Antibody-mediated neutralization of ebolaviruses

11054423 ยท 2021-07-06

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure is directed to antibodies binding to and neutralizing ebolavirus and methods for use thereof. The present disclosure is directed to a method of detecting an ebolavirus infection in a subject comprising (a) contacting a sample from said subject with an antibody or antibody fragment having clone-paired heavy and light chain CDR sequences from Table 2, or an antibody fragment thereof; and (b) detecting ebolavirus glycoprotein in said sample by binding of said antibody or antibody fragment to antigen in said sample. In still further embodiments, the present disclosure concerns immunodetection kits for use with the iminunodetection methods described above.

Claims

1. A method of treating a subject infected with Ebolavirus, or reducing the likelihood of infection of a subject at risk of contracting Ebolavirus, comprising delivering to said subject an antibody specifically binding ebolavirus glycoprotein or an antigen binding fragment thereof having heavy chain CDR1, CDR2 and CDR3 sequences of SEQ ID NOS: 91, 92 and 93, and light chain CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 347, 348 and 349.

2. The method of claim 1, wherein said antibody or antibody fragment is encoded by light chain variable sequence encoding SEQ ID NO: 227 and heavy chain variable sequence encoding SEQ ID NO: 226.

3. The method of claim 1, wherein said antibody or antibody fragment comprises light chain variable sequence of SEQ ID NO: 227 and heavy chain variable sequence encoding SEQ ID NO: 226.

4. The method of claim 1, wherein said antibody or antibody fragment comprises (a) heavy chain CDR1, CDR2, and CDR3 sequences of SEQ ID NOS: 91, 92 and 93, and light chain CDR1, CDR2, and CDR3 sequences of SEQ ID NO: 347, 348 and 349 and (b) light chain variable sequence having 70%, 80%, 90% or 95% identity to SEQ ID NO: 227 and having 70%, 80%, 90%, or 95% identity to heavy chain variable sequence encoding SEQ ID NO: 226.

5. A hybridoma or engineered cell encoding an antibody specifically binding ebolavirus glycoprotein or an antigen binding fragment thereof, wherein the antibody or antibody fragment comprises heavy chain CDR1, CDR2, and CDR3 sequences of SEQ ID NOS: 91, 92 and 93, and light chain CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 347, 348, and 349.

6. The hybridoma or engineered cell of claim 5, wherein said antibody or antibody fragment is encoded by light chain variable sequence encoding SEQ ID NO: 227 and heavy chain variable sequence encoding SEQ ID NO: 226.

7. The hybridoma or engineered cell of claim 5, wherein said antibody or antibody fragment comprises light chain variable sequence of SEQ ID NO: 227 and heavy chain variable sequence encoding SEQ ID NO: 226.

8. The hybridoma or engineered cell of claim 5, wherein said antibody or antibody fragment comprises (a) heavy chain CDR sequences of SEQ ID NOS: 91, 92 and 93, and light chain CDR sequences of SEQ ID NO: 347, 348, and 349 and (b) light chain variable sequence having 70%, 80%, 90%, or 95% identity to SEQ ID NO: 227 and having 70%, 80%, 90%, or 95% identity to heavy chain variable sequence encoding SEQ ID NO: 226.

9. The hybridoma or engineered cell of claim 5, wherein the antibody fragment is a recombinant ScFv (single chain fragment variable) antibody, Fab fragment, F(ab).sub.2 fragment, or Fv fragment, or incorporated as scFv or Fab in a diabody.

10. The hybridoma or engineered cell of claim 5, wherein said antibody is a chimeric antibody.

11. The hybridoma or engineered cell of claim 5, wherein said antibody is an IgG.

12. The hybridoma or engineered cell of claim 5, wherein said antibody or antibody fragment further comprises a cell penetrating peptide or is an intrabody.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure. The disclosure may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.

(2) FIGS. 1A-D. Cross-reactive B cell responses in filovirus immune donors. Supernatants from EBV-transformed PBMC samples isolated from survivors were screened in ELISA binding assays using BDBV, EBOV or MARV GPs (FIGS. 1A-C). Results for four BDBV survivors (FIG. 1A), one EBOV survivor (FIG. 1B) or one MARV survivor (FIG. 1C) are shown. Height of the bars indicates OD.sub.405 nm values in ELISA binding to full-length extracellular domain of GP of the indicated virus species. Reactive supernates are color-coded based on the cross-reactivity pattern: species-specific cell lines are highlighted in black; cross-reactive lines to 2 or 3 species are shown in yellow or blue, respectively. Previous work has shown that the amino acid sequence of GP differs between BDBV and EBOV by over 34%, and between BDBV and MARV by over 72%. (FIG. 1D) Percentages of lines secreting antibodies specific to BDBV, EBOV or MARV GPs, or cross-reactive antibodies to BDBV and EBOV (designated BDBV/EBOV) or BDBV, EBOV and MARV (designated BDBV/EBOV/MARV) are shown. Increasing intensity of the pink cell fill color corresponds to increasing reactivity for indicated virus. See also FIG. 8.

(3) FIGS. 2A-D. Cross-neutralizing antibodies from survivors of natural BDBV infection. (FIG. 2A) Heat map showing the binding of BDBV mAbs to a panel of filovirus GPs. The EC.sub.50 value for each GP-mAb combination is shown, with dark red, orange, yellow, or white shading indicating high, intermediate, low, or no detectable binding, respectively. EC.sub.50 values greater than 10,000 ng/mL are indicated by the >symbol. NAb names are highlighted in red. (FIG. 2B) Heat map showing the neutralization potency of BDBV GP-specific mAbs against BDBV. The IC.sub.50 value for each virus-mAb combination is shown. IC.sub.50 values greater than 10,000 ng/mL are indicated by the >symbol. Neutralization assays were performed in triplicate. (FIG. 2C) Binding of representative mAbs from six distinct binding groups to the filovirus GP. (FIG. 2D) Neutralization activity of representative neutralizing mAbs from three binding groups against BDBV, EBOV or SUDV. Error bars represent the SE of the experiment, performed in triplicate. See also FIGS. 9-11.

(4) FIG. 3. BDBV-neutralizing antibodies target at least two distinct antigenic regions of the GP surface. Data from competition-binding assays using non-neutralizing mAbs from binding Group 1A (white background) and neutralizing mAbs from binding Groups 1A, 1B, 3A or 3B (pink background). Numbers indicate the percent binding of second mAb in the presence of the first mAb, compared to binding of un-competed second mAb. MAbs were judged to compete for the same site if maximum binding of second mAb was reduced to <30% of its un-competed binding (black boxes with white numbers). MAbs were considered non-competing if maximum binding of second mAb was >70% of its un-competed binding (white boxes with red numbers). Grey boxes with black numbers indicate an intermediate phenotype (competition resulted in between 30 and 70% of un-competed binding). Blue, purple, and green dashed lines indicate what appear to be major competition groups; the blue and purple groups overlap substantially but not completely.

(5) FIGS. 4A-E. BDBV-neutralizing antibodies bind to the glycan cap or base region of GP. (FIG. 4A) Shown are negative-stain electron microscopy reference-free 2D class averages of Group 1A antibodies that bind both the glycan cap of GP and sGP, and Group 1B antibodies that bind the glycan cap of GP but not sGP. BDBV GP or GPmuc was used to generate complexes. (FIG. 4B) 3D reconstructions of glycan cap binders from Groups 1A and 1B reveal that these antibodies bind the glycan cap at overlapping but distinct epitopes. Top (left) and side (right) views of the complexes are shown. (FIG. 4C) Reference free 2D class averages of Group 1B antibodies (left) reveals that these antibodies bind an epitope below the base of GP that is flexible. In the middle image, GP is colored yellow and each Fab colored green. The right-hand panel illustrates a superimposition of crystal structures of SUDV GPmuc (PDB 3VEO) and Fabs (PDB 3CSY) to demonstrate how Fabs may bind to GP. (FIG. 4D) The composite model delineates the epitopes of the glycan cap mAbs in Group 1A or 1B. Side (above) and top (below) views are shown. (FIG. 4E) Docking a crystal structure of SUDV GPmuc (PDB 3VEO) (Bale et al., 2012), which contains a more complete model of the glycan cap region targeted by Group 1A/B mAbs, reveals how Group 1A/B mAbs target a broad region in the GP1 centered on the glycan cap, near the beginning of the mucin-like domains. Group 1B mAbs that target the base likely bind to a loop near the membrane proximal external region (MPER) that is flexible and has not yet been resolved at high resolution. TM=transmembrane region; CT=cytoplasmic tail. See also FIGS. 12A-D.

(6) FIGS. 5A-D. Epitope mapping of Group 3A mAbs using saturation mutagenesis and negative stain electron microscopy. Epitope residues for three nAbs from Group 3A (BDBV270, BDBV289 and BDBV324) were identified as those for which mutation to alanine specifically reduced binding of these antibodies (FIGS. 5A-B). GP residue W275 was common to all three nAbs, while L273 was specific for BDBV324, and Y241 was specific for BDBV289. The mutated residues are shown in space filling forms on a ribbon diagram of the EBOV GP structure, based on PDB 3CSY. (FIG. 5C) Binding values for nAbs and previously isolated mAbs KZ52, 2G4 and 4G7 to library clones with mutations at residues L273, W275 and Y241. The Ab reactivities against each mutant EBOV GP clone were calculated relative to reactivity with wild-type EBOV GP. (FIG. 5D) BDBV289 (brown) binds at the top of the viral GP near the glycan cap region. Complexes are of BDBV antibody Fab fragments bound to BDBV GPTM with side view (top panel) or top view (bottom panel). A representative Fab crystal structure is fit in the Fab density for each reconstruction (from PDBID 3CSY). A monomer of the GP trimer crystal structure (PDBID 3CSY) is also fit in the GP density, with white corresponding to GP1 and black to GP2. Two critical residues for binding by BDBV289 (W275 and Y241, determined using saturation mutagenesis) are highlighted in green. See also FIGS. 13A-B.

(7) FIGS. 6A-C. Survival and clinical signs of EBOV-inoculated mice treated with BDBV mAbs. Groups of 5 mice in each group were injected with individual mAbs by the intraperitoneal route 1 day after EBOV challenge, using 100 g of mAb per treatment. Animals treated with dengue virus-specific human mAb 2D22 served as controls. (FIG. 6A) Kaplan-Meier survival curves. (FIG. 6B) Body weight. (FIG. 6C) Illness score.

(8) FIGS. 7A-B. Survival and clinical signs of EBOV inoculated guinea pigs treated with BDBV mAbs. Groups of 5 guinea pigs per group were injected with individual mAbs by the intraperitoneal route 1 day or 1 and 3 days after EBOV challenge, using 5 mg of individual mAb (FIG. 7A) or 5 mg of the combination of two mAbs per treatment (FIG. 7B), as indicated. Animals treated with dengue virus-specific human mAb 2D22 served as controls. The survival curves are based on morning and evening observations. Mortality in the morning is shown in whole day numbers, in the evening in day values. The body weight and illness scores are shown with one value per day.

(9) FIG. 8. Cross-reactive B cell responses in BDBV immune donors 5 and 6. Related to FIG. 1. Supernatants from EBV-transformed PBMC samples isolated from survivors were screened in ELISA binding assays using BDBV, EBOV or MARV GPs. Height of the bars indicates OD.sub.405 nm values in ELISA binding to full-length extracellular domain of GP of the indicated virus species. Reactive supernates are color-coded based on the cross-reactivity pattern: species-specific cell lines are highlighted in black; cross-reactive lines to 2 or 3 species are shown in yellow or blue, respectively.

(10) FIG. 9. Binding patterns of BDBV GP-specific antibodies from Binding Group 2. (related to FIGS. 2A-D). Antibodies were segregated into six groups based on the binding to Filovirus GPs. Binding was categorized based on the OD.sub.405 values at the highest antibody concentration tested (E.sub.max>0.5) and 50% effective concentration (EC.sub.50<10 g/mL).

(11) FIG. 10. Antibodies from groups 1B, 2B and 3B recognize BDBV GP and BDBV GPmuc but not BDBV sGP in ELISA binding assay (related to FIGS. 2A-B). The binding of selected antibodies to BDBV GP, BDBV GPmuc and BDBV sGP proteins was tested at a single mAb concentration 10 g/mL.

(12) FIG. 11. Neutralization activity of BDBV GP-specific nAbs against BDBV (related to FIGS. 2A-D). Red circles represent percent neutralization relative to control at different antibody concentrations. Logistic curves are indicated by solid lines, and 95% confidence intervals are indicated by dashed lines.

(13) FIGS. 12A-E. Raw data and validation of EM models (related to FIGS. 4A-E). (FIG. 12A) Raw EM micrograph (far left), 2D reference-free class averages (middle left), and an FSC curve with resolution indicated (far right) of BDBV41 in complex with BDBV GPmuc. (FIG. 12B) As in FIG. 12A but of BDBV335 in complex with BDBV GPmuc. (FIG. 12C) As in FIG. 12A, but of BDBV432 in complex with BDBV GPmuc. (FIG. 12D) As in FIG. 12A but of BDBV353 in complex with BDBV GP. (FIG. 12E) As in FIG. 12A, but of BDBV289 in complex with BDBV GP. Refinement package used to generate each reconstruction is indicated on the far left. Scale bar indicates 200 nm.

(14) FIGS. 13A-B. Generation of escape mutant viruses for BDBV41 (related to FIGS. 5A-E). (FIG. 13A) Neutralization activity of BDBV41 against wild-type VSV/BDBV-GP (circles, straight curves), VSV/BDBV-GP #7 (squares, dashed curves), or VSV/BDBV-GP #15 (triangles, dotted curves) escape mutant viruses. (FIG. 13B) Amino acid changes in BDBV41 escape mutant viruses

(15) FIGS. 14A-C. Cross-reactive neutralizing antibodies from BDBV survivors bind a unique region on GP surface. (FIG. 14A) Binding of BDBV223, BDBV317 or BDBV340 to BDBV, EBOV, SUDV GP or sGP. (FIG. 14B) Neutralization activity of BDBV223, BDBV317 or BDBV340 against BDBV, EBOV, or SUDV. (FIG. 14C) Data from competition-binding assays using BDBV223, BDBV317 or BDBV340; antibodies from ZMapp cocktail (c2G4, c4G7 and 13C6) and previously isolated human antibodies KZ52 and BDBV289. Numbers indicate the percent binding of the second mAb in the presence of the first mAb, compared to binding of second mAb alone. MAbs were judged to compete for the same site if maximum binding of the second mAb was reduced to <30% of its un-competed binding (black boxes with white numbers). MAbs were considered non-competing if maximum binding of the second mAb was >70% of its un-competed binding (white boxes with red numbers). Grey boxes with black numbers indicate an intermediate phenotype (between 30 and 70% of un-competed binding).

(16) FIGS. 15A-E. Cross-reactive neutralizing antibodies from BDBV survivors bind near the membrane proximal region of GP. (FIG. 15A) Representative negative stain class averages of antibodies that bind GP2 exclusively in the HR2/MPER region. Complexes are of BDBV Fabs bound to BDBV GPmuc. (FIG. 15B) A class average of BDBV GPmuc bound to BDBV223 demonstrates the location of each component, with the core GP colored blue and the Fabs in green. (FIG. 15C) A class average of c13C6 Fab:c4G7 Fab bound to EBOV GPTM.sup.7 (with c13C6 in dark blue, c4G7 in yellow and GP core in light blue). (FIG. 15D) Overlaying a class average of c13C6 Fab:c4G7 Fab bound to EBOV GPTM.sup.7 (with c13C6 in dark blue, c4G7 in yellow and GP core in light blue) over a class average of BDBV223 Fab bound to BDBV GPmuc (with BDBV223 in green and GP core in light blue), demonstrates that BDBV223 binds significantly lower down on GP, well below the epitope of the c4G7 site of vulnerability at the GP1/GP2 interface. (FIG. 15E) A model of the c13C6 Fab:c4G7 Fab bound to EBOV GPTM (EMDB ID-6152) is shown with the relative location of BDBV223/317/340 Fabs (segmented c4G7 Fabs from the above map placed in the relative location on GP as indicated by class averages). Measurements of the distance from the bottom of the GP core to the mid-point of the Fab in the class averages showed a distance of 60A, which corresponds to the length of the HR2 region previously crystalized as post-fusion GP2 (PDBID 1EBO).

(17) FIGS. 16A-D. Structural and functional analysis of GP residues important for mAb cross-reactivity and neutralization. (FIG. 16A) Sequence alignment of GP2 from BDBV (SEQ ID NO: 344), EBOV (SEQ ID NO: 345) and SUDV (SEQ ID NO: 346). The numbers above the sequence correspond to the amino acid position in GP. Amino acids identical to BDBV are indicated by dots. Color-coded shapes indicate the position of residues at which alanine substitutions disrupt mAb binding, as determined by alanine-scanning mutagenesis. BDBV1, BDBV2, EBOV2 or SUDV2 peptide sequences analyzed are indicated by grey, black, blue or purple lines, respectively. (FIG. 16B) Locations of critical residues for BDBV317 and c4G7 binding are displayed on a model of EBOV GP. BDBV317 critical residues are highlighted in green and c4G7 critical residues are highlighted in yellow. (FIG. 16C) Binding of BDBV223, BDBV317 or BDBV340 to BDBV1, BDBV2, EBOV2 or SUDV2 peptides. (FIG. 16D) Binding of BDBV223, BDBV317 or BDBV340 to members of a panel of chimeric BDBV peptides (BDBV3=SEQ ID NO: 107).

(18) FIG. 17. Cross-recognition of antibodies from survivors of natural EBOV infection. Heat map showing the binding of EBOV mAbs to a panel of Filovirus GPs. The EC.sub.50 value for each GP-mAb combination is shown, with dark red, orange, yellow, or white shading indicating high, intermediate, low, or no detectable binding, respectively. EC.sub.50 values greater than 10,000 ng/mL are indicated by the >symbol. NAb names are highlighted in red.

(19) FIGS. 18A-C. Survival and clinical signs of EBOV-inoculated mice treated with EBOV mAbs. Groups of 5 mice in each group were injected with individual mAbs by the intraperitoneal route 1 day after EBOV challenge, using 100 g of mAb per treatment. Animals treated with dengue virus-specific human mAb 2D22 served as controls. (FIG. 18A) Kaplan-Meier survival curves. (FIG. 18B) Body weight. (FIG. 18C) Illness score. IC.sub.50 values in neut test are shown.

(20) FIGS. 19A-C. Survival and clinical signs of EBOV-inoculated mice treated with EBOV mAbs. Groups of 5 mice in each group were injected with individual mAbs by the intraperitoneal route 1 day after EBOV challenge, using 100 g of mAb per treatment. (FIG. 19A) Kaplan-Meier survival curves. (FIG. 19B) Body weight. (FIG. 19C) Illness score. IC.sub.50 values in neut test are shown.

(21) FIG. 20. Epitope mapping for representative EBOV mAbs by alanine scanning mutagenesis of EBOV GP.

DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS

(22) In the work reported here, the inventors isolated a large panel of human binding nAbs from B cells of human survivors of severe infection with Ebola Bundibugyo species or Ebola Zaire (the latter also called 2014 Makona strain, or Guinea strain, now properly termed Ebolavirus ebola) and used these Abs to define the molecular basis of MARV neutralization by human Abs. Remarkably, several of the Abs bound to GPs from diverse species of Ebola virus and some neutralized live viruses from diverse species. Single-particle EM structures of Ab-GP complexes revealed that some of the neutralizing Abs bound to EBOV GP near the viral membrane in the membrane proximal external region (MPER). The antibodies reported here are the first human monoclonal antibodies to these regions. Additional antibodies were shown to bind at the top of the glycoprotein, in the glycan cap region. The inventors isolated antibodies that recognize distinct patterns of glycoprotein. Some of the monoclonal antibodies bind to full-length and mucin deleted forms of glycoprotein, while avoiding potential deleterious binding to the secreted form of glycoprotein. They also found monoclonal antibodies that bind to all three forms of glycoprotein, full-length, mucin-deleted, and secreted GP. These and other aspects of the disclosure are described in detail below.

I. EBOLAVIRUS

(23) The genus Ebolavirus is a virological taxon included in the family Filoviridae, order Mononegavirales. The members of this genus are called ebolaviruses. The five known virus species are named for the region where each was originally identified: Bundibugyo ebolavirus, Reston ebolavirus, Sudan ebolavirus, nil Forest ebolavirus (originally Cte d'Ivoire ebolavirus), and Zaire ebolavirus.

(24) The Ebola virus (EBOV) protein VP24 inhibits type I and II interferon (IFN) signaling by binding to NPI-1 subfamily karyopherin (KPNA) nuclear import proteins, preventing their interaction with tyrosine-phosphorylated STAT1 (phospho-STAT1). This inhibits phospho-STAT1 nuclear import. A biochemical screen now identifies heterogeneous nuclear ribonuclear protein complex C1/C2 (hnRNP C1/C2) nuclear import as an additional target of VP24. Co-immunoprecipitation studies demonstrate that hnRNP C1/C2 interacts with multiple KPNA family members, including KPNA1. Interaction with hnRNP C1/C2 occurs through the same KPNA1 C-terminal region (amino acids 424-457) that binds VP24 and phospho-STAT1. The ability of hnRNP C1/C2 to bind KPNA1 is diminished in the presence of VP24, and cells transiently expressing VP24 redistribute hnRNP C1/C2 from the nucleus to the cytoplasm. These data further define the mechanism of hnRNP C1/C2 nuclear import and demonstrate that the impact of EBOV VP24 on nuclear import extends beyond STAT1.

(25) Ebolaviruses were first described after outbreaks of EVD in southern Sudan in June 1976 and in Zaire in August 1976. The name Ebolavirus is derived from the Ebola River in Zaire (now the Democratic Republic of the Congo), the location of the 1976 outbreak, and the taxonomic suffix -virus (denoting a viral genus). This genus was introduced in 1998 as the Ebola-like viruses. In 2002 the name was changed to Ebolavirus and in 2010, the genus was emended. Ebolaviruses are closely related to marburgviruses.

(26) Researchers have now found evidence of Ebola infection in three species of fruit bats. The bats show no symptoms of the disease, indicating that they might be spreading it. Researchers found that bats of three speciesHypsignathus monstrosus, Epomops franqueti, and Myonycteris torquatahad either genetic material from the Ebola virus, known as RNA sequences, or evidence of an immune response to the disease. The bats showed no symptoms themselves. Other hosts are possible as well.

(27) A. Taxonomy

(28) A virus of the family Filoviridae is a member of the genus Ebolavirus if its genome has several gene overlaps, its fourth gene (GP) encodes four proteins (sGP, ssGP, -peptide, and GP1,2) using co-transcriptional editing to express ssGP and GP1,2 and proteolytic cleavage to express sGP and -peptide, peak infectivity of its virions is associated with particles 805 nm in length, its genome differs from that of Marburg virus by 50% and from that of Ebola virus by <50% at the nucleotide level, its virions show almost no antigenic cross reactivity with Marburg virions.

(29) The genera Ebolavirus and Marburgvirus were originally classified as the species of the now-obsolete Filovirus genus. In March 1998, the Vertebrate Virus Subcommittee proposed in the International Committee on Taxonomy of Viruses (ICTV) to change the Filovirus genus to the Filoviridae family with two specific genera: Ebola-like viruses and Marburg-like viruses. This proposal was implemented in Washington, D.C., as of April 2001 and in Paris as of July 2002. In 2000, another proposal was made in Washington, D.C., to change the -like viruses to -virus resulting in today's Ebolavirus and Marburgvirus.

(30) Each species of the genus Ebolavirus has one member virus, and four of these cause Ebola virus disease (EVD) in humans, a type of hemorrhagic fever having a very high case fatality rate; the fifth, Reston virus, has caused EVD in other primates. Zaire ebolavirus is the type species (reference or example species) for Ebolavirus, and has the highest mortality rate of the ebolaviruses, and is also responsible for the largest number of outbreaks of the five known members of the genus, including the 1976 Zaire outbreak and the outbreak with the most deaths (2014). The five characterized species of the Ebolavirus genus are:

(31) Zaire Ebolavirus (ZEBOV).

(32) Also known simply as the Zaire virus, ZEBOV has the highest case-fatality rate, up to 90% in some epidemics, with an average case fatality rate of approximately 83% over 27 years. There have been more outbreaks of Zaire ebolavirus than of any other species. The first outbreak took place on 26 Aug. 1976 in Yambuku. Mabalo Lokela, a 44-year-old schoolteacher, became the first recorded case. The symptoms resembled malaria, and subsequent patients received quinine. Transmission has been attributed to reuse of unsterilized needles and close personal contact. The virus is responsible for the 2014 West Africa Ebola virus outbreak, with the largest number of deaths to date.

(33) Sudan Ebolavirus (SUDV).

(34) Like ZEBOV, SUDV emerged in 1976; it was at first assumed to be identical with ZEBOV. SUDV is believed to have broken out first amongst cotton factory workers in Nzara, Sudan (now in South Sudan), in June 1976, with the first case reported as a worker exposed to a potential natural reservoir. Scientists tested local animals and insects in response to this; however, none tested positive for the virus. The carrier is still unknown. The lack of barrier nursing (or bedside isolation) facilitated the spread of the disease. The average fatality rates for SUDV were 54% in 1976, 68% in 1979, and 53% in 2000 and 2001.

(35) Reston Ebolavirus (RESTV).

(36) This virus was discovered during an outbreak of simian hemorrhagic fever virus (SHFV) in crab-eating macaques from Hazleton Laboratories (now Covance) in 1989. Since the initial outbreak in Reston, Va., it has since been found in nonhuman primates in Pennsylvania, Texas, and Siena, Italy. In each case, the affected animals had been imported from a facility in the Philippines, where the virus has also infected pigs. Despite its status as a Level-4 organism and its apparent pathogenicity in monkeys, RESTV did not cause disease in exposed human laboratory workers.

(37) Ta Forest Ebolavirus (TAFV).

(38) Formerly known as Cte d'Ivoire ebolavirus, it was first discovered among chimpanzees from the Tai Forest in Cte d'Ivoire, Africa, in 1994. Necropsies showed blood within the heart to be brown; no obvious marks were seen on the organs; and one necropsy displayed lungs filled with blood. Studies of tissues taken from the chimpanzees showed results similar to human cases during the 1976 Ebola outbreaks in Zaire and Sudan. As more dead chimpanzees were discovered, many tested positive for Ebola using molecular techniques. The source of the virus was believed to be the meat of infected western red colobus monkeys (Procolubus badius) upon which the chimpanzees preyed. One of the scientists performing the necropsies on the infected chimpanzees contracted Ebola. She developed symptoms similar to those of dengue fever approximately a week after the necropsy, and was transported to Switzerland for treatment. She was discharged from hospital after two weeks and had fully recovered six weeks after the infection.

(39) Bundibugyo Ebolavirus (BDBV).

(40) On Nov. 24, 2007, the Uganda Ministry of Health confirmed an outbreak of Ebola in the Bundibugyo District. After confirmation of samples tested by the United States National Reference Laboratories and the CDC, the World Health Organization confirmed the presence of the new species. On 20 Feb. 2008, the Uganda Ministry officially announced the end of the epidemic in Bundibugyo, with the last infected person discharged on 8 Jan. 2008. An epidemiological study conducted by WHO and Uganda Ministry of Health scientists determined there were 116 confirmed and probable cases the new Ebola species, and that the outbreak had a mortality rate of 34% (39 deaths).

(41) B. Ebola Virus Disease

(42) Symptoms of Ebola Virus Disease.

(43) The incubation period from infection with the virus to onset of symptoms is 2 to 21 days. Humans are not infectious until they develop symptoms. First symptoms are the sudden onset of fever fatigue, muscle pain, headache and sore throat. This is followed by vomiting, diarrhea, rash, symptoms of impaired kidney and liver function, and in some cases, both internal and external bleeding (e.g., oozing from the gums, blood in the stools). Laboratory findings include low white blood cell and platelet counts and elevated liver enzymes.

(44) Diagnosis.

(45) It can be difficult to distinguish ebolavirus from other infectious diseases such as malaria, typhoid fever and meningitis. Confirmation that symptoms are caused by ebolavirus infection are made using antibody-capture ELISA, antigen-capture detection tests, serum neutralization test, RT-PCR assay, electron microscopy, and virus isolation by cell culture. Samples from patients are an extreme biohazard risk; laboratory testing on non-inactivated samples should be conducted under maximum biological containment conditions.

(46) Treatment and Vaccines.

(47) Supportive care-rehydration with oral or intravenous fluidsand treatment of specific symptoms, improves survival. There is as yet no proven treatment available for ebolavirus. However, a range of potential treatments including blood products, immune therapies and drug therapies are currently being evaluated. No licensed vaccines are available yet, but 2 potential vaccines are undergoing human safety testing.

(48) Prevention and Control.

(49) Good outbreak control relies on applying a package of interventions, namely case management, surveillance and contact tracing, a good laboratory service, safe burials and social mobilization. Community engagement is key to successfully controlling outbreaks. Raising awareness of risk factors for Ebola infection and protective measures that individuals can take is an effective way to reduce human transmission. Risk reduction messaging should focus on several factors: reducing the risk of wildlife-to-human transmission from contact with infected fruit bats or monkeys/apes and the consumption of their raw meat; reducing the risk of human-to-human transmission from direct or close contact with people with Ebola symptoms, particularly with their bodily fluids; outbreak containment measures including prompt and safe burial of the dead; identifying people who may have been in contact with someone infected with Ebola and monitoring the health of contacts for 21 days; the importance of separating the healthy from the sick to prevent further spread; and the importance of good hygiene and maintaining a clean environment.
In terms of controlling infection in health-care settings, health-care workers should always take standard precautions when caring for patients, regardless of their presumed diagnosis. These include basic hand hygiene, respiratory hygiene, use of personal protective equipment (to block splashes or other contact with infected materials), safe injection practices and safe burial practices. Health-care workers caring for patients with suspected or confirmed Ebola virus should apply extra infection control measures to prevent contact with the patient's blood and body fluids and contaminated surfaces or materials such as clothing and bedding. When in close contact (within 1 meter) of patients with EBV, health-care workers should wear face protection (a face shield or a medical mask and goggles), a clean, non-sterile long-sleeved gown, and gloves (sterile gloves for some procedures). Laboratory workers are also at risk. Samples taken from humans and animals for investigation of Ebola infection should be handled by trained staff and processed in suitably equipped laboratories.

II. MONOCLONAL ANTIBODIES AND PRODUCTION THEREOF

(50) A. General Methods

(51) It will be understood that monoclonal antibodies binding to Ebolavirus will have several applications. These include the production of diagnostic kits for use in detecting and diagnosing cancer, as well as for cancer therapies. In these contexts, one may link such antibodies to diagnostic or therapeutic agents, use them as capture agents or competitors in competitive assays, or use them individually without additional agents being attached thereto. The antibodies may be mutated or modified, as discussed further below. Methods for preparing and characterizing antibodies are well known in the art (see, e.g., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988; U.S. Pat. No. 4,196,265).

(52) The methods for generating monoclonal antibodies (MAbs) generally begin along the same lines as those for preparing polyclonal antibodies. The first step for both these methods is immunization of an appropriate host, or as described below, the identification of subjects who are immune due to prior natural infection. Antibody-producing cells may be induced to expand by priming with immunogens. A variety of routes can be used to administer such immunogen (subcutaneous, intramuscular, intradermal, intravenous and intraperitoneal). The production of polyclonal antibodies may be monitored by sampling blood of the immunized animal at various points following immunization. A second, booster injection, also may be given. The process of boosting and titering is repeated until a suitable titer is achieved. When a desired level of immunogenicity is obtained, the animal can be bled and the serum isolated and stored, and/or the animal can be used to generate mAbs.

(53) Somatic cells with the potential for producing antibodies, specifically B lymphocytes (B cells), are selected for use in the mAb generating protocol. These cells may be obtained from biopsied spleens or lymph nodes, or from circulating blood. The antibody-producing B lymphocytes from the immunized animal are then fused with cells of an immortal myeloma cell, generally one of the same species as the animal that was immunized or human or human/mouse chimeric cells. Myeloma cell lines suited for use in hybridoma-producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render then incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas). Any one of a number of myeloma cells may be used, as are known to those of skill in the art (Goding, pp. 65-66, 1986; Campbell, pp. 75-83, 1984).

(54) Methods for generating hybrids of antibody-producing spleen or lymph node cells and myeloma cells usually comprise mixing somatic cells with myeloma cells in a 2:1 proportion, though the proportion may vary from about 20:1 to about 1:1, respectively, in the presence of an agent or agents (chemical or electrical) that promote the fusion of cell membranes. Fusion methods using Sendai virus have been described by Kohler and Milstein (1975; 1976), and those using polyethylene glycol (PEG), such as 37% (v/v) PEG, by Gefter et al. (1977). The use of electrically induced fusion methods also is appropriate (Goding, pp. 71-74, 1986). Fusion procedures usually produce viable hybrids at low frequencies, about 110.sup.6 to 110.sup.8. However, this does not pose a problem, as the viable, fused hybrids are differentiated from the parental, infused cells (particularly the infused myeloma cells that would normally continue to divide indefinitely) by culturing in a selective medium. The selective medium is generally one that contains an agent that blocks the de novo synthesis of nucleotides in the tissue culture media. Exemplary and preferred agents are aminopterin, methotrexate, and azaserine. Aminopterin and methotrexate block de novo synthesis of both purines and pyrimidines, whereas azaserine blocks only purine synthesis. Where aminopterin or methotrexate is used, the media is supplemented with hypoxanthine and thymidine as a source of nucleotides (HAT medium). Where azaserine is used, the media is supplemented with hypoxanthine. Ouabain is added if the B cell source is an Epstein Barr virus (EBV) transformed human B cell line, in order to eliminate EBV transformed lines that have not fused to the myeloma.

(55) The preferred selection medium is HAT or HAT with ouabain. Only cells capable of operating nucleotide salvage pathways are able to survive in HAT medium. The myeloma cells are defective in key enzymes of the salvage pathway, e.g., hypoxanthine phosphoribosyl transferase (HPRT), and they cannot survive. The B cells can operate this pathway, but they have a limited life span in culture and generally die within about two weeks. Therefore, the only cells that can survive in the selective media are those hybrids formed from myeloma and B cells. When the source of B cells used for fusion is a line of EBV-transformed B cells, as here, ouabain is also used for drug selection of hybrids as EBV-transformed B cells are susceptible to drug killing, whereas the myeloma partner used is chosen to be ouabain resistant.

(56) Culturing provides a population of hybridomas from which specific hybridomas are selected. Typically, selection of hybridomas is performed by culturing the cells by single-clone dilution in microtiter plates, followed by testing the individual clonal supernatants (after about two to three weeks) for the desired reactivity. The assay should be sensitive, simple and rapid, such as radioimmunoassays, enzyme immunoassays, cytotoxicity assays, plaque assays dot immunobinding assays, and the like. The selected hybridomas are then serially diluted or single-cell sorted by flow cytometric sorting and cloned into individual antibody-producing cell lines, which clones can then be propagated indefinitely to provide mAbs. The cell lines may be exploited for MAb production in two basic ways. A sample of the hybridoma can be injected (often into the peritoneal cavity) into an animal (e.g., a mouse). Optionally, the animals are primed with a hydrocarbon, especially oils such as pristane (tetramethylpentadecane) prior to injection. When human hybridomas are used in this way, it is optimal to inject immunocompromised mice, such as SCID mice, to prevent tumor rejection. The injected animal develops tumors secreting the specific monoclonal antibody produced by the fused cell hybrid. The body fluids of the animal, such as serum or ascites fluid, can then be tapped to provide mAbs in high concentration. The individual cell lines could also be cultured in vitro, where the mAbs are naturally secreted into the culture medium from which they can be readily obtained in high concentrations. Alternatively, human hybridoma cells lines can be used in vitro to produce immunoglobulins in cell supernatant. The cell lines can be adapted for growth in serum-free medium to optimize the ability to recover human monoclonal immunoglobulins of high purity.

(57) mAbs produced by either means may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as FPLC or affinity chromatography. Fragments of the monoclonal antibodies of the disclosure can be obtained from the purified monoclonal antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, monoclonal antibody fragments encompassed by the present disclosure can be synthesized using an automated peptide synthesizer.

(58) It also is contemplated that a molecular cloning approach may be used to generate monoclonal antibodies. For this, RNA can be isolated from the hybridoma line and the antibody genes obtained by RT-PCR and cloned into an immunoglobulin expression vector. Alternatively, combinatorial immunoglobulin phagemid libraries are prepared from RNA isolated from the cell lines and phagemids expressing appropriate antibodies are selected by panning using viral antigens. The advantages of this approach over conventional hybridoma techniques are that approximately 10.sup.4 times as many antibodies can be produced and screened in a single round, and that new specificities are generated by H and L chain combination which further increases the chance of finding appropriate antibodies.

(59) Other U.S. patents, each incorporated herein by reference, that teach the production of antibodies useful in the present disclosure include U.S. Pat. No. 5,565,332, which describes the production of chimeric antibodies using a combinatorial approach; U.S. Pat. No. 4,816,567 which describes recombinant immunoglobulin preparations; and U.S. Pat. No. 4,867,973 which describes antibody-therapeutic agent conjugates.

(60) B. Antibodies of the Present Disclosure

(61) Antibodies according to the present disclosure may be defined, in the first instance, by their binding specificity, which in this case is for Ebolavirus glycoprotein (GP). Those of skill in the art, by assessing the binding specificity/affinity of a given antibody using techniques well known to those of skill in the art, can determine whether such antibodies fall within the scope of the instant claims. In one aspect, there are provided monoclonal antibodies having clone-paired CDRs from the heavy and light chains as illustrated in Table 2. Such antibodies may be produced by the clones discussed below in the Examples section using methods described herein.

(62) In a second aspect, the antibodies may be defined by their variable sequence, which include additional framework regions. These are provided in Tables 3-4 that encode or represent full variable regions. Furthermore, the antibodies sequences may vary from these sequences, optionally using methods discussed in greater detail below. For example, nucleic acid sequences may vary from those set out above in that (a) the variable regions may be segregated away from the constant domains of the light and heavy chains, (b) the nucleic acids may vary from those set out above while not affecting the residues encoded thereby, (c) the nucleic acids may vary from those set out above by a given percentage, e.g., 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, (d) the nucleic acids may vary from those set out above by virtue of the ability to hybridize under high stringency conditions, as exemplified by low salt and/or high temperature conditions, such as provided by about 0.02 M to about 0.15 M NaCl at temperatures of about 50 C. to about 70 C., (e) the amino acids may vary from those set out above by a given percentage, e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, or (f) the amino acids may vary from those set out above by permitting conservative substitutions (discussed below). Each of the foregoing apply to the nucleic acid sequences set forth as Table 3 and the amino acid sequences of Table 4.

(63) C. Engineering of Antibody Sequences

(64) In various embodiments, one may choose to engineer sequences of the identified antibodies for a variety of reasons, such as improved expression, improved cross-reactivity or diminished off-target binding. The following is a general discussion of relevant techniques for antibody engineering.

(65) Hybridomas may be cultured, then cells lysed, and total RNA extracted. Random hexamers may be used with RT to generate cDNA copies of RNA, and then PCR performed using a multiplex mixture of PCR primers expected to amplify all human variable gene sequences. PCR product can be cloned into pGEM-T Easy vector, then sequenced by automated DNA sequencing using standard vector primers. Assay of binding and neutralization may be performed using antibodies collected from hybridoma supernatants and purified by FPLC, using Protein G columns.

(66) Recombinant full length IgG antibodies were generated by subcloning heavy and light chain Fv DNAs from the cloning vector into an IgG plasmid vector, transfected into 293 Freestyle cells or CHO cells, and antibodies were collected an purified from the 293 or CHO cell supernatant.

(67) The rapid availability of antibody produced in the same host cell and cell culture process as the final cGMP manufacturing process has the potential to reduce the duration of process development programs. Lonza has developed a generic method using pooled transfectants grown in CDACF medium, for the rapid production of small quantities (up to 50 g) of antibodies in CHO cells. Although slightly slower than a true transient system, the advantages include a higher product concentration and use of the same host and process as the production cell line. Example of growth and productivity of GS-CHO pools, expressing a model antibody, in a disposable bioreactor: in a disposable bag bioreactor culture (5 L working volume) operated in fed-batch mode, a harvest antibody concentration of 2 g/L was achieved within 9 weeks of transfection.

(68) Antibody molecules will comprise fragments (such as F(ab), F(ab).sub.2) that are produced, for example, by the proteolytic cleavage of the mAbs, or single-chain immunoglobulins producible, for example, via recombinant means. Such antibody derivatives are monovalent. In one embodiment, such fragments can be combined with one another, or with other antibody fragments or receptor ligands to form chimeric binding molecules. Significantly, such chimeric molecules may contain substituents capable of binding to different epitopes of the same molecule.

(69) In related embodiments, the antibody is a derivative of the disclosed antibodies, e.g., an antibody comprising the CDR sequences identical to those in the disclosed antibodies (e.g., a chimeric, or CDR-grafted antibody). Alternatively, one may wish to make modifications, such as introducing conservative changes into an antibody molecule. In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.

(70) It also is understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. U.S. Pat. No. 4,554,101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. As detailed in U.S. Pat. No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: basic amino acids: arginine (+3.0), lysine (+3.0), and histidine (0.5); acidic amino acids: aspartate (+3.01), glutamate (+3.01), asparagine (+0.2), and glutamine (+0.2); hydrophilic, nonionic amino acids: serine (+0.3), asparagine (+0.2), glutamine (+0.2), and threonine (0.4), sulfur containing amino acids: cysteine (1.0) and methionine (1.3); hydrophobic, nonaromatic amino acids: valine (1.5), leucine (1.8), isoleucine (1.8), proline (0.51), alanine (0.5), and glycine (0); hydrophobic, aromatic amino acids: tryptophan (3.4), phenylalanine (2.5), and tyrosine (2.3).

(71) It is understood that an amino acid can be substituted for another having a similar hydrophilicity and produce a biologically or immunologically modified protein. In such changes, the substitution of amino acids whose hydrophilicity values are within 2 is preferred, those that are within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.

(72) As outlined above, amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.

(73) The present disclosure also contemplates isotype modification. By modifying the Fc region to have a different isotype, different functionalities can be achieved. For example, changing to IgG.sub.1 can increase antibody dependent cell cytotoxicity, switching to class A can improve tissue distribution, and switching to class M can improve valency.

(74) Modified antibodies may be made by any technique known to those of skill in the art, including expression through standard molecular biological techniques, or the chemical synthesis of polypeptides. Methods for recombinant expression are addressed elsewhere in this document.

(75) D. Single Chain Antibodies

(76) A Single Chain Variable Fragment (scFv) is a fusion of the variable regions of the heavy and light chains of immunoglobulins, linked together with a short (usually serine, glycine) linker. This chimeric molecule retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of a linker peptide. This modification usually leaves the specificity unaltered. These molecules were created historically to facilitate phage display where it is highly convenient to express the antigen binding domain as a single peptide. Alternatively, scFv can be created directly from subcloned heavy and light chains derived from a hybridoma. Single chain variable fragments lack the constant Fc region found in complete antibody molecules, and thus, the common binding sites (e.g., protein A/G) used to purify antibodies. These fragments can often be purified/immobilized using Protein L since Protein L interacts with the variable region of kappa light chains.

(77) Flexible linkers generally are comprised of helix- and turn-promoting amino acid residues such as alaine, serine and glycine. However, other residues can function as well. Tang et al. (1996) used phage display as a means of rapidly selecting tailored linkers for single-chain antibodies (scFvs) from protein linker libraries. A random linker library was constructed in which the genes for the heavy and light chain variable domains were linked by a segment encoding an 18-amino acid polypeptide of variable composition. The scFv repertoire (approx. 510.sup.6 different members) was displayed on filamentous phage and subjected to affinity selection with hapten. The population of selected variants exhibited significant increases in binding activity but retained considerable sequence diversity. Screening 1054 individual variants subsequently yielded a catalytically active scFv that was produced efficiently in soluble form. Sequence analysis revealed a conserved proline in the linker two residues after the V.sub.H C terminus and an abundance of arginines and prolines at other positions as the only common features of the selected tethers.

(78) The recombinant antibodies of the present disclosure may also involve sequences or moieties that permit dimerization or multimerization of the receptors. Such sequences include those derived from IgA, which permit formation of multimers in conjunction with the J-chain. Another multimerization domain is the Gal4 dimerization domain. In other embodiments, the chains may be modified with agents such as biotin/avidin, which permit the combination of two antibodies.

(79) In a separate embodiment, a single-chain antibody can be created by joining receptor light and heavy chains using a non-peptide linker or chemical unit. Generally, the light and heavy chains will be produced in distinct cells, purified, and subsequently linked together in an appropriate fashion (i.e., the N-terminus of the heavy chain being attached to the C-terminus of the light chain via an appropriate chemical bridge).

(80) Cross-linking reagents are used to form molecular bridges that tie functional groups of two different molecules, e.g., a stabilizing and coagulating agent. However, it is contemplated that dimers or multimers of the same analog or heteromeric complexes comprised of different analogs can be created. To link two different compounds in a step-wise manner, hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.

(81) An exemplary hetero-bifunctional cross-linker contains two reactive groups: one reacting with primary amine group (e.g., N-hydroxy succinimide) and the other reacting with a thiol group (e.g., pyridyl disulfide, maleimides, halogens, etc.). Through the primary amine reactive group, the cross-linker may react with the lysine residue(s) of one protein (e.g., the selected antibody or fragment) and through the thiol reactive group, the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).

(82) It is preferred that a cross-linker having reasonable stability in blood will be employed. Numerous types of disulfide-bond containing linkers are known that can be successfully employed to conjugate targeting and therapeutic/preventative agents. Linkers that contain a disulfide bond that is sterically hindered may prove to give greater stability in vivo, preventing release of the targeting peptide prior to reaching the site of action. These linkers are thus one group of linking agents.

(83) Another cross-linking reagent is SMPT, which is a bifunctional cross-linker containing a disulfide bond that is sterically hindered by an adjacent benzene ring and methyl groups. It is believed that steric hindrance of the disulfide bond serves a function of protecting the bond from attack by thiolate anions such as glutathione which can be present in tissues and blood, and thereby help in preventing decoupling of the conjugate prior to the delivery of the attached agent to the target site.

(84) The SMPT cross-linking reagent, as with many other known cross-linking reagents, lends the ability to cross-link functional groups such as the SH of cysteine or primary amines (e.g., the epsilon amino group of lysine). Another possible type of cross-linker includes the hetero-bifunctional photoreactive phenylazides containing a cleavable disulfide bond such as sulfosuccinimidyl-2-(p-azido salicylamido) ethyl-1,3-dithiopropionate. The N-hydroxy-succinimidyl group reacts with primary amino groups and the phenylazide (upon photolysis) reacts non-selectively with any amino acid residue.

(85) In addition to hindered cross-linkers, non-hindered linkers also can be employed in accordance herewith. Other useful cross-linkers, not considered to contain or generate a protected disulfide, include SATA, SPDP and 2-iminothiolane (Wawrzynczak & Thorpe, 1987). The use of such cross-linkers is well understood in the art. Another embodiment involves the use of flexible linkers.

(86) U.S. Pat. No. 4,680,338, describes bifunctional linkers useful for producing conjugates of ligands with amine-containing polymers and/or proteins, especially for forming antibody conjugates with chelators, drugs, enzymes, detectable labels and the like. U.S. Pat. Nos. 5,141,648 and 5,563,250 disclose cleavable conjugates containing a labile bond that is cleavable under a variety of mild conditions. This linker is particularly useful in that the agent of interest may be bonded directly to the linker, with cleavage resulting in release of the active agent. Particular uses include adding a free amino or free sulfhydryl group to a protein, such as an antibody, or a drug.

(87) U.S. Pat. No. 5,856,456 provides peptide linkers for use in connecting polypeptide constituents to make fusion proteins, e.g., single chain antibodies. The linker is up to about 50 amino acids in length, contains at least one occurrence of a charged amino acid (preferably arginine or lysine) followed by a proline, and is characterized by greater stability and reduced aggregation. U.S. Pat. No. 5,880,270 discloses aminooxy-containing linkers useful in a variety of immunodiagnostic and separative techniques.

(88) E. Intrabodies

(89) In a particular embodiment, the antibody is a recombinant antibody that is suitable for action inside of a cellsuch antibodies are known as intrabodies. These antibodies may interfere with target function by a variety of mechanism, such as by altering intracellular protein trafficking, interfering with enzymatic function, and blocking protein-protein or protein-DNA interactions. In many ways, their structures mimic or parallel those of single chain and single domain antibodies, discussed above. Indeed, single-transcript/single-chain is an important feature that permits intracellular expression in a target cell, and also makes protein transit across cell membranes more feasible. However, additional features are required.

(90) The two major issues impacting the implementation of intrabody therapeutic are delivery, including cell/tissue targeting, and stability. With respect to delivery, a variety of approaches have been employed, such as tissue-directed delivery, use of cell-type specific promoters, viral-based delivery and use of cell-permeability/membrane translocating peptides. With respect to the stability, the approach is generally to either screen by brute force, including methods that involve phage display and may include sequence maturation or development of consensus sequences, or more directed modifications such as insertion stabilizing sequences (e.g., Fc regions, chaperone protein sequences, leucine zippers) and disulfide replacement/modification.

(91) An additional feature that intrabodies may require is a signal for intracellular targeting. Vectors that can target intrabodies (or other proteins) to subcellular regions such as the cytoplasm, nucleus, mitochondria and ER have been designed and are commercially available (Invitrogen Corp.; Persic et al., 1997).

(92) By virtue of their ability to enter cells, intrabodies have additional uses that other types of antibodies may not achieve. In the case of the present antibodies, the ability to interact with the MUC1 cytoplasmic domain in a living cell may interfere with functions associated with the MUC1 CD, such as signaling functions (binding to other molecules) or oligomer formation. In particular, it is contemplated that such antibodies can be used to inhibit MUC1 dimer formation.

(93) F. Purification

(94) In certain embodiments, the antibodies of the present disclosure may be purified. The term purified, as used herein, is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally-obtainable state. A purified protein therefore also refers to a protein, free from the environment in which it may naturally occur. Where the term substantially purified is used, this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.

(95) Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest may be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity). Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing. Other methods for protein purification include, precipitation with ammonium sulfate, PEG, antibodies and the like or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques.

(96) In purifying an antibody of the present disclosure, it may be desirable to express the polypeptide in a prokaryotic or eukaryotic expression system and extract the protein using denaturing conditions. The polypeptide may be purified from other cellular components using an affinity column, which binds to a tagged portion of the polypeptide. As is generally known in the art, it is believed that the order of conducting the various purification steps may be changed, or that certain steps may be omitted, and still result in a suitable method for the preparation of a substantially purified protein or peptide.

(97) Commonly, complete antibodies are fractionated utilizing agents (i.e., protein A) that bind the Fc portion of the antibody. Alternatively, antigens may be used to simultaneously purify and select appropriate antibodies. Such methods often utilize the selection agent bound to a support, such as a column, filter or bead. The antibodies is bound to a support, contaminants removed (e.g., washed away), and the antibodies released by applying conditions (salt, heat, etc.).

(98) Various methods for quantifying the degree of purification of the protein or peptide will be known to those of skill in the art in light of the present disclosure. These include, for example, determining the specific activity of an active fraction, or assessing the amount of polypeptides within a fraction by SDS/PAGE analysis. Another method for assessing the purity of a fraction is to calculate the specific activity of the fraction, to compare it to the specific activity of the initial extract, and to thus calculate the degree of purity. The actual units used to represent the amount of activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the expressed protein or peptide exhibits a detectable activity.

(99) It is known that the migration of a polypeptide can vary, sometimes significantly, with different conditions of SDS/PAGE (Capaldi et al., 1977). It will therefore be appreciated that under differing electrophoresis conditions, the apparent molecular weights of purified or partially purified expression products may vary.

III. ACTIVE/PASSIVE IMMUNIZATION AND TREATMENT/PREVENTION OF EBOLA VIRUS INFECTION

(100) The present disclosure provides pharmaceutical compositions comprising anti-ebolavirus antibodies and antigens for generating the same. Such compositions comprise a prophylactically or therapeutically effective amount of an antibody or a fragment thereof, or a peptide immunogen, and a pharmaceutically acceptable carrier. In a specific embodiment, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term carrier refers to a diluent, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a particular carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Other suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.

(101) The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical agents are described in Remington's Pharmaceutical Sciences. Such compositions will contain a prophylactically or therapeutically effective amount of the antibody or fragment thereof, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration, which can be oral, intravenous, intraarterial, intrabuccal, intranasal, nebulized, bronchial inhalation, or delivered by mechanical ventilation.

(102) Active vaccines of the present disclosure, as described herein, can be formulated for parenteral administration, e.g., formulated for injection via the intradermal, intravenous, intramuscular, subcutaneous, or even intraperitoneal routes. Administration by intradermal and intramuscular routes are contemplated. The vaccine could alternatively be administered by a topical route directly to the mucosa, for example by nasal drops, inhalation, or by nebulizer. Pharmaceutically acceptable salts, include the acid salts and those which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.

(103) Passive transfer of antibodies, known as artificially acquired passive immunity, generally will involve the use of intravenous or intramuscular injections. The forms of antibody can be human or animal blood plasma or serum, as pooled human immunoglobulin for intravenous (IVIG) or intramuscular (IG) use, as high-titer human IVIG or IG from immunized or from donors recovering from disease, and as monoclonal antibodies (MAb). Such immunity generally lasts for only a short period of time, and there is also a potential risk for hypersensitivity reactions, and serum sickness, especially from gamma globulin of non-human origin. However, passive immunity provides immediate protection. The antibodies will be formulated in a carrier suitable for injection, i.e., sterile and syringeable.

(104) Generally, the ingredients of compositions of the disclosure are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.

(105) The compositions of the disclosure can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.

IV. ANTIBODY CONJUGATES

(106) Antibodies of the present disclosure may be linked to at least one agent to form an antibody conjugate. In order to increase the efficacy of antibody molecules as diagnostic or therapeutic agents, it is conventional to link or covalently bind or complex at least one desired molecule or moiety. Such a molecule or moiety may be, but is not limited to, at least one effector or reporter molecule. Effector molecules comprise molecules having a desired activity, e.g., cytotoxic activity. Non-limiting examples of effector molecules which have been attached to antibodies include toxins, anti-tumor agents, therapeutic enzymes, radionuclides, antiviral agents, chelating agents, cytokines, growth factors, and oligo- or polynucleotides. By contrast, a reporter molecule is defined as any moiety which may be detected using an assay. Non-limiting examples of reporter molecules which have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, photoaffinity molecules, colored particles or ligands, such as biotin.

(107) Antibody conjugates are generally preferred for use as diagnostic agents. Antibody diagnostics generally fall within two classes, those for use in in vitro diagnostics, such as in a variety of immunoassays, and those for use in vivo diagnostic protocols, generally known as antibody-directed imaging. Many appropriate imaging agents are known in the art, as are methods for their attachment to antibodies (see, for e.g., U.S. Pat. Nos. 5,021,236, 4,938,948, and 4,472,509). The imaging moieties used can be paramagnetic ions, radioactive isotopes, fluorochromes, NMR-detectable substances, and X-ray imaging agents.

(108) In the case of paramagnetic ions, one might mention by way of example ions such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and/or erbium (III), with gadolinium being particularly preferred. Ions useful in other contexts, such as X-ray imaging, include but are not limited to lanthanum (III), gold (III), lead (II), and especially bismuth (III).

(109) In the case of radioactive isotopes for therapeutic and/or diagnostic application, one might mention astatine.sup.211, 14carbon, .sup.51chromium, .sup.36chlorine, .sup.57cobalt, .sup.58cobalt, copper.sup.67, .sup.152Eu, gallium.sup.67, .sup.3hydrogen, iodine.sup.123, iodine.sup.125, iodine.sup.131, indium.sup.111, .sup.59iron, .sup.32phosphorus, rhenium.sup.186, rhenium.sup.188, .sup.75selenium, .sup.35sulphur, technicium.sup.99m and/or yttrium.sup.90. .sup.125I is often being preferred for use in certain embodiments, and technicium.sup.99m and/or indium.sup.111 are also often preferred due to their low energy and suitability for long range detection. Radioactively labeled monoclonal antibodies of the present disclosure may be produced according to well-known methods in the art. For instance, monoclonal antibodies can be iodinated by contact with sodium and/or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite, or an enzymatic oxidizing agent, such as lactoperoxidase. Monoclonal antibodies according to the disclosure may be labeled with technetium.sup.99m by ligand exchange process, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the antibody to this column. Alternatively, direct labeling techniques may be used, e.g., by incubating pertechnate, a reducing agent such as SNCl.sub.2, a buffer solution such as sodium-potassium phthalate solution, and the antibody. Intermediary functional groups which are often used to bind radioisotopes which exist as metallic ions to antibody are diethylenetriaminepentaacetic acid (DTPA) or ethylene diaminetetracetic acid (EDTA).

(110) Among the fluorescent labels contemplated for use as conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET, Tetramethylrhodamine, and/or Texas Red.

(111) Another type of antibody conjugates contemplated in the present disclosure are those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate. Examples of suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose oxidase. Preferred secondary binding ligands are biotin and avidin and streptavidin compounds. The use of such labels is well known to those of skill in the art and are described, for example, in U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149 and 4,366,241.

(112) Yet another known method of site-specific attachment of molecules to antibodies comprises the reaction of antibodies with hapten-based affinity labels. Essentially, hapten-based affinity labels react with amino acids in the antigen binding site, thereby destroying this site and blocking specific antigen reaction. However, this may not be advantageous since it results in loss of antigen binding by the antibody conjugate.

(113) Molecules containing azido groups may also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter and Haley, 1983). In particular, 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al., 1985). The 2- and 8-azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al., 1989; King et al., 1989; Dholakia et al., 1989) and may be used as antibody binding agents.

(114) Several methods are known in the art for the attachment or conjugation of an antibody to its conjugate moiety. Some attachment methods involve the use of a metal chelate complex employing, for example, an organic chelating agent such a diethylenetriaminepentaacetic acid anhydride (DTPA); ethylenetriaminetetraacetic acid; N-chloro-p-toluenesulfonamide; and/or tetrachloro-3-6-diphenylglycouril-3 attached to the antibody (U.S. Pat. Nos. 4,472,509 and 4,938,948). Monoclonal antibodies may also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate. Conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate. In U.S. Pat. No. 4,938,948, imaging of breast tumors is achieved using monoclonal antibodies and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl-3-(4-hydroxyphenyl)propionate.

(115) In other embodiments, derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin, using reaction conditions that do not alter the antibody combining site are contemplated. Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference). Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region have also been disclosed in the literature (O'Shannessy et al., 1987). This approach has been reported to produce diagnostically and therapeutically promising antibodies which are currently in clinical evaluation.

V. IMMUNODETECTION METHODS

(116) In still further embodiments, the present disclosure concerns immunodetection methods for binding, purifying, removing, quantifying and otherwise generally detecting Ebolavirus and its associated antigens. While such methods can be applied in a traditional sense, another use will be in quality control and monitoring of vaccine and other virus stocks, where antibodies according to the present disclosure can be used to assess the amount or integrity (i.e., long term stability) of H1 antigens in viruses. Alternatively, the methods may be used to screen various antibodies for appropriate/desired reactivity profiles.

(117) Some immunodetection methods include enzyme linked immunosorbent assay (ELISA), radioimmunoassay (MA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few. In particular, a competitive assay for the detection and quantitation of Ebolavirus antibodies directed to specific parasite epitopes in samples also is provided. The steps of various useful immunodetection methods have been described in the scientific literature, such as, e.g., Doolittle and Ben-Zeev (1999), Gulbis and Galand 0993), De Jager et al. (1993), and Nakamura et al. (1987). In general, the immunobinding methods include obtaining a sample suspected of containing Ebolavirus, and contacting the sample with a first antibody in accordance with the present disclosure, as the case may be, under conditions effective to allow the formation of immunocomplexes.

(118) These methods include methods for purifying Ebolavirus or related antigens from a sample. The antibody will preferably be linked to a solid support, such as in the form of a column matrix, and the sample suspected of containing the Ebolavirus or antigenic component will be applied to the immobilized antibody. The unwanted components will be washed from the column, leaving the Ebolavirus antigen immunocomplexed to the immobilized antibody, which is then collected by removing the organism or antigen from the column.

(119) The immunobinding methods also include methods for detecting and quantifying the amount of Ebolavirus or related components in a sample and the detection and quantification of any immune complexes formed during the binding process. Here, one would obtain a sample suspected of containing Ebolavirus or its antigens, and contact the sample with an antibody that binds Ebolavirus or components thereof, followed by detecting and quantifying the amount of immune complexes formed under the specific conditions. In terms of antigen detection, the biological sample analyzed may be any sample that is suspected of containing Ebolavirus or Ebolavirus antigen, such as a tissue section or specimen, a homogenized tissue extract, a biological fluid, including blood and serum, or a secretion, such as feces or urine.

(120) Contacting the chosen biological sample with the antibody under effective conditions and for a period of time sufficient to allow the formation of immune complexes (primary immune complexes) is generally a matter of simply adding the antibody composition to the sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to Ebolavirus or antigens present. After this time, the sample-antibody composition, such as a tissue section, ELISA plate, dot blot or Western blot, will generally be washed to remove any non-specifically bound antibody species, allowing only those antibodies specifically bound within the primary immune complexes to be detected.

(121) In general, the detection of immunocomplex formation is well known in the art and may be achieved through the application of numerous approaches. These methods are generally based upon the detection of a label or marker, such as any of those radioactive, fluorescent, biological and enzymatic tags. Patents concerning the use of such labels include U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149 and 4,366,241. Of course, one may find additional advantages through the use of a secondary binding ligand such as a second antibody and/or a biotin/avidin ligand binding arrangement, as is known in the art.

(122) The antibody employed in the detection may itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined. Alternatively, the first antibody that becomes bound within the primary immune complexes may be detected by means of a second binding ligand that has binding affinity for the antibody. In these cases, the second binding ligand may be linked to a detectable label. The second binding ligand is itself often an antibody, which may thus be termed a secondary antibody. The primary immune complexes are contacted with the labeled, secondary binding ligand, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes. The secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.

(123) Further methods include the detection of primary immune complexes by a two-step approach. A second binding ligand, such as an antibody that has binding affinity for the antibody, is used to form secondary immune complexes, as described above. After washing, the secondary immune complexes are contacted with a third binding ligand or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes). The third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system may provide for signal amplification if this is desired.

(124) One method of immunodetection uses two different antibodies. A first biotinylated antibody is used to detect the target antigen, and a second antibody is then used to detect the biotin attached to the complexed biotin. In that method, the sample to be tested is first incubated in a solution containing the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex. The antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex. The amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution containing the second step antibody against biotin. This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate. With suitable amplification, a conjugate can be produced which is macroscopically visible.

(125) Another known method of immunodetection takes advantage of the immuno-PCR (Polymerase Chain Reaction) methodology. The PCR method is similar to the Cantor method up to the incubation with biotinylated DNA, however, instead of using multiple rounds of streptavidin and biotinylated DNA incubation, the DNA/biotin/streptavidin/antibody complex is washed out with a low pH or high salt buffer that releases the antibody. The resulting wash solution is then used to carry out a PCR reaction with suitable primers with appropriate controls. At least in theory, the enormous amplification capability and specificity of PCR can be utilized to detect a single antigen molecule.

(126) A. ELISAs

(127) Immunoassays, in their most simple and direct sense, are binding assays. Certain preferred immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful. However, it will be readily appreciated that detection is not limited to such techniques, and western blotting, dot blotting, FACS analyses, and the like may also be used.

(128) In one exemplary ELISA, the antibodies of the disclosure are immobilized onto a selected surface exhibiting protein affinity, such as a well in a polystyrene microtiter plate. Then, a test composition suspected of containing the Ebolavirus or Ebolavirus antigen is added to the wells. After binding and washing to remove non-specifically bound immune complexes, the bound antigen may be detected. Detection may be achieved by the addition of another anti-Ebolavirus antibody that is linked to a detectable label. This type of ELISA is a simple sandwich ELISA. Detection may also be achieved by the addition of a second anti-Ebolavirus antibody, followed by the addition of a third antibody that has binding affinity for the second antibody, with the third antibody being linked to a detectable label.

(129) In another exemplary ELISA, the samples suspected of containing the Ebolavirus or Ebolavirus antigen are immobilized onto the well surface and then contacted with the anti-Ebolavirus antibodies of the disclosure. After binding and washing to remove non-specifically bound immune complexes, the bound anti-Ebolavirus antibodies are detected. Where the initial anti-Ebolavirus antibodies are linked to a detectable label, the immune complexes may be detected directly. Again, the immune complexes may be detected using a second antibody that has binding affinity for the first anti-Ebolavirus antibody, with the second antibody being linked to a detectable label.

(130) Irrespective of the format employed, ELISAs have certain features in common, such as coating, incubating and binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.

(131) In coating a plate with either antigen or antibody, one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate will then be washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then coated with a nonspecific protein that is antigenically neutral with regard to the test antisera. These include bovine serum albumin (BSA), casein or solutions of milk powder. The coating allows for blocking of nonspecific adsorption sites on the immobilizing surface and thus reduces the background caused by nonspecific binding of antisera onto the surface.

(132) In ELISAs, it is probably more customary to use a secondary or tertiary detection means rather than a direct procedure. Thus, after binding of a protein or antibody to the well, coating with a non-reactive material to reduce background, and washing to remove unbound material, the immobilizing surface is contacted with the biological sample to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, and a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or a third binding ligand.

(133) Under conditions effective to allow immune complex (antigen/antibody) formation means that the conditions preferably include diluting the antigens and/or antibodies with solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline (PBS)/Tween. These added agents also tend to assist in the reduction of nonspecific background.

(134) The suitable conditions also mean that the incubation is at a temperature or for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours or so, at temperatures preferably on the order of 25 C. to 27 C., or may be overnight at about 4 C. or so.

(135) Following all incubation steps in an ELISA, the contacted surface is washed so as to remove non-complexed material. A preferred washing procedure includes washing with a solution such as PBS/Tween, or borate buffer. Following the formation of specific immune complexes between the test sample and the originally bound material, and subsequent washing, the occurrence of even minute amounts of immune complexes may be determined.

(136) To provide a detecting means, the second or third antibody will have an associated label to allow detection. Preferably, this will be an enzyme that will generate color development upon incubating with an appropriate chromogenic substrate. Thus, for example, one will desire to contact or incubate the first and second immune complex with a urease, glucose oxidase, alkaline phosphatase or hydrogen peroxidase-conjugated antibody for a period of time and under conditions that favor the development of further immune complex formation (e.g., incubation for 2 hours at room temperature in a PBS-containing solution such as PBS-Tween).

(137) After incubation with the labeled antibody, and subsequent to washing to remove unbound material, the amount of label is quantified, e.g., by incubation with a chromogenic substrate such as urea, or bromocresol purple, or 2,2-azino-di-(3-ethyl-benzthiazoline-6-sulfonic acid (ABTS), or H.sub.2O.sub.2, in the case of peroxidase as the enzyme label. Quantification is then achieved by measuring the degree of color generated, e.g., using a visible spectra spectrophotometer.

(138) In another embodiment, the present disclosure contemplates the use of competitive formats. This is particularly useful in the detection of Ebolavirus antibodies in sample. In competition based assays, an unknown amount of analyte or antibody is determined by its ability to displace a known amount of labeled antibody or analyte. Thus, the quantifiable loss of a signal is an indication of the amount of unknown antibody or analyte in a sample.

(139) Here, the inventors propose the use of labeled Ebolavirus monoclonal antibodies to determine the amount of Ebolavirus antibodies in a sample. The basic format would include contacting a known amount of Ebolavirus monoclonal antibody (linked to a detectable label) with Ebolavirus antigen or particle. The Ebolavirus antigen or organism is preferably attached to a support. After binding of the labeled monoclonal antibody to the support, the sample is added and incubated under conditions permitting any unlabeled antibody in the sample to compete with, and hence displace, the labeled monoclonal antibody. By measuring either the lost label or the label remaining (and subtracting that from the original amount of bound label), one can determine how much non-labeled antibody is bound to the support, and thus how much antibody was present in the sample.

(140) B. Western Blot

(141) The Western blot (alternatively, protein immunoblot) is an analytical technique used to detect specific proteins in a given sample of tissue homogenate or extract. It uses gel electrophoresis to separate native or denatured proteins by the length of the polypeptide (denaturing conditions) or by the 3-D structure of the protein (native/non-denaturing conditions). The proteins are then transferred to a membrane (typically nitrocellulose or PVDF), where they are probed (detected) using antibodies specific to the target protein.

(142) Samples may be taken from whole tissue or from cell culture. In most cases, solid tissues are first broken down mechanically using a blender (for larger sample volumes), using a homogenizer (smaller volumes), or by sonication. Cells may also be broken open by one of the above mechanical methods. However, it should be noted that bacteria, virus or environmental samples can be the source of protein and thus Western blotting is not restricted to cellular studies only. Assorted detergents, salts, and buffers may be employed to encourage lysis of cells and to solubilize proteins. Protease and phosphatase inhibitors are often added to prevent the digestion of the sample by its own enzymes. Tissue preparation is often done at cold temperatures to avoid protein denaturing.

(143) The proteins of the sample are separated using gel electrophoresis. Separation of proteins may be by isoelectric point (pI), molecular weight, electric charge, or a combination of these factors. The nature of the separation depends on the treatment of the sample and the nature of the gel. This is a very useful way to determine a protein. It is also possible to use a two-dimensional (2-D) gel which spreads the proteins from a single sample out in two dimensions. Proteins are separated according to isoelectric point (pH at which they have neutral net charge) in the first dimension, and according to their molecular weight in the second dimension.

(144) In order to make the proteins accessible to antibody detection, they are moved from within the gel onto a membrane made of nitrocellulose or polyvinylidene difluoride (PVDF). The membrane is placed on top of the gel, and a stack of filter papers placed on top of that. The entire stack is placed in a buffer solution which moves up the paper by capillary action, bringing the proteins with it. Another method for transferring the proteins is called electroblotting and uses an electric current to pull proteins from the gel into the PVDF or nitrocellulose membrane. The proteins move from within the gel onto the membrane while maintaining the organization they had within the gel. As a result of this blotting process, the proteins are exposed on a thin surface layer for detection (see below). Both varieties of membrane are chosen for their non-specific protein binding properties (i.e., binds all proteins equally well). Protein binding is based upon hydrophobic interactions, as well as charged interactions between the membrane and protein. Nitrocellulose membranes are cheaper than PVDF, but are far more fragile and do not stand up well to repeated probings. The uniformity and overall effectiveness of transfer of protein from the gel to the membrane can be checked by staining the membrane with Coomassie Brilliant Blue or Ponceau S dyes. Once transferred, proteins are detected using labeled primary antibodies, or unlabeled primary antibodies followed by indirect detection using labeled protein A or secondary labeled antibodies binding to the Fc region of the primary antibodies.

(145) C. Immunohistochemistry

(146) The antibodies of the present disclosure may also be used in conjunction with both fresh-frozen and/or formalin-fixed, paraffin-embedded tissue blocks prepared for study by immunohistochemistry (IHC). The method of preparing tissue blocks from these particulate specimens has been successfully used in previous IHC studies of various prognostic factors, and is well known to those of skill in the art (Brown et al., 1990; Abbondanzo et al., 1990; Allred et al., 1990).

(147) Briefly, frozen-sections may be prepared by rehydrating 50 ng of frozen pulverized tissue at room temperature in phosphate buffered saline (PBS) in small plastic capsules; pelleting the particles by centrifugation; resuspending them in a viscous embedding medium (OCT); inverting the capsule and/or pelleting again by centrifugation; snap-freezing in 70 C. isopentane; cutting the plastic capsule and/or removing the frozen cylinder of tissue; securing the tissue cylinder on a cryostat microtome chuck; and/or cutting 25-50 serial sections from the capsule. Alternatively, whole frozen tissue samples may be used for serial section cuttings.

(148) Permanent-sections may be prepared by a similar method involving rehydration of the 50 mg sample in a plastic microfuge tube; pelleting; resuspending in 10% formalin for 4 hours fixation; washing/pelleting; resuspending in warm 2.5% agar; pelleting; cooling in ice water to harden the agar; removing the tissue/agar block from the tube; infiltrating and/or embedding the block in paraffin; and/or cutting up to 50 serial permanent sections. Again, whole tissue samples may be substituted.

(149) D. Immunodetection Kits

(150) In still further embodiments, the present disclosure concerns immunodetection kits for use with the immunodetection methods described above. As the antibodies may be used to detect Ebolavirus or Ebolavirus antigens, the antibodies may be included in the kit. The immunodetection kits will thus comprise, in suitable container means, a first antibody that binds to Ebolavirus or Ebolavirus antigen, and optionally an immunodetection reagent.

(151) In certain embodiments, the Ebolavirus antibody may be pre-bound to a solid support, such as a column matrix and/or well of a microtitre plate. The immunodetection reagents of the kit may take any one of a variety of forms, including those detectable labels that are associated with or linked to the given antibody. Detectable labels that are associated with or attached to a secondary binding ligand are also contemplated. Exemplary secondary ligands are those secondary antibodies that have binding affinity for the first antibody.

(152) Further suitable immunodetection reagents for use in the present kits include the two-component reagent that comprises a secondary antibody that has binding affinity for the first antibody, along with a third antibody that has binding affinity for the second antibody, the third antibody being linked to a detectable label. As noted above, a number of exemplary labels are known in the art and all such labels may be employed in connection with the present disclosure.

(153) The kits may further comprise a suitably aliquoted composition of the Ebolavirus or Ebolavirus antigens, whether labeled or unlabeled, as may be used to prepare a standard curve for a detection assay. The kits may contain antibody-label conjugates either in fully conjugated form, in the form of intermediates, or as separate moieties to be conjugated by the user of the kit. The components of the kits may be packaged either in aqueous media or in lyophilized form.

(154) The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which the antibody may be placed, or preferably, suitably aliquoted. The kits of the present disclosure will also typically include a means for containing the antibody, antigen, and any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.

VI. EXAMPLES

(155) The following examples are included to demonstrate preferred embodiments. It should be appreciated by those of skill in the art that the techniques disclosed in the examples that follow represent techniques discovered by the inventors to function well in the practice of embodiments, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.

Example 1Materials and Methods

(156) Donors.

(157) The donors were human subjects previously naturally infected with Ebola Bundibugyo in Uganda in 2007 or U.S. citizens infected with Ebola 2014 strain in 2014 in West Africa. Peripheral blood from the donors was obtained months or years after the illness, when viral clearance had been demonstrated, following informed consent. The study was approved by the Vanderbilt University Institutional Review Board.

(158) Viruses.

(159) The recombinant Ebola Zaire strain Mayinga (EBOV) expressing eGFP was generated in our laboratory by reverse genetics (Lubaki et al., 2013; Towner et al., 2005) from plasmids provided by the Special Pathogens Branch at CDC and passaged 3 times in Vero E6 cells. For analysis of antibody binding by ELISA, viruses were gamma-irradiated with the dose of 510.sup.6 rad. All work with Ebola virus was performed within the Galveston National Laboratory BSL-4 laboratories.

(160) Generation of Human Hybridomas Secreting Monoclonal Antibodies (mAbs).

(161) Peripheral blood mononuclear cells (PBMCs) from the donors were isolated with Ficoll-Histopaque by density gradient centrifugation. The cells were cryopreserved immediately and stored in the vapor phase of liquid nitrogen until use. Previously cryopreserved samples were thawed, and 10 million PBMCs were plated into 384-well plates (Nunc #164688) using: 17 mL of cell culture medium (ClonaCell-HY Medium A, Stemcell Technologies #03801), 8 g/mL of the TLR agonist CpG (phosphorothioate-modified oligodeoxynucleotide ZOEZOEZZZZZOEEZOEZZZT (SEQ ID NO: 81), Invitrogen), 3 g/mL Chk2 inhibitor (Sigma #C3742), 1 g/mL cyclosporine A (Sigma #C1832) and 4.5 mL of clarified supernate from cultures of B95.8 cells (ATCC VR-1492) containing Epstein-Barr virus (EBV). After 7 days, cells from each 384-well culture plate were expanded into four 96-well culture plates (Falcon #353072) using cell culture medium containing 8 g/mL CpG, 3 g/mL Chk2i and 10 million irradiated heterologous human PBMCs (Nashville Red Cross) and incubated for an additional four days. Plates were screened for Ebola virus antigen-specific antibody-secreting cell lines using enzyme-linked immunosorbent assays (ELISAs). Cells from wells with supernates reacting in an Ebola virus antigen ELISA were fused with HMMA2.5 myeloma cells using an established electrofusion technique (Yu et al., 2008). After fusion, hybridomas were resuspended in medium containing 100 M hypoxanthine, 0.4 M aminopterin, 16 M thymidine (HAT Media Supplement, Sigma #H0262) and 7 g/mL ouabain (Sigma #03125) and incubated for 18 days before screening hybridomas for antibody production by ELISA.

(162) Human mAb and Fab Production and Purification.

(163) After fusion with HMMA2.5 myeloma cells, hybridomas producing Ebola-specific antibodies were cloned biologically by two rounds of limiting dilution and by single-cell fluorescence-activated cell sorting. After cloning, hybridomas were expanded in post-fusion medium (ClonaCell-HY Medium E, STEMCELL Technologies #03805) until 50% confluent in 75-cm.sup.2 flasks (Corning #430641). For antibody production, cells from one 75-cm.sup.2 flask were collected with a cell scraper and expanded to four 225-cm.sup.2 flasks (Corning #431082) in serum-free medium (Hybridoma-SFM, Gibco #12045-076). After 21 days, supernates were clarified by centrifugation and sterile filtered using 0.2-m pore size filter devices. HiTrap Protein G or HiTrap MabSelectSure columns (GE Healthcare Life Sciences #17040501 and #11003494 respectively) were used to purify antibodies from filtered supernates. Fab fragments were generated by papain digestion (Pierce Fab Preparation Kit, Thermo Scientific #44985) and purified by chromatography using a two-column system where the first column contained protein G resin (GE Healthcare Life Sciences #29048581) and the second column contained either anti-kappa or anti-lambda antibody light chain resins (GE Healthcare Life Sciences #17545811 and #17548211 respectively).

(164) Screening ELISA.

(165) ELISA plates were coated with recombinant Ebola virus proteins (20 g in 10 mL DPBS per plate) and incubated at 4 C. overnight. Plates were blocked with 100 L of blocking solution/well for 1 h. Blocking solution consisted of 10 g powdered milk, 10 mL of goat serum, 100 mL of 10DPBS, and 0.5 mL of Tween-20 mixed to a 1 L final volume with distilled water. The presence of antibodies bound to the GP was determined using goat anti-human IgG horseradish peroxidase conjugated secondary antibodies (Southern Biotech #2040-05, 1:4,000 dilution) and 1-Step Ultra TMB-ELISA substrate (Thermo Scientific #34029), with optical density read at 450 nM after stopping the reaction with 1M HCl.

(166) Half Maximal Effective Concentration (EC.sub.50) Binding Analysis.

(167) Ebola virus GPs were coated onto 384-well plates (Thermo Scientific Nunc #265203) in DPBS at 2 g/mL overnight, then antigen was removed and plates were blocked with blocking solution made as above. Antibodies were applied to the plates using serial dilutions. The presence of antibodies bound to the GP was determined using goat anti-human IgG alkaline phosphatase conjugate (Meridian Life Science #W99008A, 1:4,000 dilution) and p-nitrophenol phosphate substrate tablets (Sigma #S0942), with optical density read at 405 nM after 120 minutes. A non-linear regression analysis was performed on the resulting curves using Prism version 5 (GraphPad) to calculate EC.sub.50 values.

(168) Ebola Virus Neutralization Experiments.

(169) Dilutions of mAbs in triplicate were mixed with Ebola virus or Ebola virus expressing eGFP in MEM containing 10% FBS (HyClone), 50 g/mL gentamicin (Cellgro #30-005-CR) with or without 5% guinea pig complement (MP Biomedicals #642836) in a total volume of 0.1 mL, and incubated for 1 hour at 37 C. for virus neutralization. Following neutralization, virus-antibody mixtures were placed on monolayers of Vero E6 cells in 24-well plates, incubated for 1 hour at 37 C. for virus adsorption, and overlayed with MEM containing 2% FBS and 0.8% methylcellulose (Sigma-Aldrich #M0512-1KG). After incubation for 5 days, medium was removed, cells were fixed with 10% formalin (Fisher Scientific #245-684), plates were sealed in plastic bags and incubated for 24 hours at room temperature. Sealed plates were taken out of the BSL-4 laboratory according to approved SOPs, and monolayers were washed three times with phosphate buffered saline. Viral plaques were immunostained with a mAb against EBOV, clone 15H10 (BEI Resources #NR-12184). Alternatively, following virus adsorption, monolayers were covered with MEM containing 10% FBS and 1.6% tragacanth (Sigma-Aldrich #G1128). After incubation for 14 days, medium was removed, cells were fixed with 10% formalin, plates were sealed in plastic bags, incubated for 24 hours at room temperature, and taken out of the BSL-4 laboratory as above. Fixed monolayers were stained with 10% formalin containing 0.25% crystal violet (Fisher Scientific #C581-100), and plaques were counted. In some cases, when Ebola virus expressing eGFP, neutralization was scored using reduction of fluorescence.

(170) Biolayer Interferometry Competition Binding Assay.

(171) Biotinylated GP or GPmuc (EZ-Link Micro NHS-PEG4-Biotinylation Kit, Thermo Scientific #21955) (1 g/mL) was immobilized onto streptavidin-coated biosensor tips (ForteBio #18-5019) for 2 minutes. After measuring the baseline signal in kinetics buffer (KB: 1PBS, 0.01% BSA and 0.002% Tween 20) for two minutes, biosensor tips were immersed into the wells containing primary antibody at a concentration of 100 g/mL for 10 minutes. Biosensors then were immersed into wells containing competing mAbs at a concentration of 100 g/mL for 5 minutes. The percent binding of the competing mAb in the presence of the first mAb was determined by comparing the maximal signal of competing mAb applied after the first mAb complex to the maximal signal of competing mAb alone. MAbs were judged to compete for binding to the same site if maximum binding of the competing mAb was reduced to <30% of its un-competed binding. MAbs were considered non-competing if maximum binding of the competing mAb was >70% of its un-competed binding. A level of 30-70% of its un-competed binding was considered intermediate competition.

(172) Sequence Analysis of Antibody Variable Region Genes.

(173) Total cellular RNA was extracted from clonal hybridomas that produced Ebola virus antibodies, and RT-PCR reaction was performed using mixtures of primers designed to amplify all heavy chain or light chain antibody variable regions. The generated PCR products were purified and cloned into the pJet 1.2 plasmid vector (Thermo Scientific, #K1231) for sequence analysis. The nucleotide sequences of plasmid DNAs were determined using an ABI3700 automated DNA sequencer. Heavy chain or light chain antibody variable region sequences were analyzed using the IMGT/V-Quest program (Brochet et al., 2008; Giudicelli et al., 2011). The analysis involved the identification of germline genes that were used for antibody production, location of complementary determining regions (CDRs) and framework regions (FRs) as well as the number and location of somatic mutations that occurred during affinity maturation.

(174) Statistical Analysis.

(175) EC.sub.50 values for neutralization were determined by finding the concentration of mAb at which a 50% reduction in plaque counts occurred after incubation of virus with neutralizing antibody. A logistic curve was fit to the data using the count as the outcome and the log-concentration as the predictor variable. The results of the model then were transformed back to the concentration scale. Results are presented as the concentration at the dilution that achieve a 50% reduction from challenge control with accompanying 95% confidence intervals. Each antibody was treated as a distinct analysis in a Bayesian non-linear regression model.

(176) In Vivo Testing.

(177) The animal protocol for testing of mAbs in mice was approved by the Institutional Animal Care and Use Committee of the University of Texas Medical Branch at Galveston. BALB/c mice (Harlan) were placed in the AB SL-4 facility of the Galveston National Laboratory. Groups of mice at 5 animals per group were injected with individual mAbs by the intraperitoneal route. Untreated animals served as controls. For the challenge, mice were injected with 1,000 PFU of the mouse-adapted Ebola virus Mayinga strain by the intraperitoneal route. Animals were weighed and monitored daily over the three-week period after challenge. Once animals were symptomatic, they were examined twice per day. The disease was scored using the following parameters: dyspnea (possible scores 0-5), recumbency (0-9), unresponsiveness (0-5), and bleeding/hemorrhage (0-5); the individual scores for each animal were summarized. Guinea pig studies were conducted in a similar fashion.

Example 2Results

(178) Isolation of Monoclonal Antibodies (mAbs).

(179) To generate human hybridoma cell lines secreting mAbs to Ebola virus GP, the inventors screened supernatants from EBV-transformed B cell lines derived from survivors of Ebola Bundibugyo virus (BDBV) in Uganda in 2007 or of Ebolavirus ebola (EBOV) in the 2014 West African outbreak, for binding to several recombinant forms of Ebola GP or to irradiated cell lysates prepared from Ebola virus-infected cell cultures. The inventors fused transformed cells from B cell lines producing Ebola GP-reactive Abs to the Ebola GP antigens with myeloma cells and generated 90 cloned hybridomas secreting BDBV-reactive human mAbs from BDBV survivors, and 119 cloned hybridomas secreting EBOV-reactive human mAbs from EBOV survivors. The inventors screened for binding phenotype against three types of glycoprotein, specifically, full-length glycoprotein, mucin deleted glycoprotein, and secreted glycoprotein. They found antibodies that bound with diverse patterns recognizing the various forms of glycoprotein, including clones that down to full-length and mucin delete a glycoprotein but did not have the potential deleterious property of binding to secreted like protein. The inventors also found antibodies that bound all three forms of glycoprotein.

(180) Neutralization Activity.

(181) To evaluate the inhibitory activity of the mAbs, the inventors first performed in vitro neutralization studies using a chimeric vesicular stomatitis virus with Ebola GP from on its surface (VSV/GP-Ebola) and later they tested each of the antibodies for activity against live Ebola virus strains. For the monoclonal antibodies isolated from BDBV survivors, 34 of the 90 BDBV mAb clones exhibited neutralizing activity in vitro. The inventors have found a similar proportion of neutralizing clones in the monoclonal antibodies isolated from survivors of the 2014 Ebolavirus outbreak. Within clones isolated from the 2007 or 2014 outbreak survivors, several of the antibodies isolated exhibit a higher potency for neutralization then any monoclonal antibody of any species ever reported for Ebola virus. The designated BDBV223 clone neutralizes BDBV with an IC.sub.50 of 5 ng/mL remarkably, it also has the property of cross-reactivity, and it neutralizes EBOV with an IC.sub.50 of 50 ng/mL. Antibodies with this level of activity for neutralization have not been reported previously. The inventors also found neutralizing clones from survivors of the 2014 Ebola virus outbreak, including two clones that neutralize with IC.sub.50 of <1 g/mL. The neutralization activity of neutralizing Abs was in many cases enhanced by the presence of complement.

(182) Recognition of Varying Forms of GP.

(183) To characterize the binding of isolated Abs to recombinant Ebola virus GPs, the inventors performed binding assays using either a recombinant MARV GP ectodomain containing the mucin-like domain (designated full length GP of just GP) or a recombinant GP lacking residues of the mucin-like domain (GPmuc, from EBOV or BDBV or SUDV). Based on OD.sub.405 values at the highest Ab concentration tested (E.sub.max) and 50% effective concentration (EC.sub.50), the inventors divided the GP-specific Abs into different major phenotypic binding groups, based on binding phenotype (designated Patterns 1, 2, 3 and 4). These distinctions are important, because they show some of the antibodies are more cross-reactive for diverse Ebola virus species than any antibodies ever reported. They also showed that different antibodies recognize different forms of glycoprotein, which may be useful. For example in some cases, one may find it desirable to have prophylactic or therapeutic antibodies that bind to full-length or mucin deleted glycoprotein, but avoid binding to secreted glycoprotein. Alternatively, if one is seeking to prevent pathogenic effects mediated by the secreted glycoprotein, one would seek antibodies that retained binding to the secreted form of glycoprotein. The inventors have isolated antibodies with both types of binding patterns, and with differing levels of cross-reactivity for diverse Ebola virus species.

(184) Competition-Binding Studies.

(185) To determine whether mAbs from distinct binding groups targeted different antigenic regions on the Ebola virus GP surface, the inventors performed competition-binding assays using a real-time biosensor. They tested diverse nAbs from our panel of Ebola virus antibodies in a tandem blocking assay in which biotinylated GP was attached to a streptavidin biosensor. The inventors identified several major competition binding groups within their antibodies, and subsequent electron microscopy studies of antigen antibody complexes show that one group binds to the glycan cap region on the glycoprotein, and another 2 groups bind lower on the glycoprotein, one at the base and one group lower down at the heptad repeat 2 region. These data suggested that these neutralizing Abs target at least three major antigenic regions on the Ebola virus GP surface.

(186) Electron Microscopy Studies of Antigen-Antibody Complexes.

(187) To determine the location of the antigenic region targeted by Ebola virus neutralizing Abs, the inventors performed with collaborators negative stain single-particle electron microscopy (EM) studies using complexes of GP with Fab fragments of neutralizing Abs. The EM reconstructions showed that Fab fragments for one competition binding pattern group of neutralizing Abs bind at the top of the GP in or near the glycan cap site. A second competition binding pattern group of neutralizing Abs bind at the bottom of the GP in or near what would be a putative MPER or heptad repeat 2 region.

(188) Cross-Reactive Binding of Ebola Virus Antibodies with Diverse Species of GP.

(189) It is surprising that human MARV neutralizing Abs recognize GP from diverse species of Ebola, since previously reported murine mAbs and one human phage display library derived antibody (KZ52) exhibited a binding pattern that was restricted to a single species of Ebola virus, To determine whether the isolated Ebola virus neutralizing Abs could bind in a cross-reactive manner to diverse Ebola virus species, the inventors performed ELISA binding assays using recombinant forms of BDBV, EBOV, and SUDV GPs. Several of the Ebola virus antibodies neutralizing Abs recognized two or even three species Ebola GP. They tested the breadth of neutralization of MARV neutralizing Abs for filoviruses using a panel of different Ebola virus isolates. Some of the neutralizing Abs neutralized diverse Ebola virus species, which is a newly discovered and desirable property.

(190) In Vivo Testing.

(191) The inventors tested the in vivo protective activity of the mAbs in murine and guinea pig models of infection using mouse- or guinea-pig adapted Ebola Zaire Mayinga strain. Inoculation of mice or guinea pigs with live Ebola virus caused clinical disease, and in a proportion or all of animals caused lethal disease. They selected five of the BDBV survivor mAbs among those with in vitro neutralization IC.sub.50 values and diverse properties: BDBV223, BDBV270, and BDBV289, BDBV317, BDBV324. When used as monotherapy and given at 24 hours after lethal inoculation, each exhibited a marked therapeutic effect. The inventors also tested combinations BDBV223+BDBV270, or BDBV223+BDBV289, since BDBV223 recognizes the MPER region and the other two (BDBV270 and BDBV289) recognize the glycan. Each of the combinations exhibited increased therapeutic effect. They also tested the most potent antibody (BDBV223) as monotherapy but given as a two-dose treatment (at 1 day and 3 day after lethal inoculation). This two-dose regimen appeared more effective than single dose therapy.

Example 3Discussion

(192) There is an obvious urgent need for prophylactic and therapeutic interventions for Filovirus infections given the massive outbreak of EBOV infections in West Africa in 2014. There is very little information about the structural determinants of neutralization on which to base the rational selection of antibodies, and for Ebola virus there have been no reported human neutralizing Abs with naturally paired heavy and light antibody chains.

(193) For the three most important species, EBOV and BDBV and SUDV, the inventors studied survivors of the first two species, EBOV and BDBV and obtained human monoclonal antibodies from survivors of each of those two infections. Ninety human monoclonal antibodies that obtained from eight survivors of BDBV infection in Uganda in 2007. They have also obtained cells from U.S. survivors who were infected while working in West Africa in 2014. From one of those individuals, they obtained about 93 new human monoclonal antibodies that were induced by the current strain, EBOV, historically called the Zaire strain. Additional donors have yielded 26 more clones from EBOV immune donors. Data show that some of these antibodies have neutralizing activity against the EBOV (20 of the 50 mAbs tested from the one individual so far for neutralizing activity). Thus, in summary, the inventors have two sets of antibodies, one set of 90 mAbs induced by BDBV infection and one set of 119 mAbs induced by EBOV infection.

(194) In conclusion, this study reveals that naturally-occurring human Ebola neutralizing Abs isolated from the B cells of recovered donors target several antigenic sites on Ebola virus GP, suggesting that at least two major mechanisms of Ebola virus neutralization. Remarkably, some of the isolated antibodies bound not only to the inducing virus (BDBV or EBOV) but also exhibited cross-reactive binding to other GPs, including BDBV, EBOV and SUDV GP. This information can be used to inform development of new therapeutics and structure-based vaccine designs against filoviruses. Furthermore, as these neutralizing mAbs are fully human and exhibit inhibitory activity, they could be formulated as components of a prophylactic or therapeutic approach for filovirus infection and disease. Indeed, challenge studies using murine and guinea pig modeled here show clear evidence of in vivo activity. Their ability to bind a broad range of Ebola virus isolates indicates they may offer detection of or efficacy against new viral strains yet to emerge. Since these mAbs bind to diverse forms of Ebola virus GP, these antibodies could be selected for preferred activity in vivo, for instance avoiding binding to secreted GP or including binding to secreted GP.

(195) TABLE-US-00001 TABLE 1A Biological properties of human mAbs isolated from a 2014 survivor of West African outbreak: in vivo protection, binding to GP of various filovirus species, and epitope mapping EBOV49 EBOV52 EBOV62 EBOV63 EBOV82 EBOV87 EBOV90 EBOV95 Mice 80% 0% 60% 0% 80% 20% 100% 0% protection EBOV 262 712 228 283 36 724 67 129 GP binding (EC50, g/ml) BDBV 1838 508 1389 GP binding (EC50, g/ml) SUDV 629 GP binding (EC50, g/ml) EBOV 61 82 51 38 21 51 25 41 sGP binding (EC50, g/ml) Location 252Phe.fwdarw.Cys, 275Trp.fwdarw.Gly, 234Phe.fwdarw.Val, 155Lys.fwdarw.Arg, 224Gly.fwdarw.Asp, 267Ser.fwdarw.Asn, 227Thr.fwdarw.Ile, 280Glu.fwdarw.Lys, of escape glycan cap glycan cap 273Leu.fwdarw.Pro, receptor- glycan cap 271Gly.fwdarw.Glu, glycan cap glycan cap mutations 308Phe.fwdarw.Leu, binding glycan cap glycan cap; domain; 365Leu.fwdarw.Pro, 280Gln.fwdarw.Lys, 368Leu.fwdarw.Pro, glycan cap 394Tyr.fwdarw.His, mucin-like domain

(196) TABLE-US-00002 TABLE 1B Heatmap showing the neutralization potency of EBOV GP-specific mAbs against EBOV* Mab IC.sub.50, g/mL EBOV49 6.5 EBOV52 4.0 EBOV62 8.5 EBOV63 6.4 EBOV82 <0.2 EBOV87 3.3 EBOV90 5.1 EBOV95 15.9 EBOV137 4.9 EBOV141 48.1 EBOV157 29.9 EBOV293 1.7 EBOV311 4.3 EBOV317 0.7 EBOV329 0.4 EBOV333 0.7 EBOV416 11.3 EBOV427 1.0 *The IC.sub.50 value for each virus-mAb combination is shown. Neutralization assays were performed in triplicate in the absence of complement.

(197) TABLE-US-00003 TABLE2 CDRsequences Antibody CDRH1 CDRH2 CDRH3 BDBV43 DSFSRKYG IMPIVGLT ARDEIIGARPHWFDS (SEQIDNO:33) (SEQIDNO:34) (SEQIDNO:35) BDBV223 GGSFTTTY VNYSGNA TSRIRSHIAYSWKGDV (SEQIDNO:36) (SEQIDNO:37) (SEQIDNO:38) EBOV9 GGTFSSYT IIPKLGIA LYYCARVLLSSRDAFD (SEQIDNO:39) (SEQIDNO:40) IW (SEQIDNO:41) EBOV49 GFTFSSYE ISSSGRTI AREPYVDGILYGAGDS (SEQIDNO:42) (SEQIDNO:43) YFDY (SEQIDNO:44) EBOV52 GGSISSYY IYDSGRT ASLGPFDKLWFGELLP (SEQIDNO:45) (SEQIDNO:46) GWFDP (SEQIDNO:47) EBOV63 GFTLNFYN ISSSSNYI ARDFVQLLIPQRDEWQ (SEQIDNO:48) (SEQIDNO:49) GVHDYYGMDV (SEQIDNO:50) EBOV82 GFTFTNAW IKSNTDGGTT TTGKSDCSGGNCYVVD (SEQIDNO:51) (SEQIDNO:52) Y (SEQIDNO:53) EBOV90 GFTFSNAW IKSKNDGGTA ITFLRPDH (SEQIDNO:54) (SEQIDNO:55) (SEQIDNO:56) EBOV109 GYTFTGYY INPNSGGT CATNKGTNGRYYYYGM (SEQIDNO:57) (SEQIDNO:58) DVW (SEQIDNO:59) EBOV62 GFTFSSYW IKQDGSAK ARDGLLGISDLLYPIY (SEQIDNO:82) (SEQIDNO:83) YFDY (SEQIDNO:84) EBOV87 GYTFTSYA ISGNNGNT ARDADIVVVVGATGTY (SEQIDNO:85) (SEQIDNO:86) YYGMDV (SEQIDNO:87) EBOV157 GFTVSNNY FYSDGTT ARQASGYDAYYMDV (SEQIDNO:88) (SEQIDNO:89) (SEQIDNO:90) BDBV289 GATFGSDT IIPFFGEA ARQINEMATFGEIHYY (SEQIDNO:91) (SEQIDNO:92) TYMDV (SEQIDNO:93) BDBV231 SDSIRSYS IYYSGNI ARDWITIFGRYFDV (SEQIDNO:94) (SEQIDNO:95) (SEQIDNO:96) BDBV275 GFNFGDYV IRGKTFGATT TRRATSTWYEDY (SEQIDNO:97) (SEQIDNO:98) (SEQIDNO:99) BDBV315 GDSISSGSYY IYTSGST ARDPITIFGGVIFGWG (SEQIDNO:100) (SEQIDNO:101) MDV (SEQIDNO:102) BDBV329 GGTFDTYA IIPVLGIV ARGLRSLSPRGQEGPT (SEQIDNO:103) (SEQIDNO:104) PAPGWRRAQYHYYYMD V (SEQIDNO:105) BDBV335 GGSINSDSYY VYTSGST ARVVWGSYRSYHYSYG (SEQIDNO:106) (SEQIDNO:108) MDV (SEQIDNO:109) BDBV354 GYAFTTYA ISTYYGTT VRDRSWLATSRPYDAF (SEQIDNO:110) (SEQIDNO:111) DI (SEQIDNO:112) BDBV386 GGSISSGRFY IYTSGST ATELYYYGSGSYDPLW (SEQIDNO:113) (SEQIDNO:114) S (SEQIDNO:115) BDBV397 GGSISSGSYF IYTSGTT ATSPYYYDSSHYYDY (SEQIDNO:116) (SEQIDNO:117) (SEQIDNO:118) BDBV399 GGSISNGGYH IYYSGST ARDRIRGGPIDY (SEQIDNO:119) (SEQIDNO:120) (SEQIDNO:121) BDBV353 GYTFSDYY INPYSGGT ARLYGAGSHYNHYNGM (SEQIDNO:122) (SEQIDNO:123) DV (SEQIDNO:124) BDBV410 GGSVSSGRYF IHSSGRT <Notyet (SEQIDNO:125) (SEQIDNO:126) available> BDBV270 GASISRGLYY IYTSGSI VRDAPWGDFLTGYFGF (SEQIDNO:127) (SEQIDNO:128) YGMDV (SEQIDNO:129) BDBV324 GYTFTSFE MNPKSGDT ARGPHVGEVVPGLMAG (SEQIDNO:130) (SEQIDNO:131) TYYFPLDV (SEQIDNO:132) BDBV403 GGTFSNSI IIPIVGLV AINGVNIPDTLT (SEQIDNO:133) (SEQIDNO:134) (SEQIDNO:135) BDBV407 GGSIRSYF IYYSGRP ARDERLLVEVGTDHFY (SEQIDNO:136) (SEQIDNO:137) YGLDV (SEQIDNO:138) BDBV425 GYTFTSFG INTYNGDT ARDSHLISIAVANTPN (SEQIDNO:139) (SEQIDNO:140) DF (SEQIDNO:141) BDBV426 GGSISSDDRY IYYSGST ATVTAYSPATMIVVGT (SEQIDNO:142) (SEQIDNO:143) EHGFDY (SEQIDNO:144) BDBV317 GLTFSNFG IRFDGSNK GRVLYGAAADF (SEQIDNO:145) (SEQIDNO:146) (SEQIDNO:147) BDBV342 GGTFSSYA IIPIFGKP ARGQGEIVVMVGHDDG (SEQIDNO:148) (SEQIDNO:149) GDYLGY (SEQIDNO:150) BDBV357 GGSISGSI ISLSGST ARHRKSSKMVRGIEVF (SEQIDNO:151) (SEQIDNO:152) YYYYMDV (SEQIDNO:153) BDBV340 GGSISSGSFY FYTTGST ARGPVSYYSGNLYYFD (SEQIDNO:154) (SEQIDNO:155) Y (SEQIDNO:156) BDBV392 GFTFSSFG IRYDGSDK AKRGGHDYGYYDNNRY (SEQIDNO:157) (SEQIDNO:158) IDL (SEQIDNO:159) BDBV415 GGTFSSYG IIPKFATA AGHFPQRKPITTIVVI (SEQIDNO:160) (SEQIDNO:161) TYWSLDL (SEQIDNO:162) BDBV343 GVTFSRYT ISPILGTA ARDAPIILVEGPETGM (SEQIDNO:163) (SEQIDNO:164) DV (SEQIDNO:165) BDBV377 GFTFNSYG IWFDGSKK AKDLLYGSGMVPNYYY (SEQIDNO:166) (SEQIDNO:167) YGLDV (SEQIDNO:168) Antibody CDRL1 CDRL2 CDRL3 BDBV43 QSVSSN GSS LQYYNWPRT (SEQIDNO:60) (SEQIDNO:61) BDBV223 QSVPRNY GAS HQYDRLPYT (SEQIDNO:62) (SEQIDNO:63) EBOV49 QSISNY AAS QQSYNTPPVT (SEQIDNO:64) (SEQIDNO:65) EBOV52 QSVHNY DAS QHRSNWLT (SEQIDNO:66) (SEQIDNO:67) EBOV63 QSVSNSY GAS QHYGSSQLT (SEQIDNO:68) (SEQIDNO:69) EBOV109 QSLLHSNGYNY LGS CMQALQTITF (SEQIDNO:70) (SEQIDNO:71) EBOV62 QNIGSY AAS QQSYSIPRT (SEQIDNO:169) (SEQIDNO:170) EBOV87 QSISSW DAS QQYKSSLRT (SEQIDNO:171) (SEQIDNO:172) EBOV157 QSINSW QAS QQYSSFPLT (SEQIDNO:173) (SEQIDNO:174) BDBV41 QSITSTY GAS QQYHSSL (SEQIDNO:175) (SEQIDNO:176) BDBV231 QNLLYSSNNKNF WAS QQYYTIPPT (SEQIDNO:177) (SEQIDNO:178) BDBV275 QSVLYTPNNHNY WAS QQYHIPPYS (SEQIDNO:179) (SEQIDNO:180) BDBV315 QTLLHSNGYNY LGS MQALQTPVT (SEQIDNO:181) (SEQIDNO:182) BDBV329 QSVSSNY GAS QQYGSSPGT (SEQIDNO:183) (SEQIDNO:184) BDBV335 QSVGSSY GAS QQSGSSPET (SEQIDNO:185) (SEQIDNO:186) BDBV354 QDISST GAS QHFYYFPRT (SEQIDNO:187) (SEQIDNO:188) BDBV386 QGINNN DAS QQNANLPHT (SEQIDNO:189) (SEQIDNO:190) BDBV397 QDITNY DAS QQSADLPLT (SEQIDNO:191) (SEQIDNO:192) BDBV399 QGIDNY AAS QRYNLAPSA (SEQIDNO:193) (SEQIDNO:194) BDBV353 QSIGSL RAS QQFNSY (SEQIDNO:195) (SEQIDNO:196) BDBV410 QSLLHSNGETY EVS MQSVLLPYT (SEQIDNO:197) (SEQIDNO:198) BDBV270 QSINTY AAS QQSFTTPYT (SEQIDNO:199) (SEQIDNO:200) BDBV324 QSISRW KVS QQYDTYPWT (SEQIDNO:201) (SEQIDNO:202) BDBV403 QSVSSSY DAS QQYGSSAIT (SEQIDNO:203) (SEQIDNO:204) BDBV407 QSLLHSNGYNF LGS MQA (SEQIDNO:205) BDBV425 QSVYSYY DAS QYYGNSHQGAA (SEQIDNO:206) (SEQIDNO:207) BDBV317 HSLLYSSDNKNY WAS QQYYTKSFT (SEQIDNO:208) (SEQIDNO:209) BDBV342 SSNVGAYNY DVT YSYAGSYTWI (SEQIDNO:210) (SEQIDNO:211) BDBV357 ISDIGGYDY DVS SSYTRTYTPHVV (SEQIDNO:212) (SEQIDNO:213) BDBV340 SSDIGNNNY DVN SSYTNNRTFS (SEQIDNO:214) (SEQIDNO:215) BDBV259 KLGDRY QDT QAWDTS (SEQIDNO:216) (SEQIDNO:217) BDBV343 NSDVGGYDY DVN CSYAGSYTFV (SEQIDNO:218) (SEQIDNO:219)

(198) TABLE-US-00004 TABLE3 VariableRegionProteinSequences BDBV43VH (SEQIDNO:1) QVQLVQSGAEVKKPGSSVKVSCRASGDSFSRKYGISWVRQAPGQGFEWM GTIMPIVGLTTSAQKFQGRVTITADKSTSTAHMELNSLTSEDTAIYYCA RDEIIGARPHWFDSWGQGTLVTVSS BDBV43VL (SEQIDNO:2) EIVMTQSPAIMSVSPGKRATLSCRASQSVSSNLAWYQRKPGQAPRLLIY GSSTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCLQYYNWPRTF GQGTKVEIK BDBV223VH (SEQIDNO:3) QVQLQQWGAGLLKPSETLSLTCAVYGGSFTTTYWNWIRQPPGKGLEWIG EVNYSGNANYNPSLKGRVAISVDTSKNQFSLRLNSVTAADTAIYYCTSR IRSHIAYSWKGDVWGKGTTVTVSS BDBV223VL (SEQIDNO:4) EIVMTQSPGTLSLSPGERATLSCRASQSVPRNYIGWFQQKPGQAPRLLI YGASSRAAGFPDRFSGSGSGTDFTLTITRLEPEDFAMYYCHQYDRLPYT FGQGTKLEIK EBOV49VH (SEQIDNO:5) EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEINWVRQAPGRGLEWVS YISSSGRTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR EPYVDGILYGAGDSYFDYWGQGTLVTVSS EBOV49VL (SEQIDNO:6) DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKVLIY AASSLQSGVSSRFSGSGSGTDFTLTISSLQPEDFATYFCQQSYNTPPVT FGQGTRLEIK EBOV52VH (SEQIDNO:7) QVQLQESGPGLVKPSETLSLNCTVSGGSISSYYWSWIRQPPGKGLEWIG YIYDSGRTKYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCASL GPFDKLWFGELLPGWFDPWGQGTLVTVSS EBOV52VL (SEQIDNO:8) EIVLTQSPATLSLSPGGRATLSCRASQSVHNYLAWYQQKSGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPDDFAVYYCQHRSNWLTFG GGTKVEIK EBOV63VH (SEQIDNO:9) EVQLVESGGGLVKPGGSLRLSCAASGFTLNFYNMNWVRQAPGKGLEWVS SISSSSNYIYYADSVKGRFTISRDNARKSLYLQMNSLRAEDTAVYYCAR DFVQLLIPQRDEWQGVHDYYGMDVWGQGTLVTVSS EBOV63VL (SEQIDNO:10) EIVLTQSPGTLSLSPGGRATLSCRASQSVSNSYLAWYQQKPGQAPRLLI YGASSRATGIPDRFSGSGSGTDFILTISRLEPEDFAVYYCQHYGSSQLT FGGGTKVEIK EBOV82VH (SEQIDNO:11) EVQLVESGGGLVKPGGSLRLSCAASGFTFTNAWMNWVRQAPGKGLEWVG RIKSNTDGGTTDYAAPVKGRFTISRDDSKKTLYLQMNSLKTEDTAVYYC TTGKSDCSGGNCYVVDYWGQGTLVTVSS EBOV82VL <NotYetAvailable> EBOV90VH (SEQIDNO:12) EVQLVESGGGLVKPGGALRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG RIKSKNDGGTADYAAPVKGRFSISRDDSKNTLYLQMNSLKIEDTAVYYC ITFLRPDHWGQGTLVTVSS EBOV90VL <NotYetAvailable> EBOV9VH (SEQIDNO:72) QVQLVQSGVEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMG RIIPKLGIANYAQNAQKFQGRVTITADKSTSTAYMELSRLRSEDTALYY CARVLLSSRDAFDIWGQGTLVTVSS EBOV9VL <NotYetAvailable> EBOV109VH (SEQIDNO:73) QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMG WINPNSGGTNYAQKFQGWVTMTRDTSISTAYMELRRLRSDDTAVYYCAT NKGTNGRYYYYGMDVWGQGTLVTVSS EBOV109VL (SEQIDNO:74) DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQ TITFGQGTRLEIK EBOV119VH (SEQIDNO:75) QVQLVQSGVEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMG RIIPKLGIANYAQNAQKFQGRVTITADKSTSTAYMELSRLRSEDTALYY CARVLLSSRDAFDIWGQGTLVT EBOV119VL <NotYetAvailable> EBOV62_VH (SEQIDNO:220) EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVA NIKQDGSAKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR DGLLGISDLLYPIYYFDYWGQGTLVTVSS EBOV62_VL (SEQIDNO:221) DIVMTQSPSSLSASVGDRVTITCRASQNIGSYLNWYQQKPGKAPNLLMY AASSLQSGVPSRFSGSGSGTDFTLTITSLQPEDFATYYCQQSYSIPRTF GQGTQLEIK >EBOV87_VH (SEQIDNO:222) QVQLVQSGAEVKRPGASVKVSCKASGYTFTSYAISWVRQAPGQGLEWMG WISGNNGNTNYAQKLQGRLTMTTDTSTSTAYMELRSLRSDDTAVYYCAR DADIVVVVGATGTYYYGMDVWGQGTLVTVSS >EBOV87_VL (SEQIDNO:223) DIVMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIY DASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYKSSLRTF GQGTQLEIK EBOV157_VH (SEQIDNO:224) QVQLVQSGGGLVQPGGSLRLSCAASGFTVSNNYMSWVRQAPGKGLEWVS IFYSDGTTYNADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQ ASGYDAYYMDVWGQGTLVTVSS EBOV157_VL (SEQIDNO:225) DIVMTQSPSTLSASVGDRVTITCRASQSINSWLAWYQQKPGKAPKLLIY QASTLERGVPSRFSGSGAGTEFTLTISSLQPDDFATYYCQQYSSFPLTF GGGTKVELK BDBV289_VH (SEQIDNO:226) QVQLVQSGAEVKKPGSSVKVSCKASGATFGSDTVTWVRQAPGQGLEWMG GIIPFFGEANYAQRFQGRVTITADKSTNTAYMELSSLRSEDTAVYFCAR QINEMATFGEIHYYTYMDVWGQGTLVTVSS BDBV289_VL (SEQIDNO:227) GSELTQDPAVSVALGQTVRITCQGDSLRNYYASWYQQKPRQAPVLVFYG KNNRPSGIPDRFSGSSSGNTASLTISGAQAEDEADYYCNSRDSSSNHLV FGGGTKLTVLS BDBV41 <NotYetAvailable> BDBV41_VL (SEQIDNO:228) EIVMTQSPGTLSLSPGERATLSCRASQSITSTYLAWYQQKPGQAPRLLI YGASNRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYHSSLFG GGTKVEIK BDBV231_VH (SEQIDNO:229) QVQLVQSGPGLVKPSETLSLTCTVSSDSIRSYSWSWLRQPPGKGLEWIG FIYYSGNINYNPSLKSRVTISVDTSKNQLSLNLSSVTAADTAVYYCARD WITIFGRYFDVWGRGTLVTVSS BDBV231_VL (SEQIDNO:230) DIVMTQSPDSLAVSLGERATINCKSSQNLLYSSNNKNFLTWYQHKPGQP PKLLISWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVALYYCQQYY TIPPTFGQGTKVEIK BDBV275_VH (SEQIDNO:231) QVQLVQSGGGFVQPGRSLRLSCTASGFNFGDYVMSWVRQAPGKGLEWVG FIRGKTFGATTEYAASVKGRFTISRDDSKSIAYLQIKSLKTEDTAVYYC TRRATSTWYEDYWGQGTLVTVSS BDBV275_VL (SEQIDNO:232) DIVMTQSPDSLAVSLGERATINCKSSQSVLYTPNNHNYLAWYQQKPGQP PKLLIYWASAREPGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYH IPPYSFGQGTKLEIK BDBV315_VH (SEQIDNO:233) QVQLVQSGPGLVKPSQTLSLTCTVSGDSISSGSYYWSWIRQPAGKGLEW IGRIYTSGSTNYNPSLKSRVTISVDTSKNQFSLNLSSVTAADTAVYYCA RDPITIFGGVIFGWGMDVWGQGTLVTVSS BDBV315_VL (SEQIDNO:234) DIVMTQSPLSLPVTPGEPASISCRSSQTLLHSNGYNYLYWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQ TPVTFGPGTKVDIK BDBV329_VH (SEQIDNO:235) QVQLVQSGAEVKKPGSSVKVSCKASGGTFDTYAISWVRQAPGQGLEWMG GIIPVLGIVDYAQKFQGRVTITAAKFTNIAYMELSSLRSEDAAVYYCAR GLRSLSPRGQEGPTPAPGWRRAQYHYYYMDVWGTGTLVTVSS BDBV329_VL (SEQIDNO:236) EIVMTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLI YGASSRATGIPDRFSGSGSGPDFTLTISRLEPEDFAVYYCQQYGSSPGT FGGGTKVEIK BDBV335_VH (SEQIDNO:237) QVQLQESGPGLVRPSQTLSLTCTVSGGSINSDSYYWNWIRQPAGKGLEW LGRVYTSGSTNYNPSLKSRVTISVDTSKNQVSLRLNSVTAADTGVYYCA RVVWGSYRSYHYSYGMDVWGQGTLVTVSS BDBV335_VL (SEQIDNO:238) EIVMTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQRPGQAPRLLF YGASYRATGIPDRFSASGSGTDFSLTINRLEPEDFAVYYCQQSGSSPET FGQGTKLEIK BDBV354_VH (SEQIDNO:239) QVQLVQSGVEVKKPGASVKVSCKASGYAFTTYAISWVRQAPGQGLEWMG WISTYYGTTYYAQNLQGRVTMTTDTSTSTSYLELRSLRSDDTAVYYCVR DRSWLATSRPYDAFDIWGQGTLVTVSS BDBV354_VL (SEQIDNO:240) AIQMTQSPSSLSASVGDRVTITCRASQDISSTLAWYQQKPGKAPKLLIY GASSLESGVPSRFNGSGSGTDFTLTISSLQPEDFATYYCQHFYYFPRTF GQGTRLEIR BDBV386_VH (SEQIDNO:241) QVQLVQSGPGLVKPSQTLSLTCTVSGGSISSGRFYWSWVRQPAGRGLEW IGRIYTSGSTNYNPSLKSRVSISVDTSKNQFSLKLSSVTAADTAVYYCA TELYYYGSGSYDPLWSWGQGTLVTVSS BDBV386_VL (SEQIDNO:242) DIVMTQSPSSLSASVGDRVTITCQASQGINNNLNWHQQKPGKAPKLLIY DASNLERGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQNANLPHTF GQGTKLEIK BDBV397_VH (SEQIDNO:243) QVQLVQSGPGLVKPSQTLSLTCTVSGGSISSGSYFWNWIRQPAGKGLEW IGRIYTSGTTNYNPSLKSRLTISVDTSKNQFSLKLNSVTAADTAVYYCA TSPYYYDSSHYYDYWGQGTLVTVSS BDBV397_VL (SEQIDNO:244) DIQMTQSPSSLSASVGDRVTITCQASQDITNYLNWYQQKPGKAPKLLIF DASNLEKGVPSRFSATGSATDFTFTISSLQPEDTATYYCQQSADLPLTF GQGTRLDIK BDBV399_VH (SEQIDNO:245) QVQLVQSGPGLVKPSQTLSLTCNVSGGSISNGGYHWSWIRQVPGKGLEW IGHIYYSGSTSYTPSLKSRLTISVDTSKNQFSLKLSSVTAADTAVYYCA RDRIRGGPIDYWGQGTLVTVSS BDBV399_VL (SEQIDNO:246) DIQMTQSPSSLSASVGERVTITCRASQGIDNYLAWYQQKPGKVPKLLIY AASTLHSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNLAPSAF GQGTKVEIR BDBV353_VH (SEQIDNO:247) QVQLVQSGAEMRKPGASVKVSCKASGYTFSDYYIHWVRQAPGQGLEWLG WINPYSGGTNYAQKFQGRVTMTRDTSISTAHMELSGLRSDDTALYFCAR LYGAGSHYNHYNGMDVWGQGTLVTVSS BDBV353_VL (SEQIDNO:248) DIQMTQSPSTLSASVGDRVTITCRASQSIGSLLAWYQQKPGKAPKLLIY RASTLQGGVPSRFSGSGSGTEFTLTISSLQPDDVATYYCQQFNSYFGGG TKVEIK BDBV410_VH (SEQIDNO:249) QVQLQQSGPGLVRPSQTLSLTCSVSGGSVSSGRYFWNWIRQSAGKGLEW IGRIHSSGRTNSNPSLKSRVTISVDTSKNQFSLHLGSVTAADTAVYYCA R BDBV410_VL (SEQIDNO:250) DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSNGETYLFWYLQKPGQPP QLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSVL LPYTFGQGTKLEIK BDBV270_VH (SEQIDNO:251) QVQLQESGPGLVKPSQTLSLTCTVSGASISRGLYYWSWIRQPAGKGLEW IGRIYTSGSINYNPSLKSRVTISVDTSKNQFSLRLSSVIATDTAVYYCV RDAPWGDFLTGYFGFYGMDVWGQGTLVTVSS BDBV270_VL (SEQIDNO:252) DIVMTQSPSSLSASVGDRVTITCRASQSINTYLNWYQQKPGKAPKFLIY AASSLHSGVPSRFSGSGSGTDFTLTINSLQPDDFATYYCQQSFTTPYTF GQGTKLEIK BDBV324_VH (SEQIDNO:253) QVQLVQSGAEVKKPGASVKVSCKTSGYTFTSFEIHWVRQGSGQGLEWMG RMNPKSGDTVSAQKFQGRVTLTRDTSINAAYMELGSLSSEDTAVYYCAR GPHVGEVVPGLMAGTYYFPLDVWGQGTLVTVSS BDBV324_VL (SEQIDNO:254) DIQMTQSPSTLSASIGDRVTITCRASQSISRWLAWYQQKPGKAPKLLIY KVSDLQSGVPSRFSGSGYGTEFTLTIGSLQPDDLATYYCQQYDTYPWTF GQGTKLEIK BDBV403_VH (SEQIDNO:255) QVQLVQSGAEVKKPGSSVKVSCNASGGTFSNSILNWVRQAPGQGLEWMG RIIPIVGLVNFAQKFEGRVTFTADKFTNTAYMELNSLRFEDTAVYYCAI NGGKYPGYFDYWGQGTLVTVSS BDBV403_VL (SEQIDNO:256) DIVMTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQHQPGQAPRLLI YDASSRATGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYGSSAIT FGQGTRLEIK BDB407_VH (SEQIDNO:257) QVQLQESGPGLVKPSETLSLTCAVSGGSIRSYFWSWIRQAPGKGLEWIG NIYYSGRPNYNPSLKNRVTISADTSNNEVSLELSAVTAADTAVYFCARD ERLLVEVGTDHFYYGLDVWGQGTLVTVSS BDBV407_VL (SEQIDNO:258) EIVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGYNFLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGADFTLKISRVEAEDVGVXYCMQA BDBV425_VH (SEQIDNO:259) QVQLVQSGAEVKKPGASVKVSCKASGYTFTSFGISWVRQAPGQGLEWLG WINTYNGDTNYAQKFQGRVTMTTDTSTSTGFMELRSLRSDDTAVYYCAR DSHLISIAVANTPNDFWGQGTLVTVSS BDBV425_VL (SEQIDNO:260) EIVMTQSPGTLSLSPGDRVTLSCRASQSVYSYYLAWYQQKPGQAPRLLM YDASIRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQYYGNSHQG AAFGQGTKVEVK BDBV426_VH (SEQIDNO:261) QVQLQESGPGLVKPSQTLSLTCNVSGGSISSDDRYWSWIRQPPGKGLEW LGFIYYSGSTDYNPSLKSRVTMSLDTSKNQFSLKLNSVTAADTAMYYCA TVTAYSPATMIVVGTEHGFDYWGQGTLVTVSS BDBV426_VL (SEQIDNO:262) DIVMTQSPSSLSASVGDRVTIFCRATQSIRSFLNWYQQKPGKAPNLLIY AASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPWTF GQGTKVEIK BDBV317_VH (SEQIDNO:263) QVQLVESGGGVVQPGGSLRLSCEVSGLTFSNFGMQWVRQAPGKGLEWVA FIRFDGSNKYYADSVKGRFTISRDNSKNTVYLQMGSLRAEDTAVYFCGR VLYGAAADFWGQGTLVTVSS BDBV317_VL (SEQIDNO:264) DIVMTQSPDSLAVSLGERATINCTSSHSLLYSSDNKNYLTWYQQKAGQP PKLLIYWASTRQSGVPDRFSGSGSGTEFTLTISSLQAEDVAVYYCQQYY TKSFTFGQGTKVEIK BDBV342_VH (SEQIDNO:265) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWVRQAPGQGLEWMG GIIPIFGKPNYAQKFQGRVTITADKSTSTAYMELRSLRSEDTAVYYCAR GQGEIVVMVGHDDGGDYLGYWGQGTLVTVSS BDBV342_VL (SEQIDNO:266) QSALTQPRSVSGSPGXSVTISCTGTSSNVGAYNYVSWYQQHPGKAPKLM IFDVTKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADFYCYSYAGSYT WIFGGGTKLTVLG BDBV357_VH (SEQIDNO:267) QVQLVQSGPGLVKPSETLSLTCSVSGGSISGSIWTWIRQSPGKGLEWIG YISLSGSTNFNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARH RKSSKMVRGIEVFYYYYMDVWGKGTLVTVSS BDBV357_VL (SEQIDNO:268) QSALTQPASVSGSPGQSITISCTGTISDIGGYDYVSWYQQHPGKAPKLM IYDVSDRPSGVSNRFSGSKSGNTASLTISGLQSEDEADYYCSSYTRTYT PHVVFGGGTKLTVLG BDBV340_VH (SEQIDNO:269) QVQLVQSGPGLVKPSQTLSLTCTVSGGSISSGSFYWSWIRQPAGKGLEW IGRFYTTGSTHYNPSLKSRVTISADTSKNHFSLNLTSLTAADTAVYYCA RGPVSYYSGNLYYFDYWGLGTLVTVSS BDBV340_VL (SEQIDNO:270) QSALTQPASVSGSPGQSITITCTGTSSDIGNNNYVSWYQQHPGKAPKLI IFDVNKRPSGVSNRFSGSKSDNTASLTISGLQAEDEADYYCSSYTNNRT FSFGGGTKVTVL BDBV392_VH (SEQIDNO:271) QVQLVQSGGGVVQPGGSLRLSCAASGFTFSSFGIHWVRQAPGKGLEWVA FIRYDGSDKFYLDSVKGRFTISRDNSKNTLFLQMSSLRVEDTAVYYCAK RGGHDYGYYDNNRYIDLWGRGTLVTVSS BDBV259_VH <NotYetAvailable> BDBV259_VL (SEQIDNO:272) SYVLTQPPSVSVSPGQTASITCSGDKLGDRYTCWYQQKPGQSPVLVIYQ DTKRPSGIPERFSGSNSGNTATLTISETQAIDEADYYCQAWDTS BDBV328_VH <NotYetAvailable> BDBV328_VL (SEQIDNO:273) DIQMTQSPSTLSASVGDRVTITCRASQSISTYLAWYQQKPGKAPNLLIY KASSLQSGVPPRFSGSGSGTEFTLTISSLQPDDFATYYCQQYHSYWWTF GQGTKVEII BDBV415_VH (SEQIDNO:274) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYGVSWVRQAPGQGLEWMG GIIPKFATAKYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAG HFPQRKPITTIVVITYWSLDLWGRGTLVTVSS BDBV415_VL <NotYetAvailable> BDBV343_VH (SEQIDNO:275) QVQLVESGAEGKKPGSSVKVSCKAPGVTFSRYTISWVRQAPGQGLEWMG RISPILGTANYAQKFQGRVTITADKSSSTVYMELNRLKSDDTAVYYCAR DAPIILVEGPETGMDVWGQGTLVTVSS BDBV343_VL (SEQIDNO:276) QSALTQPRSVSASPGQSVTISCTGTNSDVGGYDYVSWYQQHPGKAPKLM ISDVNMRPSGVPDRFSGSKSGNTASLTISGLQSEDEADYYCCSYAGSYT FVFGSGTKVTVLG BDBV377_VH (SEQIDNO:277) QVQLVQSGGGVVQPGRSLRLSCAASGFTFNSYGMHWVRQAPGKGLEWVA VIWFDGSKKYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTAVYYCAK DLLYGSGMVPNYYYYGLDVWGQGTLVTVSS BDBV377_VL <NotYetAvailable> BDBV255_VH (SEQIDNO:278) QVQLVQSGGGLVRPGGSLRLSCTASGFTLSTYSMTWVRQAPGKGLEWVS SISSSSTYKYYVDSIKGRFTISRDNAKNSLYLQMESLGVEDTAVYYCSR ADWDSGKGDLDSWGQGTLVTVSS BDBV255_VL (SEQIDNO:279) QPVVTQSPSASASLGASVRLTCTLNSGRSKYAIAWHQQQPGKGPRYLMT LNHDGSHSKGDGIPFRFSGSSSGTERYLTISSLQSEDEADYYCQTWGKG IVVFGGGTKLTVLG BDBV432_VH (SEQIDNO:280) QVQLVQSGPRLVKPSETLSLTCTVSGDSSGRYYWSWIRQTPGKGLEWIG YISYTGSTNYNPSLKSRVTISSDMSKSHFSLNLTSVTAADTAVYYCARG GWNLLVSYFDFWGLGTLVTVSS BDBV432_VL <NotYetAvailable> BDBV91_VH (SEQIDNO:281) QVQLVQSGAELKPPGASVKVSCKPSGYTFTDYYIHWVRQAPGQGLEWMG WINPKSGETHYAQKFRGWVTLTRDTSISTTYMDLTRLKSDDTAVYFCAR GDLETTIFFYNAVDVWGQGTLVTVSS BDBV91_VL (SEQIDNO:282) DIQMTQSPSSLSASVGDRVTITCRATESIGIYLNWYQRKPGKAPNLLIF ATSSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQGFSSPFSF GQGTRLEIK

(199) TABLE-US-00005 TABLE4 VariableRegionNucleicAcidSequences BDBV43VH (SEQIDNO:13) caggtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtc tcctgcagggcttctggagactccttcagccgcaagtatggcatcagctgggtgcgacag gcccctggacaaggatttgagtggatgggaacgatcatgccaatcgttggtttgaccacc tccgcccagaaattccagggcagagtcacaattaccgcggacaagtccacgagcacagcc cacatggaactgaacagcctgacatctgaggacacggccatttattactgtgcgagagat gaaattattggggctcgaccccactggttcgactcttggggccagggaaccctggtcacc gtctcctca BDBV43VL (SEQIDNO:14) gaaattgtgatgacccagtctccagccatcatgtctgtgtctccagggaaaagagccacc ctctcctgcagggccagtcagagtgtcagtagcaacttagcctggtaccagcggaaacct ggccaggctcccaggctcctcatctatggttcttccaccagggccactggtatcccagcc aggttcagtggcagtgggtctgggacagagttcactctcaccatcagcagcctgcagtct gaggattttgcagtttattactgtctgcaatattataactggcctcggacgttcggccaa gggaccaaggtggaaatcaaa BDBV223VH (SEQIDNO:15) caggtgcagctacagcagtggggcgcaggactgttgaagccttcggagaccctgtccctc acctgcgctgtctatggtgggtccttcacgactacctactggaattggatccgccagccc ccagggaaggggctggaatggataggggaagtcaattatagtggaaacgccaactacaac ccgtccctcaagggtcgagtcgccatatcagtggacacatccaagaaccagttctccctg aggttgaactctgtgaccgccgcggacacggctatatattactgtacgagtcgcatacgt tcgcacattgcctactcgtggaagggggacgtctggggcaaagggaccacggtcaccgtc tcctca BDBV223VL (SEQIDNO:16) gaaattgtgatgacccagtctccaggcaccctgtctttgtctccaggggaaagagccacc ctctcctgcagggccagtcagagtgttcccaggaattatataggttggttccagcagaaa cctggccaggctcccaggctcctcatctatggtgcatccagcagggccgctggcttccca gacagattcagtggcagtgggtctgggacagacttcactctcaccatcaccagactggag cctgaagattttgcaatgtattactgtcaccagtatgataggttaccgtacacttttggc caggggaccaagctggagatcaaa EBOV49VH (SEQIDNO:17) gaggtgcagctggtggagtctgggggaggcttggtacagcctggagggtccctgagactc tcctgtgcagcctctggattcaccttcagtagttatgaaatcaactgggtccgccaggct ccagggagggggctggagtgggtttcatacattagtagtagtggtagaaccatatactac gcagactctgtgaagggccgattcaccatctccagagacaacgccaagaactcactgtat ctgcaaatgaacagcctgagagccgaggacacggctgtttattactgtgcgagagaacca tatgttgacggaatattatatggggccggggatagctactttgactactggggccaggga accctggtcaccgtctcctca EBOV49VL (SEQIDNO:18) gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcacttgccgggcaagtcagagcattagcaactatttaaattggtatcagcagaaacca gggaaagcccctaaggtcctgatctatgctgcatccagtttgcaaagtggggtctcatca aggttcagtggcagtggatctgggacagacttcactctcaccatcagcagtctgcaacct gaagattttgcaacttacttctgtcaacagagttacaatacccctccggtcaccttcggc caagggacacgactggagattaaa EBOV52VH (SEQIDNO:19) caggtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctc aactgcactgtctctggtggctccatcagtagttactactggagctggatccggcagccc ccagggaagggactggagtggattgggtatatctatgacagtgggagaaccaagtacaac ccctccctcaagagtcgagtcaccatatcattagacacgtccaagaaccagttctccctg aagctgagctctgtgaccgccgcagacacggccgtgtattactgtgcgagtctgggccat tcgacaaattatggttcggggagttgttgccgggatggttcgacccctggggccagggaa ccctggtcaccgtctcctca EBOV52VL (SEQIDNO:20) gaaattgtgttgacacagtctccagccaccctgtctttgtctccagggggaagagccacc ctctcctgcagggccagtcagagtgttcacaactacttagcctggtaccaacagaagtct ggccaggctcccaggctcctcatctatgatgcatccaacagggccactggcatcccagcc aggttcagtggcagtgggtctgggacagacttcactctcaccatcagcagcctggagcct gacgattttgcagtttattactgtcagcaccgtagcaactggctcactttcggcggaggg accaaggtggagatcaaa EBOV63VH (SEQIDNO:21) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactc tcctgtgcggcctctggattcaccttaaatttctataacatgaactgggtccgccaggct ccagggaaggggctggagtgggtctcatccattagtagtagtagtaattacatatactac gcagactcagtgaagggccgattcaccatctccagagacaacgccaggaagtcactgtat ctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtgcgagagatttt gtccagctattaattccgcaaagggacgagtggcagggtgtccacgactactacggtatg gacgtctggggccaagggaccctggtcaccgtctcctca EBOV63VL (SEQIDNO:22) gaaattgtgttgacgcagtctccaggcaccctgtctttgtctccagggggaagagccacc ctctcctgcagggccagtcagagtgttagcaacagctacttagcctggtaccagcagaaa cctggccaggctcccaggctcctcatctatggtgcatccagcagggccactggcatccca gacaggttcagtggcagtgggtctgggacagacttcattctcaccatcagcagactggag cctgaagattttgcagtgtattactgtcagcactatggtagctctcagctcactttcggc ggagggaccaaggtggagatcaaa EBOV82VH (SEQIDNO:23) gaggtgcagctggtggagtctgggggaggcttggtaaagcctggggggtcccttagactc tcctgtgcagcctctggattcacttttactaacgcctggatgaactgggtccgccaggct ccagggaaggggctggagtgggttggccgtattaaaagcaacactgatggtgggacaaca gactacgctgcacccgtgaaaggcagattcaccatctcaagagatgattcaaaaaagacg ctgtatctgcaaatgaacagcctgaaaaccgaggacacagccgtgtattactgtaccaca gggaaaagtgactgtagtggtggtaactgctacgtggttgactactggggccagggaacc ctggtcaccgtctcctca EBOV82VL <NotYetAvailable> EBOV90VH (SEQIDNO:24) gaggtgcagctggtggagtctgggggaggcttggtaaagcctgggggggcccttagactc agctgtgcagcctctggattcactttcagtaacgcctggatgagctgggtccgccaggct ccagggaaggggctggagtgggttggccgtattaaaagcaaaaatgatggtgggacagca gactacgctgcacccgtgaaaggcagattcagcatctcaagagatgattcaaaaaacacg ctttatctgcaaatgaacagcctgaaaatcgaggacacagccgtgtattactgtatcacg tttttacgccccgaccactggggccagggaaccctggtcaccgtctcctca EBOV90VL <NotYetAvailable> EBOV9VH (SEQIDNO:76) CAGGTGCAGCTGGTGCAGTCTGGGGTTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTC TCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATACTATCAGCTGGGTGCGACAGGCC CCTGGACAAGGGCTTGAGTGGATGGGAAGGATCATCCCTAAGCTTGGTATAGCAAACTAC GCACAGAACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACAAATCCACGAGC ACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGAGGACACGGCCCTGTATTACTGTGCG AGAGTATTACTGAGTAGCAGGGATGCTTTTGATATCTGGGGCCAAGGGACCCTGGTCACC GTCTCCTCA EBOV9VL (SEQIDNO:77) QVQLVQSGVEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGRIIPKLGIANY AQNAQKFQGRVTITADKSTSTAYMELSRLRSEDTALYYCARVLLSSRDAFDIWGQGTLVT VSS EBOV109VH (SEQIDNO:78) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTC TCCTGCAAGGCTTCTGGATACACCTTCACCGGCTACTATATGCACTGGGTGCGACAGGCC CCTGGACAAGGGCTTGAATGGATGGGATGGATCAACCCTAACAGTGGTGGCACAAACTAT GCACAGAAGTTTCAGGGCTGGGTCACCATGACCAGGGACACGTCCATCAGCACAGCCTAC ATGGAGCTGAGAAGGCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGACCAACAAA GGAACTAACGGTCGCTACTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCCTGGTC ACCGTCTCCTCA EBOV109VL (SEQIDNO:79) GACATTGTGATGACCCAGTCTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCGGCCTCC ATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCATAGTAATGGATACAACTATTTGGATTGG TACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTAATCGGGCC TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATCAGGCACAGATTTTACACTGAAAATC AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCATGCAAGCTCTACAAACTATC ACCTTCGGCCAAGGGACACGACTGGAGATTAAA EBOV119VH (SEQIDNO:80) CAGGTGCAGCTGGTGCAGTCTGGGGTTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTC TCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATACTATCAGCTGGGTGCGACAGGCC CCTGGACAAGGGCTTGAGTGGATGGGAAGGATCATCCCTAAGCTTGGTATAGCAAACTAC GCACAGAACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACAAATCCACGAGC ACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGAGGACACGGCCCTGTATTACTGTGCG AGAGTATTACTGAGTAGCAGGGATGCTTTTGATATCTGGGGCCAAGGGACCCTGGTCACC EBOV119VL <NotYetAvailable> EBOV62VH (SEQIDNO:283) gaggtgcagctggtggagtctgggggaggcttggtccagcctggggggtccctgagactc tcctgtgcagcctctggattcacctttagtagctattggatgagctgggtccggcaggct ccagggaaggggctggagtgggtggccaacataaagcaagatggaagtgcgaaatactat gtggactctgtgaagggccgattcaccatctccagagacaacgccaagaactcgctgtat ctgcaaatgaacagcctgagagccgaggacacggccgtctattactgtgcgagagatgga ttactcgggatcagtgatttattataccccatatactactttgactactggggccaggga accctggtcaccgtctcctca EBOV62VL (SEQIDNO:284) gacattgtgatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcacttgccgggcaagtcagaacattgggagctatttaaattggtatcagcagaaacca gggaaagcccctaacctcctgatgtatgctgcatccagtttgcaaagtggggtcccatca aggttcagtggcagtggatctgggacagatttcactctcaccatcaccagtctgcaacct gaagattttgcaacttactactgtcaacagagttacagtatccctcgaacttttggccag gggacccagctggagattaaa EBOV87_VH (SEQIDNO:285) caggttcagctggtgcagtctggagctgaggtgaagaggcctggggcctcagtgaaggtc tcctgcaaggcttctggttacacctttaccagctacgctatcagctgggtgcgacaggcc cctggacaagggcttgagtggatgggatggatcagcggtaacaatggtaacacaaactat gcacagaagctccagggcagactcaccatgaccacagacacatccacgagcacagcctac atggagctgaggagcctgagatctgacgacacggccgtttattactgtgcgagagatgcc gatattgtcgtggtggtaggtgctacggggacctactactacggtatggacgtctggggc caagggaccctggtcaccgtctcctca EBOV87_VL (SEQIDNO:286) gacatcgtgatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcacc atcacttgccgggccagtcagagtattagtagctggttggcctggtatcagcagaaacca gggaaagcccctaagctcctgatctatgatgcctccagtttggaaagtggggtcccatca aggttcagcggcagtggatctgggacagaattcactctcaccatcagcagcctgcagcct gatgattttgcaacttattactgccaacagtataaaagttctctgaggacgttcggccag gggacccagctggagattaaa EBOV157VH (SEQIDNO:287) caggtgcagctggtgcagtctgggggaggcttggtccagcctggggggtccctgagactc tcctgtgcagcctctggattcaccgtcagtaacaactacatgagctgggtccgccaggct ccagggaaggggctggagtgggtctcaattttttatagcgatggtaccacatacaacgca gactccgtgaagggcagattcaccatctccagagacaattccaagaacacgctgtatctt caaatgaacagcctgagagccgaggacacggctgtgtattactgtgcgagacaagcaagt ggctacgacgcctactacatggacgtctggggccagggaaccctggtcaccgtctcctca EBOV157VL (SEQIDNO:288) gacatygtgatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcacc atcacttgccgggccagtcagagtattaatagctggttggcctggtatcagcagaaacca gggaaagcccctaagctcctgatctatcaggcgtctactttagaaagaggggtcccatca aggttcagcggcagtggagctgggacagaattcactctcaccattagcagcctgcagcct gatgattttgcaacttattactgccaacaatatagtagtttcccgctcactttcggcgga gggaccaaggtggagctcaaa BDBV289VH (SEQIDNO:289) caggtgcagctggtgcagtctggggctgaagtgaagaagcctgggtcctcggtgaaggtc tcctgcaaggcttctggagccaccttcggcagcgatactgtcacctgggtgcgacaggcc cctggacaagggcttgagtggatgggagggatcatccctttttttggtgaagcaaactac gcacagaggtttcagggcagagtcacgataaccgcggacaagtccacgaacacagcctac atggaactgagcagcctgagatctgaggacacggccgtgtacttctgtgcgagacaaata aacgagatggctacatttggggagatacattattatacgtacatggatgtctggggccaa gggaccctggtcaccgtctcctca BDBV289VL <NotYetAvailable> BDBV41VH <NotYetAvailable> BDBV41VL (SEQIDNO:290) gaaattgtgatgacccagtctccaggcaccctgtctttgtctccaggggaaagagccacc ctctcctgcagggccagtcagagtattaccagcacctacttagcctggtaccagcagaaa cctggccaggctcccaggctcctcatctatggtgcatccaacagggccactggcatccca gacaggttcagtggcagtgggtctgggacagacttcactctcaccatcagcagactggag cctgaagattttgcagtgtattactgtcagcagtatcatagctcacttttcggcggaggg accaaggtggagatcaaa BDBV231VH (SEQIDNO:291) caggtgcagctggtgcagtcgggcccaggtctggtgaagccttcggagaccctgtccctc acctgcactgtctctagtgactccatcaggagttactcctggagctggctccggcagccc ccagggaagggcctggagtggattgggtttatctattacagtgggaacatcaattacaac ccgtccctcaagagtcgagtcaccatatcagtagacacgtccaagaaccagttgtccctg aacctgagctctgtgaccgctgcggacacggccgtgtattattgtgcgagagattggatt acgatttttgggaggtacttcgatgtctggggccgtggcaccctggtcaccgtctcctca BDBV231VL (SEQIDNO:292) gacatcgtgatgacccagtctccagactccctggctgtttctctgggcgagagggccacc atcaactgcaagtccagccagaatcttttatacagctccaacaataagaacttcttaact tggtaccaacacaaaccaggacagcctcctaagctgctcatttcctgggcatctactcgg gaatccggggtccctgaccgattcagtggcagcgggtctgggacagatttcactctcacc atcagcagcctgcaggctgaagatgtggcactttattactgtcagcaatattatactatt cctccaacgttcggccaagggaccaaggtggaaatcaaa BDBV275_VH (SEQIDNO:293) caggtgcagctggtgcagtctgggggaggcttcgtacagccagggcggtccctgagactg tcctgtacagcctctggattcaactttggtgattatgttatgagctgggtccgccaggct ccagggaaggggctggagtgggtaggtttcattaggggcaaaacttttggtgcgacaaca gagtacgccgcgtctgtgaaaggcagatttaccatctcaagggatgattccaaaagcatc gcctacctgcaaattaaatccctgaaaaccgaggacacagccgtctactattgtactaga agggccaccagcacctggtacgaggactattggggccagggaaccctggtcaccgtctcc tca BDBV275_VL (SEQIDNO:294) gacatcgtgatgacccagtctccggactccctggctgtgtctctgggcgagagggccacc atcaactgcaagtccagccagagtgttttatacacccccaacaatcataattacttagct tggtaccagcagaaaccaggacagcctcctaagctgctcatttactgggcatctgcccgg gaacccggggtccctgaccgattcagtggcagcgggtctgggacagatttcactctcacc ataagcagcctgcaggctgaggatgtggcagtttattactgtcagcaatatcatattcct ccgtacagttttggccaggggaccaagctggagatcaaa BDBV315_VH (SEQIDNO:295) caggtgcagctggtgcagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcactgtctctggtgactccatcagcagtggtagttactactggagctggatccgg cagcccgccgggaagggactggagtggattgggcgtatctataccagtgggagcaccaac tacaatccctccctcaagagtcgagtcaccatttcagtagacacgtccaagaaccagttc tccctgaacctgagctctgtgaccgccgcagacacggccgtgtattactgtgcgagagat ccgattacgatttttggaggggttattttcggctggggaatggacgtctggggccaaggg accctggtcaccgtctcctca BDBV315_VL (SEQIDNO:296) gacattgtgatgacccagtctccactctccctgcccgtcacccctggagagccggcctcc atctcctgcaggtctagtcagaccctcctgcatagtaatggatacaactatttgtattgg tacctgcagaagccagggcagtctccacagctcctgatctatttgggttctaatcgggcc tccggggtccctgacaggttcagtggcagtggatccggcacagattttacactgaaaatc agcagagtggaggctgaggatgttggggtttattactgcatgcaagctctacaaactccc gtcactttcggccctgggaccaaagtggatatcaaa BDBV329_VH (SEQIDNO:297) caggtccagctggtgcagtctggggctgaagtgaagaagcctgggtcctcagtgaaggtc tcctgcaaggcttctggaggcaccttcgacacctatgctatcagctgggtgcgacaggcc cctggacaagggcttgagtggatgggagggattatccctgttcttggtatagtagattat gcacagaagttccagggcagagtcacaattactgcggccaaattcacgaacatagcctac atggagctgagcagcctgagatctgaggacgcggccgtgtattactgtgcgagaggcctg cggagcctttctccccggggacaagagggacctactccagcgcccgggtggagaagggct caataccactactactacatggacgtctggggcacagggaccctggtcaccgtctcctca BDBV329_VL (SEQIDNO:298) gaaattgtgatgacccagtctccaggcaccctgtctttgtctccaggggaaagagccacc ctctcctgcagggccagtcagagtgttagtagcaactatttagcctggtaccagcaaaaa cctggccaggctcccaggctcctcatctatggtgcatccagcagggccactggcatccca gacaggttcagtggcagtgggtctgggccagacttcactctcaccatcagcagactggag cctgaagattttgcagtgtattattgtcagcagtatggtagttcacccggcactttcggc ggagggaccaaggtggagatcaaa BDBV335_VH (SEQIDNO:299) caggtgcagctgcaggagtcgggcccaggactggtgaggccttcacagaccctgtccctc acctgcactgtgtctggtggctccatcaacagtgatagttactactggaactggatccgg cagcccgccgggaagggactggagtggcttgggcgtgtctataccagtgggagcaccaac tacaacccctccctcaagagtcgagtcaccatatcagtagacacgtccaagaaccaggtc tccctgaggctgaactccgtgaccgccgcagacacgggcgtatattactgtgcgagagtg gtttgggggagttatcgttcctaccactactcctacggtatggacgtctggggccaaggg accctggtcaccgtctcctca BDBV335_VL (SEQIDNO:300) gaaattgtgatgacccagtctccaggcaccctgtctttgtctccaggggaaagagccacc ctctcctgcagggccagtcagagtgttggcagcagctacttagcctggtaccagcagaga cctggccaggctcccaggctcctcttctatggtgcatcctacagggccactggcatccca gacaggttcagtgccagtgggtctggaacagacttcagtctcaccatcaacagactggag cctgaagattttgcagtctattactgtcagcagtctggtagctcgccggagacttttggc caggggaccaagctggagatcaaa BDBV354_VH (SEQIDNO:301) caggtgcagctggtgcagtctggagttgaggtgaagaagcctggggcctcagtgaaggtc tcctgcaaggcgtctggttacgcctttaccacctatgctatcagctgggtgcgacaggcc cctggacaagggcttgagtggatgggttggatcagcacttactatggtaccacatactat gcacagaacctccagggcagagtcaccatgaccacagacacatccacgagcacatcctac ttggaactgaggagcctaagatctgacgacacggccgtctattactgtgtgagagatcgg tcgtggctggccacttcccgaccatatgatgcttttgatatctggggccaagggaccctg gtcaccgtctcctca BDBV354_VL (SEQIDNO:302) gccatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcacttgccgggcaagtcaggacattagcagtactttagcctggtatcagcagaaaccg ggaaaagctcctaaactcctgatctatggtgcctccagtttggaaagtggggtcccatcc aggttcaacggcagtggatctgggacagatttcactctcaccatcagcagcctgcagcct gaagatttcgcaacttattactgtcagcacttttactatttcccccgcaccttcggccaa gggacacgactggagattaga BDBV386_VH (SEQIDNO:303) caggtgcagctggtgcagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcactgtctctggtggctccatcagcagtggtcgtttctactggagctgggtccgg cagcccgccgggaggggactggagtggattgggcgcatctataccagtgggagcaccaac tacaacccctccctcaagagtcgagtcagcatatcagtagacacgtccaagaaccagttc tccctgaagctgagctctgtgaccgccgcagatacggccgtgtattactgtgcgactgaa ctgtactactatggttcggggagttatgacccgctttggtcctggggccagggaaccctg gtcaccgtctcctca BDBV386_VL (SEQIDNO:304) gacattgtgatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcacttgccaggcgagtcagggcattaacaacaatttaaattggcatcagcaaaaacca ggtaaagcccctaagctcctgatctacgatgcatccaatttggaaagaggggtcccatca aggttcagtggaagtggatctgggacagattttactttcaccatcagcagcctgcagcct gaagatattgctacatattactgtcaacagaatgccaatctcccgcacacttttggccag gggaccaagctggagatcaaa BDBV397_VH (SEQIDNO:305) caggtgcagctggtgcagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcactgtctctggtggctccatcagcagtgggagttacttctggaactggatccgg cagcccgccgggaagggactggagtggattgggcgtatctataccagcgggaccaccaac tacaatccctccctcaagagtcgcctcaccatttcagtagacacgtccaagaaccaattc tccctgaagctgaactctgtgaccgccgcagacacggccgtgtattactgtgcgacaagc ccgtattactatgatagttctcattattacgactactggggccagggaaccctggtcacc gtctcctca BDBV397_VL (SEQIDNO:306) gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcacttgccaggcgagtcaggacattaccaactatttaaattggtatcagcagaagcca gggaaagcccctaagctcctgatcttcgatgcttccaatttggaaaagggggtcccatca aggttcagtgctactggatctgcgacagattttactttcaccatcagcagcctgcagcct gaagatactgcgacatattactgtcaacagtctgctgatctccccctcaccttcggccaa gggacacgactggacattaaa BDBV399_VH (SEQIDNO:307) caggtgcagctggtgcagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcaatgtctctggtggctccatcagcaatggtggttaccactggagttggatccgc caggtcccagggaagggcctggagtggattggacacatttattacagtgggagcacctcc tacaccccgtccctcaagagtcgacttaccatatcagtggacacctctaagaaccagttc tccctgaagctgagctctgtgactgccgcggacacggccgtatattactgtgcgagagat aggatacggggcgggcccattgactactggggccagggaaccctggtcaccgtctcctca BDBV399_VL (SEQIDNO:308) gacatccagatgacccagtctccatcctccctgtctgcatctgttggagaaagagtcacc atcacttgccgggcgagtcagggcatcgacaattatttagcctggtatcaacaaaaacca gggaaagttcctaaactcctgatctatgctgcatccactttgcactcaggggtcccatct cggttcagtggcagtggatctgggacagatttcactctcaccatcagcagcctgcagcct gaagatgttgcaacttattactgtcaaaggtataaccttgccccgagcgcttttggccag gggaccaaggtggagatcaga BDBV353_VH (SEQIDNO:309) caggtgcagctggtgcagtctggggctgagatgaggaagcctggggcctcagtgaaggtc tcctgcaaggcttctggatacaccttcagtgactactatatacactgggtgcgccaggcc cctggacaagggcttgagtggctgggatggatcaacccttatagtggaggcacaaattat gcacagaagtttcagggcagggtcaccatgaccagggacacgtccatcagcacagcccac atggagctgagcgggctcagatctgacgacacggccctatatttctgtgcgagactatat ggtgcggggagtcattataatcactacaacggcatggacgtctggggtcaagggaccctg gtcaccgtctcctca BDBV353_VL (SEQIDNO:310) gacatccagatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcacc atcacttgccgggccagtcagagtattggtagtttattggcctggtatcagcagaaaccg gggaaagcccctaagctcctgatctatagggcgtctactttacaaggtggggtcccatca aggttcagcggcagtggatctgggacagaattcactctcaccatcagcagcctgcagcct gatgatgttgctacttattactgccaacaatttaatagttatttcggcggagggaccaag gtggagatcaaa BDBV410_VH (SEQIDNO:311) caggtgcagctgcagcagtcgggcccaggactggtgaggccgtcacagaccctgtccctc acctgctctgtctctggtggctccgtcagtagtggtcgttacttctggaactggatccgg cagtccgccgggaagggactggagtggattgggcgtatccattccagtgggagaaccaac tccaacccctccctcaagagtcgagtcaccatatcagtcgacacgtccaagaaccagttc tccctgcacctgggctctgtgaccgccgcagacacggccgtctattactgtgcgagaga BDBV410_VL (SEQIDNO:312) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctcc atctcctgcaagtctagtcagagcctcctgcatagtaatggagagacctatttattttgg tacctgcagaagccaggccagccgccacaactcctgatctatgaagtttccaaccggttc tctggagtgccagataggttcagtggcagcgggtcagggacagatttcacactgaagatc agccgggtggaggctgaggatgttggagtttattactgcatgcaaagtgtactccttccg tacacttttggccaggggaccaagctggagatcaag BDBV270_VH (SEQIDNO:313) caggtgcagctgcaggagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcactgtctctggtgcctccatcagcaggggtctttactactggagctggatccgg cagcccgccgggaagggactggagtggattgggcgcatctataccagtgggagcatcaac tacaatccttccctcaagagtcgagtcaccatatcagtagacacgtccaagaatcagttc tccctgaggctgagctctgtaatcgccacagacacggccgtgtattattgtgtgagagat gctccctggggagattttttgactggttattttggcttctacggtatggacgtctggggc caagggaccctggtcaccgtctcctca BDBV270_VL (SEQIDNO:314) gacattgtgatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcacttgccgggcaagtcagagcattaacacctatttaaattggtatcagcagaaacca gggaaagcccctaagttcctgatctatgctgcatccagtttgcacagtggggtcccatca aggttcagtggtagtggatctgggacagatttcactctcaccatcaacagtctacaacct gatgattttgcaacttactactgtcaacagagtttcactaccccgtacacttttggccag gggaccaagctggagatcaag BDBV324_VH (SEQIDNO:315) caggtgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtc tcctgtaagacttctggatacaccttcaccagctttgaaatccactgggtgcgacagggc agtggacaagggcttgagtggatgggacgtatgaatcctaaaagtggtgacacagtctct gcacagaagttccagggcagagtcacccttaccagggacacgtccataaatgcagcctac atggagctgggcagcctgagttctgaggacacggccgtgtactactgtgcgagaggccca cacgttggcgaagttgttccaggtcttatggcgggcacctactattttcctttggacgtc tggggccaagggaccctggtcaccgtctcctca BDBV324_VL (SEQIDNO:316) gacatccagatgacccagtctccctccaccctgtctgcatctataggagacagagtcacc atcacttgccgggccagtcagagcattagtcgctggttggcctggtatcagcagaaacca gggaaagcccctaaactcctgatctataaggtgtctgatttacaaagtggggtcccatca aggttcagcggcagtggatatgggacagaattcactctcaccatcggcagcctgcagcct gatgatttggcaacttattattgccaacaatatgatacatatccgtggacgttcggccag gggaccaagctggagatcaag BDBV403_VH (SEQIDNO:317) caggtccagctggtgcaatctggggctgaggtgaagaagcctgggtcctcggtgaaggtc tcctgcaacgcttctggaggcaccttcagcaactccattcttaactgggtgcgacaggcc cctggacaagggcttgagtggatgggaaggatcatccctatcgttggtctagtaaacttc gcacaaaagttcgagggcagagtcacatttaccgcggacaaattcacgaacacagcctac atggagctgaacagtctgagatttgaggacacggccgtgtactactgtgcgataaatggg gtaaatatcccggatactttgactactggggccagggaaccctggtcaccgtctcctca BDBV403_VL (SEQIDNO:318) gacattgtgatgacccagtctccaggcaccctgtctttgtctccaggggaaagagccacc ctctcctgcagggccagtcagagtgtgagcagcagctacttagcctggtaccagcaccaa cctggccaggctcccaggctcctcatctatgatgcatccagcagggccactggcatccca gacaggttcagtggcagtgggtctgggacagacttcactctcatcatcagcagactggag cctgaagattttgcagtgtattactgtcagcagtatggaagctcagcgatcaccttcggc caagggacacgactggagatcaag BDBV407_VH (SEQIDNO:319) caggtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctc acctgcgctgtctctggtggctccatcaggagttatttctggagctggatccggcaggcc ccagggaagggactggaatggattgggaatatctattacagtgggcgccccaattacaac ccctccctcaagaatcgagtcaccatatcagcagacacgtccaacaatgaggtctcactg gagctgagcgctgtgaccgctgcggacacggccgtgtatttctgtgcgagagatgagaga ctactggtggaggtcggaaccgaccacttctactacggtttggacgtctggggccaaggg accctggtcaccgtctcctca BDBV407_VL (SEQIDNO:320) gaaattgtgatgacccagtctccactctccctgtctgtcacccctggagagccggcctcc atctcctgcaggtctagtcagagcctcctacatagtaatggatacaactttttggattgg tatttgcagaagccagggcagtctccacagctcctgatttatttgggttctaatcgggcc tccggggtccctgacaggttcagtggcagtggatccggcgcagattttacactgaaaatc agcagagtggaggctgaggatgttggggtnnattactgcatgcaagct BDBV425_VH (SEQIDNO:321) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtc tcctgcaaggcctcgggctacacctttaccagttttggtatcagctgggtgcgacaggcc ccgggacaagggctagagtggctgggatggatcaacacttacaatggtgacacaaactat gcacagaagttccagggcagagtcaccatgacaacagatacatccacgagtacaggcttc atggagctgaggagcctgagatctgacgacacggccgtctattactgtgcgagagactcc cacttaataagtatagcagtggctaatacgcccaatgacttctggggccagggaaccctg gtcaccgtctcctca BDBV425_VL (SEQIDNO:322) gaaattgtgatgacccagtcgccaggcaccctgtctttgtctccaggggacagagtcacc ctctcctgcagggccagtcagagtgtttacagctactacttagcctggtaccagcagaaa cctggccaggctcccaggctcctcatgtatgatgcatccatcagggccactggcatccca gacaggttcagtggcagtgggtctgggacagacttcactctcaccatcagcagtctggag cctgaagattttgcagtgtactactgtcagtactatggtaactcacaccagggggcggcg ttcggccaagggactaaggtggaagtcaaa BDBV426_VH (SEQIDNO:323) caggtgcagctgcaggagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcaatgtctctggtggctccatcagcagtgatgatagatactggagctggatccgc cagcccccagggaagggcctggagtggcttgggttcatctattacagtgggagcaccgac tacaacccgtccctcaagagtcgagttaccatgtcactagacacctccaagaaccagttc tccctgaagctgaactctgtgactgccgcagacacggccatgtattactgtgccacagta acagcttactctcctgctactatgatagtagtgggtaccgaacatgggtttgactactgg ggccagggaaccctggtcaccgtctcctca BDBV426_VL (SEQIDNO:324) gacattgtgatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc atcttttgccgggcaactcagagcattcgcagctttttaaattggtatcagcagaaacca gggaaagcccctaacctcctgatctatgctgcatccagtttgcaaagtggggtcccatcc aggttcagtggcagtggatctgggacagatttcactctcaccatcagcagtctacaacct gaagattttgcaacttactactgtcaacagagttacagtaccccatggacgttcggccaa gggaccaaggtggagatcaag BDBV317_VH (SEQIDNO:325) aggtgcagctggtggagtctgggggaggcgtggtccagcctggggggtccctgagactct cctgtgaagtgtccggactcaccttcagtaactttggcatgcagtgggtccgccaggctc caggcaagggtctggagtgggtggcctttatacggtttgatggaagtaataagtattatg cagactccgtgaagggccgattcaccatatccagagacaactccaagaacacggtttatc tccaaatgggcagcctgagagccgaggacacggcagtgtatttttgtgggagagttctat acggagccgcagctgacttttggggccagggaaccctggtcaccgtctcctca BDBV317_VL (SEQIDNO:326) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccacc atcaactgcacgtccagtcacagtcttttatacagctccgacaataagaactatttaact tggtaccagcagaaagcaggacagcctcctaagctgctcatctactgggcttctacccgg caatccggggtccctgaccgattcagtggcagcgggtctgggacagagttcactctcacc atcagcagcctgcaggctgaagatgtggcagtctattactgtcagcagtattatactaag tctttcactttcggccaagggaccaaggtggagatcaag BDBV342_VH (SEQIDNO:327) caggtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcgtcggtgaaggtc tcctgcaaggcctctggaggcaccttcagcagctatgctatcaactgggtgcgacaggcc cctggacaagggcttgagtggatgggagggatcatccctatctttggtaaaccaaactac gcacagaagttccagggcagagtcacgattaccgcggacaaatccacgagcacagcctac atggaactgagaagcctgagatctgaggacacggccgtatattactgtgcgcggggacag ggagagattgtggtgatggttggtcatgacgacgggggggactaccttggctactggggc cagggaaccctggtcaccgtctcctca BDBV342_VL (SEQIDNO:328) cagtctgccctgactcagcctcgctcggtgtccgggtctcctggacwgtcagtcaccatc tcctgcactggaaccagcagtaatgttggtgcttataactatgtctcctggtaccaacaa cacccaggcaaagcccccaaactcatgatttttgatgtcactaagcggccctcaggggtc cctgatcgcttctctggctccaagtctggcaacacggcctccctgaccatctctggactc caggctgaggatgaggctgatttttactgctactcatatgcaggcagctacacttggatt ttcggcggagggaccaagctgaccgtcctaggt BDBV357_VH (SEQIDNO:329) caggtgcagctggtgcagtcgggcccaggactggtgaagccttcggagaccctgtccctc acctgcagtgtctctggtggctccatcagtggttccatctggacctggatccggcagtcc ccagggaagggactggagtggattggatatatctctttaagtgggagcaccaacttcaac ccctccctcaagagtcgagtcaccatttcagtagacacgtccaagaaccagttctccctg aagctgagctctgtgaccgccgcagacactgccgtgtattactgtgcgagacatcggaaa tcgtcgaagatggttcgaggaattgaagttttctactactactacatggacgtctggggc aaagggaccctggtcaccgtctcctca BDBV357_VL (SEQIDNO:330) cagtctgccctgactcagcctgcctccgtgtctgggtctcctggacagtcgatcaccatc tcctgcactggaaccatcagtgacattggtggttatgactatgtctcctggtaccaacaa cacccaggcaaagcccccaaactcatgatttatgatgtcagtgatcggccctcaggggtt tctaatcgcttctctggctccaagtctggcaacacggcctccctgaccatctctgggctc cagtctgaggacgaggctgattattactgcagttcatatacaagaacttacactccccac gtggtattcggcggagggaccaagctgaccgtcctaggt BDBV340_VH (SEQIDNO:331) caggtgcagctggtgcagtcgggcccaggactggtgaagccttcacagaccctgtccctc acctgcactgtctctggtggctccatcagcagtggaagtttctactggagctggatccgg cagcccgccgggaagggactggagtggattgggcgtttctataccactggaagcacccac tacaatccctccctcaagagtcgagtcaccatatcggcggacacgtcgaagaaccacttc tccctgaacctcacttctttgaccgccgcagacacggccgtttattactgtgcgagaggg ccggtctcctattatagtggcaacctctactactttgactactggggcctgggaaccctg gtcaccgtctcctca BDBV340_VL (SEQIDNO:332) cagtctgccctgactcagcctgcctccgtgtctgggtctcctggacagtcgatcaccatc acctgcactggaaccagcagtgacattggtaataataactatgtctcctggtaccaacag cacccaggcaaggcccccaaactcatcatttttgatgtcaataagcgaccctcaggggtt tctaaccgcttctctggctccaagtctgacaacacggcctccctgaccatctctgggctc caggctgaggacgaggctgattattactgcagctcatatacaaacaacaggactttctcc ttcggaggtgggaccaaggtcaccgtccta BDBV392_VH (SEQIDNO:333) caggtgcagctggtgcagtctgggggaggcgtggtccagcctggggggtccctgagactc tcctgtgcagcgtctggattcaccttcagtagctttggcatccactgggtccgccaggct ccgggcaaggggctggagtgggtggcatttatacgatatgatggaagtgataagttctat ttagactccgtgaagggccgattcaccatctctagagacaattccaagaatacgctgttt ctgcaaatgagcagccttagagttgaagacacggctgtgtattactgtgcgaagagaggg gggcatgattatggttactacgacaacaatcgctacatcgatctctggggccgtggcacc ctggtcaccgtctcctca BDBV259_VL (SEQIDNO:334) tcctatgtgctgactcagccaccctcagtgtccgtgtccccgggacagacagccagcatc acctgctctggagataaattgggggatagatatacttgctggtatcaacagaagccaggc cagtcccctgtattggtcatctatcaagatactaagcggccctcagggatccctgagcga ttctctggctccaactctgggaacacagccactctgaccatcagcgagacccaggctata gatgaggctgactattactgtcaggcgtgggacaccagca BDBV415_VH (SEQIDNO:335) caggtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtc tcctgcaaggcttctggaggcaccttcagcagttatggtgttagctgggtgcgacaggcc cctggacaagggcttgagtggatgggagggatcatccctaagtttgctacagcaaaatac gcacagaagttccagggcagagtcacgattaccgcggacgaatccacgagcacagcctac atggagctgagcagcctgagatctgaggacacggccgtgtattactgtgcgggacacttc ccccagaggaaaccgattactacgatagtagtgattacttactggtccctcgatctctgg ggccgtggcaccctggtcaccgtctcctca BDBV343_VH (SEQIDNO:336) caggtgcagctggtggagtctggggctgaggggaagaagcctgggtcctcggtgaaggtc tcctgcaaggctccaggagtcaccttcagcagatataccatcagctgggtgcgacaggcc cctggacaggggcttgagtggatgggaaggatcagcccaatccttggcacagcaaactac gcacagaagttccagggcagagtcacgattaccgcggacaaatcctcgagcacagtctac atggaactgaacagactgaaatctgacgacacggctgtatattactgtgcgagagatgca ccgattattctggttgagggaccggagaccggtatggacgtctggggccaagggaccctg gtcaccgtctcctca BDBV343_VL (SEQIDNO:337) cagtctgccctgactcagcctcgctcagtgtccgcgtctcctggacagtcagtcaccatc tcctgcactggcaccaacagtgatgttggtggttatgactatgtctcctggtaccagcaa cacccaggcaaagcccccaaactcatgatttctgatgtcaatatgcggccctcaggggtc cctgatcgcttctctggctccaagtctggcaacacggcctccctgaccatctctgggctc caatctgaggatgaggctgattattactgctgctcatatgcaggcagctacacttttgtc ttcggaagtgggaccaaggtcaccgtcctaggt BDBV377_VH (SEQIDNO:338) caggtgcagctggtgcagtctgggggaggcgtggtccagcctgggaggtccctgagactc tcctgtgcagcgtctggattcaccttcaatagctatggcatgcactgggtccgccaggct ccaggcaaggggctggagtgggtggcagttatatggtttgatggaagtaaaaaatactat gcagactccgtgaagggccgattcaccatctccagagacaattccaagaactcactgtac ttgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgaaagacctc ctgtatggttcggggatggtcccaaattactactactacggtttggacgtctggggccaa gggaccctggtcaccgtctcctca BDBV377_VL <NotYetAvailable> BDBV255_VH (SEQIDNO:339) caggtgcagctggtgcagtctgggggaggcctggtcaggcctggggggtccctgagactc tcctgtacggcctctggattcaccctcagtacttatagcatgacctgggtccgccaggct ccagggaagggcctggagtgggtctcatccatcagtagttcgtctacctacaagtactac gtggactcgattaagggccgattcaccatctccagagacaacgccaagaactcactgtat ctgcaaatggagagcctgggagtcgaggacacggctgtgtattactgttcgagagcggac tgggactccgggaaaggagaccttgactcctggggccagggaaccctggtcaccgtctcc tca BDBV255_VL (SEQIDNO:340) cagcctgtggtgactcagtcgccctctgcctctgcctccctgggagcctcggtcagactc acctgcactctcaacagcgggcgcagtaaatacgccatcgcatggcaccagcaacagcca gggaagggccctcgctacttgatgacacttaatcatgatggcagtcacagcaagggagac gggatcccttttcgcttctcaggctccagctctgggactgagcgctacctcaccatctcc agcctccagtctgaggatgaggctgactattactgtcagacttggggcaagggcatcgtg gtattcggcggagggaccaagctgaccgtcctaggt BDBV432_VH (SEQIDNO:341) caggtgcagctggtgcagtcgggcccacgactggtgaagccttcggagaccctgtccctc acctgcactgtctctggtgactccagcggtcgttactactggagctggatccggcagacc ccagggaagggactagaatggattgggtatatctcttacactgggagcaccaactacaac ccctccctcaagagtcgagtcaccatatcttcagacatgtccaagagccacttctccctg aacttgacctctgtgaccgctgcggacacggccgtgtattattgtgcgagagggggatgg aacctcctagtaagctactttgacttctggggcctgggaaccctggtcaccgtctcctca BDBV432_VL <NotYetAvailable> BDBV91_VH (SEQIDNO:342) caggtgcagctggtgcagtctggggctgagttgaagccgcctggggcctcagtgaaggtc tcctgcaagccttctggatacacgttcaccgactactatatacactgggtgcgacaggcc cctggacaagggcttgagtggatgggatggatcaaccctaaaagtggagaaacacactat gcacagaagtttcggggctgggtcaccttgaccagggacacgtccatcagcacaacctac atggacctgaccaggctgaaatctgacgacacggccgtgtatttctgtgcgagaggggat ctagagactacgatcttcttctacaacgctgtggacgtctggggccaagggaccctggtc accgtctcctca BDBV91_VL (SEQIDNO:343) gacatccagatgacccagtctccatcttccctgtctgcatctgtaggagacagagtcacc atcacttgccgggcaactgagagtattggcatctatttaaattggtatcagcggaaacca gggaaggcccctaacctcctgatctttgctacatccagtttgcagagtggggtcccgtca aggttcagtggcagtggatctgggacagaattcactctcaccatcagcagtctgcaacct gaagattttgcaacttacttttgtcaacagggtttcagttctcctttcagttttggccag gggaccaggctggagatcaag

(200) All of the compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this disclosure have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the disclosure as defined by the appended claims.

VII. REFERENCES

(201) The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. U.S. Pat. No. 3,817,837 U.S. Pat. No. 3,850,752 U.S. Pat. No. 3,939,350 U.S. Pat. No. 3,996,345 U.S. Pat. No. 4,196,265 U.S. Pat. No. 4,275,149 U.S. Pat. No. 4,277,437 U.S. Pat. No. 4,366,241 U.S. Pat. No. 4,472,509 U.S. Pat. No. 4,554,101 U.S. Pat. No. 4,680,338 U.S. Pat. No. 4,816,567 U.S. Pat. No. 4,867,973 U.S. Pat. No. 4,938,948 U.S. Pat. No. 5,021,236 U.S. Pat. No. 5,141,648 U.S. Pat. No. 5,196,066 U.S. Pat. No. 5,563,250 U.S. Pat. No. 5,565,332 U.S. Pat. No. 5,856,456 U.S. Pat. No. 5,880,270 Antibodies: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988. Abbondanzo et al., Am. J. Pediatr. Hematol. Oncol., 12(4), 480-489, 1990. Allred et al., Arch. Surg., 125(1), 107-113, 1990. Atherton et al., Biol. of Reproduction, 32, 155-171, 1985. Brown et al., J. Immunol. Meth., 12; 130(1), 111-121, 1990. Campbell, In: Monoclonal Antibody Technology, Laboratory Techniques in Biochemistry and Molecular Biology, Vol. 13, Burden and Von Knippenberg, Eds. pp. 75-83, Amsterdam, Elsevier, 1984. Capaldi et al., Biochem. Biophys. Res. Comm., 74(2):425-433, 1977. De Jager et al., Semin. Nucl. Med. 23(2), 165-179, 1993. Dholakia et al., J. Biol. Chem., 264, 20638-20642, 1989. Doolittle and Ben-Zeev, Methods Mol. Biol., 109, 215-237, 1999. Gefter et al., Somatic Cell Genet., 3:231-236, 1977. Goding, In: Monoclonal Antibodies: Principles and Practice, 2d ed., Orlando, Fla., Academic Press, 60-61, 65-66, 71-74, 1986. Gulbis and Galand, Hum. Pathol. 24(12), 1271-1285, 1993. Khatoon et al., Ann. of Neurology, 26, 210-219, 1989. King et al., J. Biol. Chem., 269, 10210-10218, 1989. Kohler and Milstein, Eur. J. Immunol., 6, 511-519, 1976. Kohler and Milstein, Nature, 256, 495-497, 1975. Kyte and Doolittle, J. Mol. Biol., 157(1):105-132, 1982. Nakamura et al., In: Enzyme Immunoassays: Heterogeneous and Homogeneous Systems, Chapter 27, 1987. O'Shannessy et al., J. Immun. Meth., 99, 153-161, 1987. Owens and Haley, J. Biol. Chem., 259, 14843-14848, 1987. Persic et al., Gene 187:1, 1997 Potter and Haley, Meth. Enzymol., 91, 613-633, 1983. Remington's Pharmaceutical Sciences, 15th Ed., 3:624-652, 1990. Tang et al., J. Biol. Chem., 271:28324-28330, 1996. Wawrzynczak & Thorpe, In: Immunoconjugates, Antibody Conjugates In Radioimaging And Therapy Of Cancer, Vogel (Ed.), NY, Oxford University Press, 28, 1987. Beniac et al., (2012). The organisation of Ebola virus reveals a capacity for extensive, modular polyploidy. PloS One 7, e29608. Brauburger et al., (2012). Forty-five years of Marburg virus research. Viruses 4, 1878-1927. Brochet et al., (2008). IMGT/V-QUEST: the highly customized and integrated system for IG and TR standardized V-J and V-D-J sequence analysis. Nucleic Acids Res. 36, W503-508. Carette et al., (2011). Ebola virus entry requires the cholesterol transporter Niemann-Pick C1. Nature 477, 340-343. Carragher et al., (2000). Leginon: An automated system for acquisition of images from vitreous ice specimens. J. Struct. Biol. 132, 33-45. CDC (2009). Imported case of Marburg hemorrhagic feverColorado, 2008. MMWR 58, 1377-1381. Chandran et al., (2005). Endosomal proteolysis of the Ebola virus glycoprotein is necessary for infection. Science (New York, N.Y.) 308, 1643-1645. Cook, J. D., and Lee, J. E. (2013). The secret life of viral entry glycoproteins: moonlighting in immune evasion. PLoS Path. 9, e1003258. Ct et al., (2011). Small molecule inhibitors reveal Niemann-Pick C1 is essential for Ebola virus infection. Nature 477, 344-348. Dias et al., (2011). A shared structural solution for neutralizing ebolaviruses. Nat. Struct. Mol. Biol. 18, 1424-7. Dube et al., (2009). The primed ebolavirus glycoprotein (19-kilodalton GP1,2): sequence and residues critical for host cell binding. J. Virol. 83, 2883-2891. Dye et al., (2012). Postexposure antibody prophylaxis protects nonhuman primates from Filovirus disease. Proc. Natl. Acad. Sci U.S.A. 109, 5034-5039. Garbutt et al., (2004). Properties of replication-competent vesicular stomatitis virus vectors expressing glycoproteins of filoviruses and arenaviruses. J. Virol. 78, 5458-5465. Giudicelli et al., (2011). IMGT/V-QUEST: IMGT standardized analysis of the immunoglobulin (IG) and T cell receptor (TR) nucleotide sequences. Cold Spring Harb. Protoc. 2011, 695-715. Hashiguchi et al., Cell 2015, in press. Johnson et al., (1996). Characterization of a new Marburg virus isolated from a 1987 fatal case in Kenya. Arch. Virol. Suppl. 11, 101-114. Kajihara et al., (2012). Inhibition of Marburg virus budding by nonneutralizing antibodies to the envelope glycoprotein. J. Virol. 86, 13467-13474. Ksiazek et al., (1999). ELISA for the detection of antibodies to Ebola viruses. J. Infect. Dis. 179 Suppl 1, S192-198. Lander et al., (2009). Appion: an integrated, database-driven pipeline to facilitate EM image processing. J. Struct. Bio. 166, 95-102. Lee et al., (2008). Structure of the Ebola virus glycoprotein bound to an antibody from a human survivor. Nature 454,177-182. Lubaki et al., (2013). The lack of maturation of Ebola virus-infected dendritic cells results from the cooperative effect of at least two viral domains. J. Virol. 87, 7471-7485. Maruyama et al., (1999). Ebola virus can be effectively neutralized by antibody produced in natural human infection. J. Virol. 73, 6024-6030. Marzi et al., (2012). Protective efficacy of neutralizing monoclonal antibodies in a nonhuman primate model of Ebola hemorrhagic fever. PloS One 7, e36192. Murin et al., (2014). Structures of protective antibodies reveal sites of vulnerability on Ebola virus. Proc. Natl. Acad. Sci. U.S.A 111, 17182-17187. Nanbo et al., (2010). Ebolavirus is internalized into host cells via macropinocytosis in a viral glycoprotein-dependent manner. PLoS Pathog. 6, e1001121. Olinger et al., (2012). Delayed treatment of Ebola virus infection with plant-derived monoclonal antibodies provides protection in rhesus macaques. Proc. Natl. Acad. Sci U.S.A. 109, 18030-18035. Pettersen et al., (2004). UCSF ChimeraA visualization system for exploratory research and analysis. J. Comput. Chem. 25, 1605-1612. Pettitt et al., (2103). Therapeutic intervention of Ebola virus infection in rhesus macaques with the MB-003 monoclonal antibody cocktail. Sci. Transl. Med. 5, 199ra113. Potter et al., (1999). Leginon: A system for fully automated acquisition of 1000 electron micrographs a day. Ultramicroscopy 77, 153-161. Qiu et al., (2012). Successful treatment of Ebola virus-infected cynomolgus macaques with monoclonal antibodies. Sci. Trans. Med. 4, 138ra181-138ra181. Qiu et al., (2014). Reversion of advanced Ebola virus disease in nonhuman primates with ZMapp. Nature 514, 47-53. Saeed et al., (2010). Cellular entry of ebola virus involves uptake by a macropinocytosis-like mechanism and subsequent trafficking through early and late endosomes. PLoS Pathog. 6, e1001110. Saphire, E. O. (2013). An update on the use of antibodies against the filoviruses. Immunotherapy 5, 1221-1233. Smith et al., (1982). Marburg-virus disease in Kenya. Lancet 1, 816-820. Suloway et al., (2005). Automated molecular microscopy: the new Leginon system. J. Struct. Bio. 151, 41-60. Tang et al., (2007). EMAN2: an extensible image processing suite for electron microscopy. J. Struct. Bio. 157, 38-46. Thomas et al., (1985). Mass and molecular composition of vesicular stomatitis virus: a scanning transmission electron microscopy analysis. J. Virol. 54, 598-607. Towner et al., (2009). Isolation of genetically diverse Marburg viruses from Egyptian fruit bats. PLoS Path. 5, e1000536. Towner et al., (2006). Marburgvirus genomics and association with a large hemorrhagic fever outbreak in Angola. J. Virol. 80, 6497-6516. Towner et al., (2005). Generation of eGFP expressing recombinant Zaire ebolavirus for analysis of early pathogenesis events and high-throughput antiviral drug screening. Virology 332, 20-27. van Heel et al., (1996). A new generation of the IMAGIC image processing system. J. Struct. Bio. 116, 17-24. Warfield et al., (2007). Development of a model for marburgvirus based on severe-combined immunodeficiency mice. Virol. J. 4, 108. Warfield et al., (2009). Development and characterization of a mouse model for Marburg hemorrhagic fever. J. Virol. 83, 6404-6415. Warren et al., (2014). Protection against Filovirus diseases by a novel broad-spectrum nucleoside analogue BCX4430. Nature 508, 402-405. World Health Organization (2014a). Ebola Situation Report, in W.H.O. Global Alert and Response. 7 Jan. 2015. World Health Organization (2014b). Marburg virus diseaseUganda, 10 Oct. 2014, in W.H.O. Global Alert and Response. Yu et al., (2008). An optimized electrofusion-based protocol for generating virus-specific human monoclonal antibodies. J. Immunol. Met. 336, 142-151.