigma 202673 261,004 + +++++ As.sub.2O.sub.5 [00033]embedded image Sigma 483257 14,771 + +++++ KAsF.sub.6 [00034]embedded image Sigma 342246 159,810 + +++ LiAsF.sub.6 [00035]embedded image Sigma 308315 9,837,036 + +++ SbCl.sub.3 [00036]embedded image Sigma 337374 24,814 + +++ SbF.sub.3 [00037]embedded image Sigma 381292 24,554 + ++ SbAc.sub.3 [00038]embedded image Sigma 483265 16,685,080 + ++ Sb.sub.2O.sub.3 [00039]embedded image Sigma 202649 27,652 + +++ Sb(OC.sub.2H.sub.5).sub.3 [00040]embedded image Sigma 213314 16,686,007 + +++ Sb(OCH.sub.3).sub.3 [00041]embedded image Sigma 538345 16,684,878 + +++ SbI.sub.3 [00042]embedded image Sigma 401188 14,813 + +++ Sb.sub.2O.sub.5 [00043]embedded image Sigma 255998 14,813 + +++ Sb.sub.2(SO.sub.4).sub.3 [00044]embedded image Sigma 10783 24,010 + +++ BiI.sub.3 [00045]embedded image Sigma 229474 111,042 + +++ C.sub.16H.sub.18As.sub.2N.sub.4O.sub.2 [00046]embedded image NSC92909 261,046 + + C.sub.13H.sub.14As.sub.2O.sub.6 [00047]embedded image NSC48300 241,158 + +++ C.sub.17H.sub.28AsClN.sub.4O.sub.6S [00048]embedded image NSC721951 405,069 + + C.sub.10H.sub.13NO.sub.8Sb [00049]embedded image NSC31660 16,682,749 + +++ C.sub.6H.sub.12NaO.sub.8Sb+ [00050]embedded image NSC15609 24,182,331 + +++ (CH.sub.3CO.sub.2).sub.3Sb [00051]embedded image Sigma 483265 16,685,080 + + C.sub.8H.sub.4K.sub.2O.sub.12Sb.sub.2xH.sub.2O [00052]embedded image Sigma 244791 53,315,432 + ++ C.sub.13H.sub.21NaO.sub.9Sb+ [00053]embedded image NSC15623 24,182,342 + +++ HOC.sub.6H.sub.4COOBiO [00054]embedded image Sigma 480789 16,682,734 + + (O.sub.2CCh.sub.2C(OH)(CO.sub.2)CH.sub.2CO.sub.2]Bi [00055]embedded image Sigma 480746 16,696,198 + +++ (CH.sub.3CO.sub.2).sub.3Bi [00056]embedded image Sigma 401587 16,688,082 + +++ As.sub.2S.sub.2 [00057]embedded image Sigma 519111 3,627,253 + +++++ As.sub.2S.sub.3 [00058]embedded image Sigma 448060 4,093,503 + +++++ As.sub.2S.sub.5 [00059]embedded image Sigma 519103 3,371,533 + +++++ [00060]text missing or illegible when filed

    TABLE-US-00009 TABLE 8 Rescue profile of selected mp53. Str. Res. column shows whether the mp53 is structurally rescuable. Func. Res. shows whether the mp53 is functionally rescuable. Res. column shows whether the mp53 is rescuable (i.e. either structurally or functionally rescuable). Mutations are selected from clinical p53 mutations detected by Shanghai Institute of Hematology (SIH) and p53 mutations reported in MDS patients (FIG. 4), and our clinical data. Str. Func. Str. Func. Str. Func. mp53 Res. Res. Res. mp53 Res. Res. Res. mp53 Res. Res. Res. R17H Yes Yes Yes K132M Yes Yes Yes D261H Yes Yes Yes R245S Yes Yes Yes A138V No Yes Yes D281Y Yes No Yes R248Q Yes Yes Yes G154S Yes No Yes R283H Yes Yes Yes R249S Yes Yes Yes R156P No Yes Yes L383P No No No R273H No No No A159V Yes Yes Yes M384T No No No R282W Yes Yes Yes A159P Yes Yes Yes F054Y Yes Yes Yes T232T Yes Yes Yes M160L No No Yes S090P Yes Yes Yes F270C No Yes Yes Y163H Yes Yes Yes Q375X Yes Yes 'es Y220H No Yes Yes Y163C Yes Yes Yes Q038H Yes Yes Yes I254T Yes Yes Yes R174L Yes Yes Yes S241A No Yes Yes P273C No No No C176Y Yes Yes Yes S241C Yes Yes Yes C176F Yes No Yes H179Y Yes Yes Yes S241D Yes Yes Yes H179P Yes Yes Yes H179Q Yes Yes Yes S241E Yes Yes Yes Y220C Yes No No P190L Yes Yes Yes S241F Yes Yes Yes R278S No No No H193R Yes Yes Yes S241G No Yes Yes Vl43A Yes Yes Yes R20'9K Yes No Yes S241H No Yes Yes S006P No No No V216E No Yes Yes S241E Yes Yes Yes L014P No No No Y234H Yes Yes Yes S241K No No No S033P No Yes Yes M23IT Yes Yes Yes S241L No Yes Yes Q052R No No No V272N Yes Yes Yes S241M Yes Yes Yes D057G No Yes Yes C238Y Yes Yes Yes S241N Yes Yes Yes D061G No Yes Yes G245A Yes Yes Yes S241P Yes No Yes P072A No No No G245D Yes Yes Yes S241Q Yes Yes Yes P080S No No No R248W No Yes Yes S241R Yes Yes Yes T081P No No No G266R No Yes Yes S241T No Yes Yes S094P No No No F270S No Yes Yes S241V Yes Yes Yes S095F No No No R273S No No No S241W Yes Yes Yes Y126C No Yes Yes R273L No No No S241Y Yes No Yes L130H Yes Yes Yes R278H No No No

    TABLE-US-00010 TABLE 9 1.30 Representative mp53 rescuability experimental data. Structural rescuability for the indicated mp53 was measured by comparing the PAb1620 immunoprecipitation efficiency of the mp53 in the presence and absence of the PANDA Agent ATO. Functional rescuability for the indicated mp53 was measured by the functional assays Luciferase, qPCR, and/or Western blot for the indicated mp53 target genes in the presence and absence of the PANDA Agent ATO. A p53 mutation is rescuable if it is neither functionally nor structurally rescuable. A p53 mutation is non-rescuable if it is neither functionally nor structurally rescuable. Other PANDA Agents also produced a similar rescuability profile. 1620 TP Luciferase Assay qPCR / CDKNIA PUMA MDM2 PIG3 CDKNIA PUMA MDM2 Str. Func. H H HC S2 H HC S2 H HC S2 H H H H Res Res R175H 39.6 3.8 1.4 1.5 6.2 1.0 1.5 8.1 2.4 1.6 6.8 2.2 3.3 Yes Yes R245S 1.6 3.7 2.6 2.6 2.1 1.7 1.1 2.7 3.3 4.2 2.3 Yes Yes R248Q 2.1 1.3 1.3 1.3 1.1 1.0 1.3 1.4 2.1 1.3 0.9 Yes Yes R249S 19.4 3.9 1.2 1.5 1.1 0.9 1.3 1.7 2.6 1.2 Yes Yes R273H 1.4 1.3 1.1 1.4 1.1 1.0 1.4 1.5 1.4 1.3 1.1 No No R282W 3.5 6.8 5.2 9.9 17.0 4.1 13.1 5.1 3.0 3.2 6.5 Yes Yes I232T 1.6 6.2 4.6 6.0 7.7 3.6 4.0 2.4 2.7 3.2 4.3 Yes Yes F270C 1.1 8.0 3.1 3.8 8.1 2.5 3.2 1.4 2.1 1.9 2.1 No Yes Y220H 1.0 4.4 14.5 5.1 2.1 No Yes I254T 1.8 7.8 3.2 3.4 2.9 Yes Yes R273C 1.2 1.0 0.9 1.3 0.6 No No 1620 1620 1620 TP Luciferase Assayu STR. Func. TP Luciferase Assay Str. Func. TP Western Bloat Str. Func. / CDKNIA PUMA Res RES / CDKNIA PUMA Res. Res. / Puma p21 Res Res. C176F 2.7 1.2 Yes No G245A 3.2 3.2 Yes Yes S241A 1.47 2.2 1.0 No Yes H179R 4.6 1.0 1.8 Yes Yes G2450 1.7 1.5 Yes Yes Y220C 3.9 1.4 1.0 Yes No R248W 1.1 1.5 No Yes R278S 1.0 1.1 No No G266R 1.0 3.2 No Yes V143A 6.5 2.5 Yes Yes F270S 1.0 1.9 No Yes S006P 1.2 1.3 No No R273S 1.49 1.0 No No L014P 1.2 1.1 No No R273L 1.2 1.0 No No S033P 1.0 1.9 No Yes P278H 1.1 1.0 No No Q052R 1.1 1.4 No No D281H 2.1 2.2 Yes Yes D057G 1.0 1.5 No Yes D281Y 1.5 1.1 Yes No D061G 1.1 2.1 No Yes R283H 1.6 1.6 Yes Yes P072A 0.9 1.3 No No L383P 1.1 1.2 No No P080S 1.0 1.0 No No M384T 1.2 1.0 No No T081P 1.49 1.2 No No F054Y 1.6 1.2 Yes Yes S094P 0.9 0.9 No No S090P 1.6 1.2 Yes Yes S095F 1.1 1.2 No No Q375X 2.0 1.3 Yes Yes Y126C 0.9 2.9 No Yes Q038H 1.7 1.5 Yes Yes L130H 86.7 9.5 Yes Yes K132M 1.6 2.5 Yes Yes A138V 1.1 4.8 No Yes G154S 2.1 1.2 Yes No 1620 1620 TP Luciferase Assay STR. Runc TP Luciferase Assay Str. Func. / CDKNIA PUMA Res Res / CDknia PUMA Res. Res. R156P 1.0 3.3 No Yes S241C 2.7 1.1 1.8 Yes Yes A159V 2.9 7.8 Yes Yes S241D 2.1 2.7 1.4 Yes Yes A159P 2.8 2.8 Yes Yes S241E 1.7 0.9 1.8 Yes Yes M160L 0.0 1.1 No No S241F 1.9 0.6 2.2 Yes Yes Y163H 6.5 3.0 Yes Yes S241G 1.4 1.1 1.9 No Yes Y163C 10.4 3.1 Yes Yes S241H 1.1 2.1 1.1 No Yes R174L 2.8 2.2 Yes Yes S241I 1.6 1.6 2.8 Yes Yes C176Y 26.1 2.8 Yes Yes S241K 1.3 1.4 0.9 No No H179Y 78.7 2.1 Yes Yes S241L 1.4 2.9 1.5 No Yes H179Q 2.3 1.8 Yes Yes S241M 1.5 0.8 1.8 Yes Yes P190L 2.7 4.3 Yes Yes S241N 2.7 8.9 1.5 Yes Yes H193R 2.4 2.0 Yes Yes S241P 4.2 0.6 1.0 Yes No R209K 2.0 1.4 Yes No S241Q 2.0 1.7 7.4 Yes Yes V216E 1.0 2.3 No Yes S241R 2.3 11.0 1.6 Yes Yes Y234H 2.7 48.9 Yes Yes S241T 1.1 1.9 1.4 No Yes M237I 82.4 2.4 Yes Yes S241V 2.8 0.4 2.5 Yes Yes V272M 4.3 28.4 Yes Yes S241W 1.7 5.7 2.1 Yes Yes C238Y 68.3 1.6 Yes Yes S241Y 1.8 1.1 1.3 Yes No Str. Res.: one or more of the wildtype structure in the indicated mp53 can be rescured by the PANDA Agent ATO, as measured to a 1.5 fold or more increase in PAb1620 immunoprecipitation signal. A Yes in this column supports the presence of a structurally rescuable p53 mutation. Fun. Res.: one or more of the mutation is a functionally rescuable p53 mutation, as indicated by a Yes under the colun. In particular, the PANDA Agent can rescue one or more of the mp53's wild type function to a 1.5 fold or more, as measured by luciferase assay, qPCR, or Western blot. The cell expressing the mp53s include H1299 non-small cell lung carcinoma cell (H), HC T116 colon cancer cells (HC), and Saos-2 osteosarcoma (S2).

    TABLE-US-00011 TABLE 10 Patient selection criteria for our phase I Decitabine (DAC) - ATO combination therapy trial for Myelodysplastic Syndrome (DMS). Patients with mutant TP53 tested for rescuability, and those with rescuable mp53 are selected for trial. Characteristics of the 50 sequenced MDS/AML patients at diagnosis All Mutant Wild-Type Patients TP53 TP53 Characteristic (N = 50) (N = 3) (N = 47) Exome sequencing performed - 50 (100) 3 (100) 47 (100) No. (%) Male sex - No. (%) 27 (54) 0 (0) 27 (57) Age at diagnosis - yrs Median 57.5 62 57 Range 17-92 49-64 17-82 Disease - No. (%) AML 5 (10) 0 (0) 5 (11) MDS 45 (90) 3 (100) 42 (89)

    TABLE-US-00012 TABLE 11 1.32 Treatment response observed in our phase I Decitabine (DAC) - ATO combination therapy trial for Myelodysplastic Syndrome (DMS). Clinical characteristics and responses of the three treated mp53 patients (#27, #35, and #19) Hb; Diag.; BM Platelets; Study Best Patient Sex mp53 Age (yr) Blast ANC Karyotype IPSS-R Regimen (days) Response #27 F S241F MDS- 7.5% 70 g/L; 46XX, High DAC + 259 Complete RAEB 101 10.sup.9/L; 6p+ risk ATO Remission (62) 1.85 10.sup.9/L #35 F S241C MDS- 10.5% 63 g/L; 46XX High DAC + 359 Complete RAEB-II 20 10.sup.9/L; risk ATO Remission (63) 0.77 10.sup.9/L #19.sup.a F Q375*, MDS- 6.5% 94 g/L; 46XXX, +del (3) (p21), 5, 13, Very DAC + 166 Progression- Q38H RAEB-I 34 10.sup.9/L; +mar [12]/46, idem, 7, +8, 14, high ATO + free (62) 1.74 10.sup.9/L 17, 19, +mar2, +mar3, +mar4 risk ARA [2]/46XX [5] .sup.aPatient No. 19 was DAC-resistant and AML -prone Hb means Haemoglobin *means the mutations causes a stope code on p53 gene sequence, leading to a truncated mp53

    TABLE-US-00013 TABLE 12 Adverse effects observed in our phase I Decitabine (DAC) - ATO combination therapy trial for Myelodysplastic Syndrome (DMS). Adverse Patient: events of treatment #27 #35 #19 WBC (1 100) 2 2 2 PLT (1 109) 0 2 2 Hb (g/L) 0 0 1 Fever/No. infection 1 1 1 Weight gain/loss 0 0 1 Nausea 0 0 1 Vomiting 0 0 1 Diarrhea 0 0 0 Fatigue 0 0 1 Constipation 1 0 0 Dyspnead 0 0 0 Dysrhythmias 0 0 1 Stomatitis 0 0 1 SGOT/SGPT 0 0 0 Blood creatinine increased 0 0 0 Hypokalemia 0 0 0

    TABLE-US-00014 TABLE 13 Exemplary p53 SNPs P47S P72R V217M G360A R110L/P R267W P278A R290H N311S E339K S366A

    TABLE-US-00015 TABLE14 p53Isoforms,NomenclaturesandSequences p53aminoacidsequence, p53Nomenclatureandreference PANDACysteinesareunderlined Wildtypehumanp53isoforma 393aa NCBIReferenceSequence:NP_000537.3cellular MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLP tumorantigenp53isoforma[Homosapiens]; SQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPP NCBIReferenceSequence:NP_001119584.1, VAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYG NP_001119584.1cellulartumorantigenp53 FRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQ isoforma[Homosapiens] LWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE OtherNames: RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSV p53isoform1 VVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPIL UniProtdatabaseidentifier:P04637-1, TIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN sp|P04637|P53_HUMANCellulartumorantigenp53 LRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLD OS=HomosapiensGN=TP53PE=1SV=4 GEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG p53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD full-lengthp53 p53. Wildtypehumanp53isoformb 341aa NCBIReferenceSequence:NP_001119586.1, MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLP NP_001119586.1cellulartumorantigenp53isoformb SQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPP [Homosapiens] VAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYG OtherNames: FRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQ p53isoform2 LWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRVPHHE UniProtdatabaseidentifier:P04637-2, RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSV sp|04637-2|P53_HUMANIsoform2ofCellular VVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPIL tumorantigenp53OS=HomosapiensGN=TP53 TIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN p53. LRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLD GEYFTLQDQTSFQKENC Wildtypehumanp53isoformc 346aa NCBIReferenceSequence:NP_001119585.1, MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLP NP_001119585.1cellulartumorantigenp53isoformc SQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPP [Homosapiens] VAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYG OtherNames: FRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQ p53isoform3 LWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE UniProtdatabaseidentifier:P04637-3, RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSV sp|P04637-3|P53_HUMANIsoform3ofCellular VVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPIL tumorantigenp53OS=HomosapiensGN=TP53 TIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN p53 LRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLD GEYFTLQMLLDLRWCYFLINSS Wildtypehumanp53isoformg 354aa NCBIReferenceSequence:NP_001119590.1, MDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAP NP_001119590.1cellulartumorantigenp53isoformg APAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRL [Homosapiens]; GFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWV NCBIReferenceSequence:NP_001263689.1, DSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCS NP_001263689.1cellulartumorantigenp53isoformg DSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVP [Homosapiens]; YEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII NCBIReferenceSequence:NP_001263690.1, TLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK NP_001263690.1cellulartumorantigenp53isoformg KGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEY [Homosapiens]) FTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSR OtherNames: AHSSHLKSKKGQSTSRHKKLMFKTEGPDSD p53isoform4 UniProtdatabaseidentifier:P04637-4, sp|P04637-4|P53_HUMANIsoform4ofCellular tumorantigenp53OS=HomosapiensGN=TP53) 40p53 Wildtypehumanp53isoformi 302aa NCBIReferenceSequence:NP_001263625.1, MDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAP NP_001263625.1cellulartumorantigenp53isoformi APAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRL [Homosapiens] GFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWV OtherNames: DSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCS p53isoform5 DSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVP UniProtdatabaseidentifier:P04637-5, YEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII sp|P04637-5|P53_HUMANIsoform5ofCellular TLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK tumorantigenp53OS=HomosapiensGN=TP53) KGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEY 40p53 FTLQDQTSFQKENC Wildtypehumanp53isoformh 307aa NCBIReferenceSequence:NP_001263624.1, MDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAP NP_001263624.1cellulartumorantigenp53isoformh APAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRL [Homosapiens]) GFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWV OtherNames: DSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCS p53isoform6 DSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVP UniProtdatabaseidentifier:P04637-6, YEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII sp|P04637-6|P53_HUMANIsoform6ofCellular TLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK tumorantigenp53OS=HomosapiensGN=TP53 KGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEY 40p53 FTLQMLLDLRWCYFLINSS

    1.36 Representative Effective Dose for Mouse Studies

    [0267]

    TABLE-US-00016 TABLE 15 Representative effective dose for administering in mouse. Drug concen- tration when administration Dose per day ATO (i .v.) 1 mg/ml 5 mg/kg ATO (oral) 1 mg/ml 5 mg/kg As2S2 (oral) 15 mg/ml 100 mg/kg As2S3 (oral 15 mg/ml 100 mg/kg As2S5 (oral) 15 mg/ml 100 mg/kg As4S4 (oral) 15 mg/ml 100 mg/kg

    TABLE-US-00017 TABLE 16 Representative effective dose in humans. Maximun Platform Adminis- Metal Metal tering concen- concen- drug tration tration concen- Dose in blood in blood tration per day (plasma) (plasma) ATO (i.v.) 0.02-0.04 0.1-0.3 0.57-1.31 0.03-0.07 mg/ml mg/kg mg/L mg/L ATO (oral) 1.25 0.13 0.57-1.31 0.03-0.07 mg/ml mg/kg mg/L mg/L As2S2 (oral) Solid 2.80 0.57-1.31 0.03-0.07 mg/kg mg/L mg/L As2S3 (oral) Solid 3.20 0.57-1.31 0.03-0.07 L mg/kg mg/L mg/ As2S5 (oral) Solid 4.05 0.57-1.31 0.03-0.07 mg/kg mg/L mg/L As4S4 (oral) Solid 2.80 0.57-1.31 0.03-0.07 mg/kg mg/L mg/L

    REFERENCES

    [0268] The following publications, references, patents and patent applications are hereby incorporated by reference in their entireties. [0269] Alexandrova, E. M., Yallowitz, A. R., Li, D., Xu, S., Schulz, R., Proia, D. A., Lozano, G., Dobbelstein, M., and Moll, U. M. (2015). Improving survival by exploiting tumour dependence on stabilized mutant p53 for treatment. Nature 523, 352-356. [0270] Aryee, D. N., Niedan, S., Ban, J., Schwentner, R., Muehlbacher, K., Kauer, M., Kofler, R., and Kovar, H. (2013). Variability in functional p53 reactivation by PRIMA-1(Met)/APR-246 in Ewing sarcoma. British journal of cancer 109, 2696-2704. [0271] Basse, N., Kaar, J. L., Settanni, G., Joerger, A. C., Rutherford, T. J., and Fersht, A. R. (2010). Toward the rational design of p53-stabilizing drugs: probing the surface of the oncogenic Y220C mutant. Chemistry & biology 17, 46-56. [0272] Bauer, M. R., Joerger, A. C., and Fersht, A. R. (2016). 2-Sulfonylpyrimidines: Mild alkylating agents with anticancer activity toward p53-compromised cells. Proceedings of the National Academy of Sciences of the United States of America 113, E5271-5280. [0273] Boeckler, F. M., Joerger, A. C., Jaggi, G., Rutherford, T. J., Veprintsev, D. B., and Fersht, A. R. (2008). Targeted rescue of a destabilized mutant of p53 by an in silico screened drug. Proceedings of the National Academy of Sciences of the United States of America 105, 10360-10365. [0274] Bullock, A. N, and Fersht, A. R. (2001). Rescuing the function of mutant p53. Nature reviews Cancer 1, 68-76. [0275] Bullock, A. N, Henckel, J., DeDecker, B. S., Johnson, C. M., Nikolova, P. V., Proctor, M. R., Lane, D. P., and Fersht, A. R. (1997). Thermodynamic stability of wild-type and mutant p53 core domain. Proceedings of the National Academy of Sciences of the United States of America 94,14338-14342. [0276] Bullock, A. N, Henckel, J., and Fersht, A. R. (2000). Quantitative analysis of residual folding and DNA binding in mutant p53 core domain: definition of mutant states for rescue in cancer therapy. Oncogene 19, 1245-1256. [0277] Bykov, V. J., Issaeva, N., Shilov, A., Hultcrantz, M., Pugacheva, E., Chumakov, P., Bergman, J., Wiman, K. G., and Selivanova, G. (2002). Restoration of the tumor suppressor function to mutant p53 by a low-molecular-weight compound. Nature medicine 8, 282-288. [0278] Cancer Genome Atlas Research, N., Ley, T. J., Miller, C., Ding, L., Raphael, B. J., Mungall, A. J., Robertson, A., Hoadley, K., Triche, T. J., Jr., Laird, P. W., et al. (2013). Genomic and epigenomic landscapes of adult de novo acute myeloid leukemia. The New England journal of medicine 368, 2059-2074. [0279] Demma, M., Maxwell, E., Ramos, R., Liang, L., Li, C., Hesk, D., Rossman, R., Mallams, A., Doll, R., Liu, M., et al. (2010). SCH529074, a small molecule activator of mutant p53, which binds p53 DNA binding domain (DBD), restores growth-suppressive function to mutant p53 and interrupts HDM2-mediated ubiquitination of wild type p53. The Journal of biological chemistry 285, 10198-10212. [0280] Demma, M. J., Wong, S., Maxwell, E., and Dasmahapatra, B. (2004). CP-31398 restores DNA-binding activity to mutant p53 in vitro but does not affect p53 homologs p63 and p73. The Journal of biological chemistry 279, 45887-45896. [0281] Dolgin, E. (2017). The most popular genes in the human genome. Nature 551, 427-431. [0282] Donoghue, N., Yam, P. T., Jiang, X. M., and Hogg, P. J. (2000). Presence of closely spaced protein thiols on the surface of mammalian cells. Protein science: a publication of the Protein Society 9, 2436-2445. [0283] Feldser, D. M., Kostova, K. K., Winslow, M. M., Taylor, S. E., Cashman, C., Whittaker, C. A., Sanchez-Rivera, F. J., Resnick, R., Bronson, R., Hemann, M. T., et al. (2010). Stage-specific sensitivity to p53 restoration during lung cancer progression. Nature 468, 572-575. [0284] Fogal, V., Hsieh, J. K., Royer, C., Zhong, S., and Lu, X. (2005). Cell cycle-dependent nuclear retention of p53 by E2F1 requires phosphorylation of p53 at Ser315. The EMBO journal 24, 2768-2782. [0285] Foster, B. A., Coffey, H. A., Morin, M. J., and Rastinejad, F. (1999). Pharmacological rescue of mutant p53 conformation and function. Science 286, 2507-2510. [0286] Freed-Pastor, W. A., and Prives, C. (2012). Mutant p53: one name, many proteins. Genes & development 26, 1268-1286. [0287] Gao, J., Aksoy, B. A., Dogrusoz, U., Dresdner, G., Gross, B., Sumer, S. O., Sun, Y., Jacobsen, A., Sinha, R., Larsson, E., et al. Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortal. Sci Signal 6, p11. [0288] Gillotin, S., Yap, D., and Lu, X. (2010). Mutation at Ser392 specifically sensitizes mutant p53H175 to mdm2-mediated degradation. Cell cycle 9, 1390-1398. [0289] Grellety, T., Laroche-Clary, A., Chaire, V., Lagarde, P., Chibon, F., Neuville, A., and Italiano, A. (2015). PRIMA-1(MET) induces death in soft-tissue sarcomas cell independent of p53. BMC cancer 15, 684. [0290] Heredia-Moya, J., and Kirk, K. L. (2008). An improved synthesis of arsenic-biotin conjugates. Bioorganic & medicinal chemistry 16, 5743-5746. [0291] Hu, J., Liu, Y. F., Wu, C. F., Xu, F., Shen, Z. X., Zhu, Y. M., Li, J. M., Tang, W., Zhao, W. L., Wu, W., et al. (2009). Long-term efficacy and safety of all-trans retinoic acid/arsenic trioxide-based therapy in newly diagnosed acute promyelocytic leukemia. Proceedings of the National Academy of Sciences of the United States of America 106, 3342-3347. [0292] Joerger, A. C., and Fersht, A. R. (2007). Structure-function-rescue: the diverse nature of common p53 cancer mutants. Oncogene 26, 2226-2242. [0293] Joerger, A. C., and Fersht, A. R. (2016). The p53 Pathway-Origins, Inactivation in Cancer, and Emerging Therapeutic Approaches. Annual review of biochemistry 85, 375-404. [0294] Kandoth, C., McLellan, M. D., Vandin, F., Ye, K., Niu, B., Lu, C., Xie, M., Zhang, Q., McMichael, J. F., Wyczalkowski, M. A., et al. (2013). Mutational landscape and significance across 12 major cancer types. Nature 502, 333-339. [0295] Khoo, K. H., Verma, C. S., and Lane, D. P. (2014). Drugging the p53 pathway: understanding the route to clinical efficacy. Nature reviews Drug discovery 13, 217-236. [0296] Lambert, J. M., Gorzov, P., Veprintsev, D. B., Soderqvist, M., Segerback, D., Bergman, J., Fersht, A. R., Hainaut, P., Wiman, K. G., and Bykov, V. J. (2009). PRIMA-1 reactivates mutant p53 by covalent binding to the core domain. Cancer cell 15, 376-388. [0297] Li, D., Marchenko, N. D., and Moll, U. M. (2011). SAHA shows preferential cytotoxicity in mutant p53 cancer cells by destabilizing mutant p53 through inhibition of the HDAC6-Hsp90 chaperone axis. Cell death and differentiation 18, 1904-1913. [0298] Lindsley, R. C., Saber, W., Mar, B. G., Redd, R., Wang, T., Haagenson, M. D., Grauman, P. V., Hu, Z. H., Spellman, S. R., Lee, S. J., et al. (2017). Prognostic Mutations in Myelodysplastic Syndrome after Stem-Cell Transplantation. The New England journal of medicine 376, 536-547. [0299] Liu, X., Wilcken, R., Joerger, A. C., Chuckowree, I. S., Amin, J., Spencer, J., and Fersht, A. R. (2013). Small molecule induced reactivation of mutant p53 in cancer cells. Nucleic acids research 41, 6034-6044. [0300] Lo-Coco, F., Avvisati, G., Vignetti, M., Thiede, C., Orlando, S. M., lacobelli, S., Ferrara, F., Fazi, P., Cicconi, L., Di Bona, E., et al. (2013). Retinoic acid and arsenic trioxide for acute promyelocytic leukemia. The New England journal of medicine 369, 111-121. [0301] Lu, M., Breyssens, H., Salter, V., Zhong, S., Hu, Y., Baer, C., Ratnayaka, I., Sullivan, A., Brown, N. R., Endicott, J., et al. (2013). Restoring p53 function in human melanoma cells by inhibiting MDM2 and cyclin B1/CDK1-phosphorylated nuclear iASPP. Cancer cell 23, 618-633. [0302] Lu, M., Muers, M. R., and Lu, X. (2016a). Introducing STRaNDs: shuttling transcriptional regulators that are non-DNA binding. Nature reviews Molecular cell biology 17, 523-532. [0303] Lu, M., Breyssens, H., Salter, V., Zhong, S., Hu, Y., Baer, C., Ratnayaka, I., Sullivan, A., Brown, N. R., Endicott, J., et al. (2013). Restoring p53 function in human melanoma cells by inhibiting MDM2 and cyclin B1/CDK1-phosphorylated nuclear iASPP. Cancer cell 23, 618-633. [0304] Lu, M., Zak, J., Chen, S., Sanchez-Pulido, L., Severson, D. T., Endicott, J., Ponting, C. P., Schofield, C. J., and Lu, X. (2014). A code for RanGDP binding in ankyrin repeats defines a nuclear import pathway. Cell 157, 1130-1145. [0305] Lu, T., Zou, Y., Xu, G., Potter, J. A., Taylor, G. L., Duan, Q., Yang, Q., Xiong, H., Qiu, H., Ye, D., et al. (2016b). PRIMA-1Met suppresses colorectal cancer independent of p53 by targeting MEK. Oncotarget. [0306] Lukashchuk, N., and Vousden, K. H. (2007). Ubiquitination and degradation of mutant p53. Molecular and cellular biology 27, 8284-8295. Martins, C. P., Brown-Swigart, L., and Evan, G. I. (2006). Modeling the therapeutic efficacy of p53 restoration in tumors. Cell 127, 1323-1334. [0307] Muller, P. A., Caswell, P. T., Doyle, B., Iwanicki, M. P., Tan, E. H., Karim, S., Lukashchuk, N., Gillespie, D. A., Ludwig, R. L., Gosselin, P., et al. (2009). Mutant p53 drives invasion by promoting integrin recycling. Cell 139, 1327-1341. [0308] Muller, P. A., and Vousden, K. H. (2013). p53 mutations in cancer. Nature cell biology 15, 2-8. [0309] Muller, P. A., and Vousden, K. H. (2014). Mutant p53 in cancer: new functions and therapeutic opportunities. Cancer cell 25, 304-317. [0310] Parrales, A., Ranjan, A., lyer, S. V., Padhye, S., Weir, S. J., Roy, A., and Iwakuma, T. (2016). DNAJA1 controls the fate of misfolded mutant p53 through the mevalonate pathway. Nature cell biology 18, 1233-1243. [0311] Patyka, M., Sharifi, Z., Petrecca, K., Mansure, J., Jean-Claude, B., and Sabri, S. (2016). Sensitivity to PRIMA-1MET is associated with decreased MGMT in human glioblastoma cells and glioblastoma stem cells irrespective of p53 status. Oncotarget. [0312] Puca, R., Nardinocchi, L., Porru, M., Simon, A. J., Rechavi, G., Leonetti, C., Givol, D., and D'Orazi, G. (2011). Restoring p53 active conformation by zinc increases the response of mutant p53 tumor cells to anticancer drugs. Cell cycle 10, 1679-1689. [0313] Riley, T., Sontag, E., Chen, P., and Levine, A. (2008). Transcriptional control of human p53-regulated genes. Nature reviews Molecular cell biology 9, 402-412. [0314] Rippin, T. M., Bykov, V. J., Freund, S. M., Selivanova, G., Wiman, K. G., and Fersht, A. R. (2002). Characterization of the p53-rescue drug CP-31398 in vitro and in living cells. Oncogene 21, 2119-2129. [0315] Shoemaker, R. H. (2006). The NCI60 human tumour cell line anticancer drug screen. Nature reviews Cancer 6, 813-823. [0316] Soragni, A., Janzen, D. M., Johnson, L. M., Lindgren, A. G., Thai-Quynh Nguyen, A., Tiourin, E., Soriaga, A. B., Lu, J., Jiang, L., Faull, K. F., et al. (2016). A Designed Inhibitor of p53 Aggregation Rescues p53 Tumor Suppression in Ovarian Carcinomas. Cancer cell 29, 90-103. [0317] Tessoulin, B., Descamps, G., Moreau, P., Maiga, S., Lode, L., Godon, C., Marionneau-Lambot, S., Oullier, T., Le Gouill, S., Amiot, M., et al. (2014). PRIMA-1Met induces myeloma cell death independent of p53 by impairing the GSH/ROS balance. Blood 124, 1626-1636. [0318] Vassilev, L. T., Vu, B. T., Graves, B., Carvajal, D., Podlaski, F., Filipovic, Z., Kong, N., Kammlott, U., Lukacs, C., Klein, C., et al. (2004). In vivo activation of the p53 pathway by small-molecule antagonists of MDM2. Science 303, 844-848. [0319] Ventura, A., Kirsch, D. G., McLaughlin, M. E., Tuveson, D. A., Grimm, J., Lintault, L., Newman, J., Reczek, E. E., Weissleder, R., and Jacks, T. (2007). Restoration of p53 function leads to tumour regression in vivo. Nature 445, 661-665. [0320] Vogelstein, B., Lane, D., and Levine, A. J. (2000). Surfing the p53 network. Nature 408, 307-310. [0321] Wang, Y., Suh, Y. A., Fuller, M. Y., Jackson, J. G., Xiong, S., Terzian, T., Quintas-Cardama, A., Bankson, J. A., El-Naggar, A. K., and Lozano, G. (2011). Restoring expression of wild-type p53 suppresses tumor growth but does not cause tumor regression in mice with a p53 missense mutation. The Journal of clinical investigation 121, 893-904. [0322] Wassman, C. D., Baronio, R., Demir, O., Wallentine, B. D., Chen, C. K., Hall, L. V., Salehi, F., Lin, D. W., Chung, B. P., Hatfield, G. W., et al. (2013). Computational identification of a transiently open L1/S3 pocket for reactivation of mutant p53. Nature communications 4, 1407. [0323] Weinmann, L., Wischhusen, J., Demma, M. J., Naumann, U., Roth, P., Dasmahapatra, B., and Weller, M. (2008). A novel p53 rescue compound induces p53-dependent growth arrest and sensitises glioma cells to Apo2L/TRAIL-induced apoptosis. Cell death and differentiation 15, 718-729. [0324] Xue, W., Zender, L., Miething, C., Dickins, R. A., Hernando, E., Krizhanovsky, V., Cordon-Cardo, C., and Lowe, S. W. (2007). Senescence and tumour clearance is triggered by p53 restoration in murine liver carcinomas. Nature 445, 656-660. [0325] Zhang, T. D., Chen, G. Q., Wang, Z. G., Wang, Z. Y., Chen, S. J., and Chen, Z. (2001). Arsenic trioxide, a therapeutic agent for APL. Oncogene 20, 7146-7153. [0326] Zhang, X. W., Yan, X. J., Zhou, Z. R., Yang, F. F., Wu, Z. Y., Sun, H. B., Liang, W. X., Song, A. X., Lallemand-Breitenbach, V., Jeanne, M., et al. (2010). Arsenic trioxide controls the fate of the PML-RARalpha oncoprotein by directly binding PML. Science 328, 240-243. [0327] Zhu, J., Chen, Z., Lallemand-Breitenbach, V., and de The, H. (2002). How acute promyelocytic leukaemia revived arsenic. Nature reviews Cancer 2, 705-713. [0328] Chang CK, Zhao YS, Xu F, Guo J, Zhang Z, He Q, Wu D, Wu LY, Su JY, Song LX, Xiao C, Li X (2016). TP53 mutations predict decitabine-induced complete responses in patients with myelodysplastic syndromes. Br. J. Haematol. 176, 600-608.