Engineered HCV E2 Immunogens and Related Vaccine Compositions
20210024585 ยท 2021-01-28
Inventors
- Linling He (San Diego, CA)
- Jiang Zhu (San Diego, CA)
- Erick Giang (San Diego, CA)
- Mansun Law (San Diego, CA)
- Ian Wilson (La Jolla, CA)
- Netanel Tzarum (Jerusalem, IL)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2770/24234
CHEMISTRY; METALLURGY
C12N2770/24222
CHEMISTRY; METALLURGY
A61K2039/55555
HUMAN NECESSITIES
A61K47/6929
HUMAN NECESSITIES
International classification
A61K47/69
HUMAN NECESSITIES
Abstract
The present invention provides novel engineered HCV E2 polypeptide immunogens and related vaccine compositions that display the engineered E2 polypeptides. The invention also provides methods of using such immunogens and vaccine compositions in various therapeutic applications, e.g., for preventing or treating HCV infections.
Claims
1. A modified HCV E2 ectodomain polypeptide, comprising an engineered E2 ectodomain sequence that contains at least one modification selected from (a) a truncation in the VR2 disordered region and (b) a deletion in the -sandwich loop connecting sheets 6 and 7 of the -sandwich domain.
2. The modified HCV E2 ectodomain polypeptide of claim 1, wherein the engineered E2 ectodomain sequence comprises SEQ ID NO:4, a conservatively modified variant or a substantially identical sequence thereof.
3. The modified HCV E2 ectodomain polypeptide of claim 2, wherein truncation of the VR2 disordered region comprises replacing residues 41-61 of SEQ ID NO:4, CPERLASCGSSGCWHYPPRPC (SEQ ID NO:6), with CPERASGHYPRPC (SEQ ID NO:10).
4. The modified HCV E2 ectodomain polypeptide of claim 2, wherein truncation of the VR2 disordered region comprises replacing residues 41-61 of SEQ ID NO:4, CPERLASCGSSGCWHYPPRPC (SEQ ID NO:6), with a sequence set forth in CXXXXXXHYPRPC (SEQ ID NO:8) or CXXXXXHYPRPC (SEQ ID NO:9), wherein X is any amino acid residue.
5. The modified HCV E2 ectodomain polypeptide of claim 4, wherein in SEQ ID NO:8 is QNWDEP (SEQ ID NO:11), KVNIDP (SEQ ID NO:12), EKVEEL (SEQ ID NO:13), PDENMK (SEQ ID NO:14), or KREEKM (SEQ ID NO:15).
6. The modified HCV E2 ectodomain polypeptide of claim 4, wherein in SEQ ID NO:9 is PKTEV (SEQ ID NO:16), KRVDI (SEQ ID NO:17), PSDMV (SEQ ID NO:18), PNEEE (SEQ ID NO:19), or KKEIR (SEQ ID NO:20).
7. The modified HCV E2 ectodomain polypeptide of claim 2, wherein deletion of the -sandwich loop sequence (SEQ ID NO:21) comprises deletion of one or more residues that form the tip of the -sandwich loop.
8. The modified HCV E2 ectodomain polypeptide of claim 7, wherein residues that form the tip of the -sandwich loop are residues 543-546 from SEQ ID NO:4.
9. The modified HCV E2 ectodomain polypeptide of claim 7, wherein residues 543-546 from SEQ ID NO:4, RRPL (SEQ ID NO:22), are deleted.
10. The modified HCV E2 ectodomain polypeptide of claim 1, comprising both truncation in the VR2 disordered region and deletion in the -sandwich loop.
11. The modified HCV E2 ectodomain polypeptide of claim 10, comprising an amino acid sequence as set forth in any one of SEQ ID NOs:26-38, a conservatively modified variant or a substantially identical sequence thereof.
12. A polynucleotide encoding the modified HCV E2 ectodomain polypeptide of claim 1.
13. A pharmaceutical composition, comprising the modified HCV E2 ectodomain polypeptide of claim 1, and a pharmaceutically acceptable carrier.
14. A vaccine composition, comprising a modified HCV E2 ectodomain polypeptide of claim 1 that is displayed on the surface of a self-assembling nanoparticle.
15. The vaccine composition of claim 14, wherein C-terminus of the modified HCV E2 ectodomain polypeptide is fused to the N-terminus of subunit of the self-assembling nanoparticle via a linker sequence.
16. The vaccine composition of claim 15, wherein the linker sequence comprises (GGGGS).sub.2 (SEQ ID NO:42).
17. The vaccine composition of claim 14, wherein the modified HCV E2 ectodomain polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOs:26-38, a conservatively modified variant or a substantially identical sequence thereof.
18. The vaccine composition of claim 14, wherein subunit of the self-assembling nanoparticle comprises the polypeptide as shown in SEQ ID NO:39 (E2p), SEQ ID NO:40 (I3-01), or SEQ ID NO:41 (ferritin), a conservatively modified variant or a substantially identical sequence thereof.
19. A polynucleotide, encoding a fusion protein comprising a modified HCV E2 ectodomain polypeptide of claim 1 and a self-assembling nanoparticle subunit, wherein the modified HCV E2 ectodomain polypeptide is fused at its C-terminus to the N-terminus of the self-assembling nanoparticle subunit.
20. A pharmaceutical composition, comprising the vaccine composition of claim 14, and a pharmaceutically acceptable carrier.
21. A method of treating or preventing HCV infection in a subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of the vaccine composition of claim 14, thereby treating or preventing HCV infection in the subject.
Description
DESCRIPTION OF THE DRAWINGS
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION
I Overview
[0027] Glycoproteins E1 and E2 form a heterodimer on the HCV envelope that mediates viral entry into host hepatocytes. E2 interacts with host cellular receptors CD81 and SR-B1 and is a major target for neutralizing antibodies (NAb). Crystal structures of an E2 core (E2c) from isolate H77 (genotype 1a) with a broadly neutralizing antibody (bNAb), AR3C, and a truncated E2 from isolate J6 (genotype 2a) bound to a non-NAb, 2A12, provided the first insight into immune recognition of HCV envelope glycoproteins and paved the way for structure-based design of antiviral drugs and vaccines. Diverse vaccine strategies such as viral vectors, DNA vaccines, virus-like particles (VLP), and recombinant E2 and E1E2 proteins have been explored, but no licensed vaccine is available to prevent HCV infection. Although recombinant E1, E2 and E1E2 glycoproteins have elicited NAbs in animals and humans, neutralization breadth was limited and directed mainly to the immunodominant variable loops. Therefore, HCV vaccine efforts should be focused on design and optimization of envelope glycoprotein-based antigens capable of eliciting a bNAb response.
[0028] Over the last decade, several rational vaccine design strategies for human immunodeficiency virus type-1 (HIV) have included epitope-focused and native Env trimer-based approaches, that aim to direct the immune response to bNAb epitopes either by grafting the epitope onto heterologous scaffolds, removing or suppressing immunodominant regions, or stabilizing Env structures. Another major advance was the development of self-assembling nanoparticles (NP) to present stabilized Env trimers and epitope-scaffolds as multivalent VLP vaccines. These general design elements can, in principle, be applied to a wide range of vaccine targets including HCV. Indeed, epitope-scaffolds have been designed for conserved E1 and E2 NAb epitopes, but with no reported in vivo data or little improvement in neutralization breadth. See, e.g., He et al., Sci. Rep. 5, 12501, 2015; Pierce et al., J. Virol. 91, e01032-01017, 2017; and Sandomenico et al., J. Virol. 90, 3745-3759, 2016.
[0029] The present invention is predicated in part from the inventors' studies to redesign HCV E2 based vaccine polypeptides. Specifically, the inventors first redesigned E2 core constructs by truncating the VR2 disordered region and the -sandwich loop, followed by computationally optimizing the truncated VR2 loop (tVR2). The redesigned HCV E2 polypeptides were found to have improved yield, higher purity and increased thermostability. They also have stronger binding to broadly neutralizing antibodies and reduced binding to non-neutralizing antibodies. The inventors further displayed the redesigned HCV E2 polypeptides on nanoparticles of various sizes. The resulting nanoparticle vaccine compositions also demonstrated substantial yield, high purity, and enhanced antigenicity. In addition, mice were immunized with the nanoparticle vaccine constructs, and longitudinal serum analysis confirmed the superior immunogenicity of the nanoparticle vaccines. Moreover, statistical analysis was performed to validate the in vivo data, providing a rigorous foundation for future comparison of different types of HCV vaccine candidates.
[0030] In accordance with these studies, the invention provides novel HCV immunogen polypeptides that are derived from the engineered or redesigned HCV E2 core polypeptides described herein. Also provided in the invention are HCV vaccine compositions containing a displaying platform, including a self-assembling nanoparticle, that displays one or more of the redesigned HCV E2 polypeptides. Therapeutic applications of the redesigned HCV E2 polypeptides and the related nanoparticle vaccine compositions, e.g., treating or preventing HCV infections, are also provided in the invention.
[0031] Unless otherwise specified herein, the vaccine immunogens of the invention, the encoding polynucleotides, expression vectors and host cells, as well as the related therapeutic applications, can all be generated or performed in accordance with the procedures exemplified herein or routinely practiced methods well known in the art. See, e.g., Methods in Enzymology, Volume 289: Solid-Phase Peptide Synthesis, J. N. Abelson, M. I. Simon, G. B. Fields (Editors), Academic Press; 1st edition (1997) (ISBN-13: 978-0121821906); U.S. Pat. Nos. 4,965,343, and 5,849,954; Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, N.Y. (3rd ed., 2000); Brent et al., Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (ringbou ed., 2003); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (1986); or Methods in Enzymology: Guide to Molecular Cloning Techniques Vol. 152, S. L. Berger and A. R. Kimmerl Eds., Academic Press Inc., San Diego, USA (1987); Current Protocols in Protein Science (CPPS) (John E. Coligan, et. al., ed., John Wiley and Sons, Inc.), Current Protocols in Cell Biology (CPCB) (Juan S. Bonifacino et. al. ed., John Wiley and Sons, Inc.), and Culture of Animal Cells: A Manual of Basic Technique by R. Ian Freshney, Publisher: Wiley-Liss; 5th edition (2005), Animal Cell Culture Methods (Methods in Cell Biology, Vol. 57, Jennie P. Mather and David Barnes editors, Academic Press, 1st edition, 1998). The following sections provide additional guidance for practicing the compositions and methods of the present invention.
II. Definitions
[0032] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which this invention pertains. The following references provide one of skill with a general definition of many of the terms used in this invention: Academic Press Dictionary of Science and Technology, Morris (Ed.), Academic Press (1.sup.st ed., 1992); Oxford Dictionary of Biochemistry and Molecular Biology, Smith et al. (Eds.), Oxford University Press (revised ed., 2000); Encyclopaedic Dictionary of Chemistry, Kumar (Ed.), Anmol Publications Pvt. Ltd. (2002); Dictionary of Microbiology and Molecular Biology, Singleton et al. (Eds.), John Wiley & Sons (3.sup.rd ed., 2002); Dictionary of Chemistry, Hunt (Ed.), Routledge (1.sup.st ed., 1999); Dictionary of Pharmaceutical Medicine, Nahler (Ed.), Springer-Verlag Telos (1994); Dictionary of Organic Chemistry, Kumar and Anandand (Eds.), Anmol Publications Pvt. Ltd. (2002); and A Dictionary of Biology (Oxford Paperback Reference), Martin and Hine (Eds.), Oxford University Press (4.sup.th ed., 2000). Further clarifications of some of these terms as they apply specifically to this invention are provided herein.
[0033] As used herein, the singular forms a, an, and the, refer to both the singular as well as plural, unless the context clearly indicates otherwise. For example, an Env-derived trimer can refer to both single or plural Env-derived trimer molecules, and can be considered equivalent to the phrase at least one Env-derived trimer.
[0034] As used herein, the terms antigen or immunogen are used interchangeably to refer to a substance, typically a protein, which is capable of inducing an immune response in a subject. The term also refers to proteins that are immunologically active in the sense that once administered to a subject (either directly or by administering to the subject a nucleotide sequence or vector that encodes the protein) is able to evoke an immune response of the humoral and/or cellular type directed against that protein. Unless otherwise noted, the term vaccine immunogen is used interchangeably with protein antigen or immunogen polypeptide.
[0035] The term conservatively modified variant applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For polypeptide sequences, conservatively modified variants refer to a variant which has conservative amino acid substitutions, amino acid residues replaced with other amino acid residue having a side chain with a similar charge. Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0036] Epitope refers to an antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic, such that they elicit a specific immune response, for example, an epitope is the region of an antigen to which B and/or T cells respond. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
[0037] Effective amount of a vaccine or other agent that is sufficient to generate a desired response, such as reduce or eliminate a sign or symptom of a condition or disease, such as a viral infection. For instance, this can be the amount necessary to inhibit viral replication or to measurably alter outward symptoms of the viral infection. In general, this amount will be sufficient to measurably inhibit virus (for example, HCV) replication or infectivity. When administered to a subject, a dosage will generally be used that will achieve a target concentration that has been shown to be sufficient for in vitro inhibition of viral replication. In some embodiments, an effective amount is one that treats (including prophylaxis) one or more symptoms and/or underlying causes of any of a disorder or disease, for example to treat HCV infection. In some embodiments, an effective amount is a therapeutically effective amount. In some embodiments, an effective amount is an amount that prevents one or more signs or symptoms of a particular disease or condition from developing, such as one or more signs or symptoms associated with HCV infection.
[0038] As used herein, a fusion protein is a recombinant protein containing amino acid sequence from at least two unrelated proteins that have been joined together, via a peptide bond, to make a single protein. The unrelated amino acid sequences can be joined directly to each other or they can be joined using a linker sequence. As used herein, proteins are unrelated, if their amino acid sequences are not normally found joined together via a peptide bond in their natural environment(s) (e.g., inside a cell). For example, the amino acid sequences of bacterial enzymes such as B. stearothermophilus dihydrolipoyl acyltransferase (E2p) and the amino acid sequences of HCV E2 glycoproteins are not normally found joined together via a peptide bond.
[0039] As used herein, E1 refers to an envelope glycoprotein on hepatitis C virus. The E1 polypeptide is located in the HCV polyprotein immediately after the core protein at amino acid residues corresponding to residues 192-383 of the HCV genotype 1a, H77 isolate polyprotein.
[0040] As used herein, HCV envelope glycoprotein 2 (E2) refers to an envelope glycoprotein on hepatitis C virus. E2 is a type I transmembrane protein with an amino-terminal ectodomain connected to a carboxy-terminal transmembrane helix through an amphipathic, a-helical stem. The E2 polypeptide is located in the HCV polyprotein immediately after the E1 polypeptide at amino acid residues corresponding to residues 384-746 (SEQ ID NO:1) of the HCV genotype 1a, H77 isolate. See, e.g., Goffard et al., Biochimie 85, 295-301, 2003. Unless otherwise noted, reference to an E2 polypeptide herein also includes truncated forms thereof, such as soluble forms that are truncated at their C-terminus to remove the transmembrane domain, that retain a property, such as a binding property, and variants, such as those from different HCV isolates and quasispecies, including polypeptides that have at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the E2 polypeptide from HCV genotype 1a, isolate H77, set forth in SEQ ID NO:1.
[0041] Unless otherwise noted, E2 polypeptides include synthetic molecules prepared by translation of nucleic acids, proteins generated by chemical synthesis, such as syntheses that include ligation of shorter polypeptides, through recombinant methods, proteins isolated from HCV-infected human and non-human tissue and cells, chimeric E2 polypeptides and modified forms thereof. E2 polypeptides also include fragments or portions of E2 that are of sufficient length or include appropriate regions to retain at least one property of a full-length E2 polypeptide, such as the ability to bind to anti-E2 antibodies. E2 polypeptides also include those that contain chemical or posttranslational modifications and those that do not contain chemical or posttranslational modifications. Such modifications include, but are not limited to, pegylation, albumination, glycosylation, farnysylation, carboxylation, hydroxylation, phosphorylation, and other polypeptide modifications known in the art.
[0042] As used herein, the HCV E2 ectodomain (E2.sub.ECTO or E2 TM) refers to the soluble portion of the E2 polypeptide that is outside the viral membrane, i.e., the N-terminal portion of E2 protein that does not include the transmembrane helix. In the prototype H77 isolate, E2 ATM or E2.sub.ECTO consists of amino acids 384-717 (SEQ ID NO:2) and is stabilized by nine conserved disulfide bonds. It contains three variable regions including hypervariable region 1 (HVR1, a.a. 384-411), VR2 (a.a. 460-484), and VR3 (a.a. 570-580) and is covered with 11 N-linked glycans. As used herein, the VR2 disordered region refers to a specific E2 fragment which spans VR2, and is bordered by two cysteine residues that form two disulfide bonds for anchoring to the back layer and the -sandwich domain, respectively. In the H77 isolate, the VR2 disordered region corresponds to residues 452-494, and the two anchoring disulfide bonds are C452-C620 and C494-0564.
[0043] As used herein, reference to an amino acid position in any of the mature, processed HCV proteins, such as E2, is made with numbering relative to the full length HCV polypeptide, and not with reference to the mature polypeptide. Thus, for example, reference to amino acid position 425 in the E2 polypeptide from HCV genotype 1a, isolate H77 corresponds to position 42 of the mature E2 polypeptide set forth in SEQ ID NO:1.
[0044] As used herein, corresponding residues refers to residues that occur at aligned loci. Related or variant polypeptides are aligned by any method known to those of skill in the art. Such methods typically maximize matches, and include methods such as using manual alignments and by using the numerous alignment programs available (for example, BLASTP) and others known to those of skill in the art. By aligning the sequences of polypeptides, one skilled in the art can identify corresponding residues, using conserved and identical amino acid residues as guides. For example, by aligning the sequences of E2 polypeptides from different HCV isolates, one of skill in the art can identify corresponding residues, using conserved and identical amino acid residues as guides. Corresponding positions also can be based on structural alignments, for example by using computer simulated alignments of protein structure.
[0045] As used herein, the term hepatitis C virus, HCV, or HCVs includes different viral genotypes, subtypes, quasispecies and isolates. It includes any noncytopathic RNA virus that has a single and positive-stranded RNA genome belonging to the Hepacivirus genus of the Flaviviridae family. The term includes different isolates of HCV such as, without limitation, those having polyprotein sequences and accession numbers shown above, as well as any others in the NCBI database. Examples of different genotypes encompassed by this term include, without limitation, genotype 1, 2, 3, 4, 5 and 6, as described in Simmonds et al. (Hepatology 42:962-973, 2005). Reference to HCV also includes those of any additional genotypes that are established. Examples of different subtypes include, without limitation, 1a, 1b, 1c, 2a, 2b, 2c, 2i, 2k, 3a, 3b, 3k, 4a, 4d, 4f, 5a, 6a, 6b, 6c, 6d, 6e, 6f, 6g, 6h, 6i, 6j, 6k, 6l, 6m, 6n, 6o, 6q, 6p and 6t. The term also includes cell culture HCVs (HCVcc) and pseudotype HCVs (HCVpp), as well as HCV quasispecies. Various HCVs are described by Simmonds P. in Genetic diversity and evolution of hepatitis C virus15 years on, J Gen Virol 85:3173-3188 (2004) and Simmonds et al. in Consensus proposals for a unified system of nomenclature of hepatitis C virus genotypes, Hepatology 42:962-973 (2005). HCV nucleotide sequences are known in the art. For example, see Viral Bioinfomatics Research Center (hcvdb.org) and the Hepatitis C Virus database (hcv.lanl.gov).
[0046] Immunogen as used herein refers to a protein or a portion thereof that is capable of inducing an immune response in a mammal, such as a mammal infected or at risk of infection with a pathogen. Administration of an immunogen can lead to protective immunity and/or proactive immunity against a pathogen of interest.
[0047] Immune response refers to a response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus. In some embodiment, the response is specific for a particular antigen (an antigen-specific response). In some embodiments, an immune response is a T cell response, such as a CD4+ response or a CD8+ response. In some other embodiments, the response is a B cell response, and results in the production of specific antibodies.
[0048] Immunogenic composition refers to a composition comprising an immunogenic polypeptide that induces a measurable CTL response against virus expressing the immunogenic polypeptide, or induces a measurable B cell response (such as production of antibodies) against the immunogenic polypeptide.
[0049] Sequence identity or similarity between two or more nucleic acid sequences, or two or more amino acid sequences, is expressed in terms of the identity or similarity between the sequences. Sequence identity can be measured in terms of percentage identity; the higher the percentage, the more identical the sequences are. Two sequences are substantially identical if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
[0050] Homologs or orthologs of nucleic acid or amino acid sequences possess a relatively high degree of sequence identity/similarity when aligned using standard methods. Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth. Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.
[0051] The term subject refers to any animal classified as a mammal, e.g., human and non-human mammals. Examples of non-human animals include dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, and etc. Unless otherwise noted, the terms patient or subject are used herein interchangeably. Preferably, the subject is human.
[0052] The term treating or alleviating includes the administration of compounds or agents to a subject to prevent or delay the onset of the symptoms, complications, or biochemical indicia of a disease (e.g., an HCV infection), alleviating the symptoms or arresting or inhibiting further development of the disease, condition, or disorder. Subjects in need of treatment include those already suffering from the disease or disorder as well as those being at risk of developing the disorder. Treatment may be prophylactic (to prevent or delay the onset of the disease, or to prevent the manifestation of clinical or subclinical symptoms thereof) or therapeutic suppression or alleviation of symptoms after the manifestation of the disease.
[0053] Vaccine refers to a pharmaceutical composition that elicits a prophylactic or therapeutic immune response in a subject. In some cases, the immune response is a protective immune response. Typically, a vaccine elicits an antigen-specific immune response to an antigen of a pathogen, for example a viral pathogen, or to a cellular constituent correlated with a pathological condition. A vaccine may include a polynucleotide (such as a nucleic acid encoding a disclosed antigen), a peptide or polypeptide (such as a disclosed antigen), a virus, a cell or one or more cellular constituents. In some embodiments of the invention, vaccines or vaccine immunogens or vaccine compositions are expressed from fusion constructs and self-assemble into nanoparticles displaying an immunogen polypeptide or protein on the surface.
[0054] Virus-like particle (VLP) refers to a non-replicating, viral shell, derived from any of several viruses. VLPs are generally composed of one or more viral proteins, such as, but not limited to, those proteins referred to as capsid, coat, shell, surface and/or envelope proteins, or particle-forming polypeptides derived from these proteins. VLPs can form spontaneously upon recombinant expression of the protein in an appropriate expression system. Methods for producing particular VLPs are known in the art. The presence of VLPs following recombinant expression of viral proteins can be detected using conventional techniques known in the art, such as by electron microscopy, biophysical characterization, and the like. See, for example, Baker et al. (1991) Biophys. J. 60:1445-1456; and Hagensee et al. (1994) J. Virol. 68:4503-4505. For example, VLPs can be isolated by density gradient centrifugation and/or identified by characteristic density banding. Alternatively, cryoelectron microscopy can be performed on vitrified aqueous samples of the VLP preparation in question, and images recorded under appropriate exposure conditions.
[0055] A self-assembling nanoparticle refers to a ball-shape protein shell with a diameter of tens of nanometers and well-defined surface gemoetry that is formed by identical copies of a non-viral protein capable of automatically assembling into a nanoparticle with a similar appearance to VLPs. Known examples include ferritin (FR), which is conserved across species and forms a 24-mer, as well as B. stearothermophilus dihydrolipoyl acyltransferase (E2p), Aquifex aeolicus lumazine synthase (LS), and Thermotoga maritima encapsulin, which all form 60-mers. Self-assembling nanoparticles can form spontaneously upon recombinant expression of the protein in an appropriate expression system. Methods for nanoparticle production, detection, and characterization can be conducted using the same techniques developed for VLPs.
III. Redesigned HCV E2 Core Immunogenic Polypeptides
[0056] The invention provides engineered or redesigned HCV E2 core polypeptides or proteins for producing HCV vaccines. E2 is a type I transmembrane protein with an amino-terminal ectodomain connected to a carboxy-terminal transmembrane helix through an amphipathic, -helical stem. The E2 polypeptide is located in the HCV polyprotein immediately after the E1 polypeptide at amino acid residues corresponding to residues 384-746 of the HCV genotype 1a, H77 isolate. See, e.g., Goffard et al., Biochimie 85, 295-301, 2003. E2 is highly modified post-translationally with several (9-11) N-linked glycosylation sites and 20 cysteine residues that are conserved across all genotypes. Unless otherwise noted, amino acid residue numbering of HCV genotype 1a, H77 isolate is used herein as the reference.
[0057] E2 core refers to a portion of E2 that forms a 3-dimensional structure that is recognized by a broadly neutralizing antibody, AR3C Fab. See, e.g., Law et al., Nat. Med. 2008; 14:25, 2008. The E2 core has a compact, globular domain structure, consisting mostly of -strands and random coil with two small a-helices. The strands are arranged in two, perpendicular sheets (A and B), which are held together by an extensive hydrophobic core and disulfide bonds. The E2 core contains a central immunoglobulin (Ig)-like -sandwich with front and back layers. As used herein, an E2 core polypeptide refers to an engineered polypeptide sequence that includes E2 residues or fragments that correspond to the key structural elements of E2 core in its 3-dimensional structure of E2. A prototype E2 core polypeptide, E2c (SEQ ID NO:3), is derived from E2 TM of the H77 isolate. It consists of E2 amino acids 412-459, a GSSG linker replacing residues 460-485 of E2, and amino acids 486-645, with both the stalk region and the transmembrane (TM) region deleted. Relative to E2 sequence, E2c additionally contains mutations N448D and N576D. A further modified E2 core polypeptide, E2c3 (SEQ ID NO:4), is derived from E2c. Relative to E2c, the E2c3 polypeptide additionally contains a GGPTDG (SEQ ID NO:43) linker replacing E2 residues 569-597. Thus, it consists of amino acids 412-459, the GSSG linker, amino acids 486-568, the GGPTDG (SEQ ID NO:43) linker, and amino acids 598-645. Also, E2c3 only harbors the N448D substitution, with the N576D substitution being removed as a result of residues 569-597 being replaced by the GGPTDG (SEQ ID NO:43) linker. See, e.g., Kong et al., Science. 342:1090-1094, 2013; and Kong et al., Proc. Natl. Acad. Sci. U.S.A. 113, 12768-12773, 2016.
[0058] Unless otherwise noted, the amino acid residue numbering of E2 or derivative thereof (e.g., E2 ATM and E2 core), as well as the various redesigned HCV core polypeptides of the invention, is based on HCV genotype 1a, H77 isolate. Due to substantial sequence conservation among the E2 proteins from different HCV genotypes, corresponding amino acid residues bordering the various domains, regions and loops of an E2 protein from any other HCV genotype and isolate can be readily determined (e.g., by sequence alignment) or otherwise known in the art. For example, while E2 core of the H77 isolate spans residues 412-645, the E2 core of HCV genotype 2a, isolate J6 is comprised of residues spanning 412-645 based on the H77 numbering system (or 412-649 in the actual J6 polypeptide sequence). See, e.g., Kong et al., Science. 342:1090-1094, 2013; and Khan et al., Nature 509:381-384, 2014.
[0059] In general, the redesigned HCV E2 polypeptides of the invention contain one or more modifications in the VR2 disordered region and the -sandwich loop. The original VR2 disordered region contains 43 residues, corresponding to residues 452-494 in the H77 isolate, CPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPC (SEQ ID NO:5). The corresponding region in the engineered E2c proteins known in the art, E2c and E2c3, contain a sequence of 21 residues, CPERLASCGSSGCWHYPPRPC (SEQ ID NO:6). Typically, the redesigned HCV E2 polypeptides of the invention contain a further shortened VR2 disordered region (tVR2) relative to that of the engineered E2c proteins known in the art, E2c and E2c3. In various embodiments, the further shortened VR2 disordered region (tVR2) in the redesigned HCV E2 polypeptides contains less than about 20, 19, 18, 17, 16 or less residues. In some preferred embodiments, the tVR2 contains less than about 15, 14, 13, 12 or less residues. As shown in the exemplified tVR2 sequence of redesigned HCV E2 polypeptide E2mc3, CPERASGHYPRPC (SEQ ID NO:10), the further shortening of the VR2 disordered region of E2c and E2c3 involves deletions of various residues in SEQ ID NO:6. In some embodiments, the tVR2 of the redesigned HCV E2 polypeptides of the invention can have an amino acid sequence set forth in C(X)nHYPRPC (SEQ ID NO:7), wherein X is any amino acid residue, and n is between about 3 to about 10. In some of these embodiments, the tVR2 contains 13 or 12 residues as set forth in CXXXXXXHYPRPC (SEQ ID NO:8) or CXXXXXHYPRPC (SEQ ID NO:9), wherein X is any amino acid residue. Importantly, it was observed that the prior art E2 polypeptide such as E2c3 could not be displayed on nanoparticles with meaningful expression. In contrast, further modification of the VR2 disordered region in the redesigned HCV E2 polypeptides of the invention enables satisfactory nanoparticle display of the polypeptides, as exemplified herein.
[0060] In addition to the shortened length, modification of the VR2 disordered region can additionally involve optimization of the sequence to further stabilize the HCV E2 polypeptides. Optimization of the tVR2 sequence can be performed using ensemble-based de novo protein design as described in, e.g., Kong et al., Nat. Commun. 7:12040, 2016. Specific guidance for optimizing tVR2 sequence by selecting random sequences, performing simulated annealing and identifying lowest-energy sequences, is also provided in the Examples herein. In some of the redesigned HCV E2 polypeptides of the invention, the tVR2 sequence is derived from optimization of the sequence as set forth in any one of SEQ ID NOs:7-9. As exemplification with redesigned HCV E2 polypeptides set forth in SEQ ID NOs:27-38, the optimized tVR2 sequence can be any of SEQ ID NOs:65-74, a substantially identical sequence or a conservatively substituted variant thereof.
[0061] Additionally or alternatively to the modified VR2 disordered region, the redesigned HCV E2 polypeptides of the invention also contain a modification in the (3-sandwich domain. As shown in
[0062] Preferably, the redesigned HCV E2 core polypeptides contain both modifications of the VR2 disordered region and the -sandwich loop as described above. Some specific examples of redesigned HCV E2 core polypeptides containing such modifications are set forth in SEQ ID NOs:26-38. As exemplified herein, while being derived from different HCV isolates and genotypes, these redesigned HCV E2 core polypeptides all demonstrated substantially improved yield and purity, as well as satisfactory immunogenic activities. In addition to these specific polypeptides, redesigned HCV E2 polypeptides of the invention also encompass polypeptides having an amino acid sequence that is substantially identical to one of these sequences, including conservatively modified variant sequences. In various embodiments, the redesigned HCV E2 core polypeptides of the invention can have an amino acid sequence that is identical to any of SEQ ID NOs:26-38, except for one or more amino acid residue substitutions of non-conserved residues among different HCV isolates or genotypes, or substitutions in the non-conserved region or motif of the E2 sequence of different HCV isolates or genotypes.
[0063] As exemplified herein with isolate H77 (genotype 1a) and isolate HK6a (genotype 6a), E2 sequences from various HCV strains can all be readily employed to generate HCV immunogen polypeptides in accordance with the redesign strategy described herein. HCV isolates have been grouped into seven genotypes and a number of subtypes, which have different geographical distributions. E2 sequences of many of these isolates are already known. For example, HCV related sequence information can be obtained from the Hepatitis C Virus Databases maintained by the National Institute of Allergy and Infectious Diseases (NIAID). While there is a considerable degree of variability among E2 sequences of different HCV isolates, a certain number of conserved motifs or neutralizing epitopes have been identified in the E2 sequences. In redesigning E2 core polypeptides with a given HCV E2 sequence in accordance with the strategy described herein, one can readily determine the appropriate residues for modifications via sequence alignment and also considering the conserved motifs known in the art. See, e.g., Simmonds et al., Hepatology 42:962-973, 2005; Wang et al., Viruses 3:2127-2145, 2011; and Krey et al., PLoS Pathog. 6:e1000762, 2010; Bhattarai et al., PLoS Pathog. 11: e1005183, 2015; and Kachko et al., Vaccine 30:69-77, 2011. As exemplified herein with the HK6a isolate, redesigned HCV E2 polypeptides from other isolates can be obtained by directly adopting the H77 sequence designs without further modification. This includes replacing the VR2 disordered region with the same optimized tVR2 sequence identified for the H77 isolate and deleting the corresponding residues in the tip of the -sandwich loop as in the redesigned H77 sequences exemplified herein.
[0064] As detailed below, the resigned HCV E2 polypeptides may be conjugated to a presenting platform (e.g., nanoparticles or VLPs) via various means. Preferably, the conjugation is achieved via covalent linkage, e.g., protein fusions or insertions. In some preferred embodiments, the protein sequence is fused with the presenting platform sequence via a linker sequence. In various embodiments, other modifications can also be made to the redesigned E2 polypeptides or the conjugating partner in order to improve stability or antigenicity.
[0065] The various redesigned HCV E2 polypeptides of the invention can be obtained or generated in accordance with the protocols exemplified herein or methods well known in the art. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, N.Y., (3.sup.rd ed., 2000); and Brent et al., Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (ringbou ed., 2003). Upon recombinant expression (e.g., in HEK293 F cells as detailed herein), the proteins can be purified by any of the routinely practiced procedures. See, e.g., Guide to Protein Purification, Ed. Deutscher, Meth. Enzymol. 185, Academic Press, San Diego, 1990; and Scopes, Protein Purification: Principles and Practice, Springer Verlag, New York, 1982. Substantial purification denotes purification from other proteins or cellular components. A substantially purified protein is at least 60%, 70%, 80%, 90%, 95% or 98% pure. Once purified, antigenicity and other properties of the redesigned HCV E2 polypeptides can also be readily examined with standard methods, e.g., antigenic profiling using known bNAbs and non-Nabs, differential scanning calorimetry (DSC), electron microscopy, binding analysis via ELISA, Biolayer Interferometry (BLI), Surface Plasmon Resonance (SPR), and co-crystallography analysis as exemplified herein.
IV. Scaffolded HCV E2 Vaccine Compositions
[0066] Other than the engineered or redesigned HCV E2 polypeptides described above, the invention also provides HCV E2 polypeptide based vaccine compositions that contain a heterologous scaffold that presents or incorporates a redesigned HCV E2 protein. Any heterologous scaffold can be used to present the redesigned HCV E2 polypeptide in the construction of the vaccines of the invention. These include nanoparticles, virus-like particles, protein carriers (e.g., immunoglobulin chains or domains such as Fc, KLH, BSA, tetanus toxoid, and diphtheria toxoid), as well as various chemical scaffolds. In some embodiments, a virus-like particle (VLP) such as bacteriophage Q.sub. VLP and nanoparticles can be used. In some preferred embodiments, the heterologous scaffold for presenting or displaying the redesigned HCV E2 polypeptide is a self-assembling nanoparticle. Various nanoparticle platforms can be employed in generating the vaccine compositions of the invention. In general, the nanoparticles employed in the invention need to be formed by multiple copies of a single subunit. The nanoparticles are typically ball-like shaped, and/or have rotational symmetry (e.g., with 3-fold and 5-fold axes), e.g., with an icosahedral structure exemplified herein. Additionally or alternatively, the amino-terminus of the particle subunit has to be exposed and in close proximity to the 3-fold axis, and the spacing of three amino-termini has to closely match the spacing of the carboxyl-termini of the HCV E2 polypeptides. In some preferred embodiments, the immunogens comprise self-assembling nanoparticles with a diameter of about 20 nm or less (usually assembled from 12, 24, or 60 subunits) and 3-fold axes on the particle surface.
[0067] In some preferred embodiments, the immunogen protein or polypeptide (e.g., an HCV E2 protein) is presented on self-assembling nanoparticles such as self-assembling nanoparticles derived from E2p, I3-01 and ferritin (FR) as exemplified herein. E2p is a redesigned variant of dihydrolipoyl acyltransferase from Bacillus stearothermophilus that has been shown to self-assemble into thermostable 60-meric nanoparticle. See, e.g., He et al., Nat. Commun. 7:12041, 2016 Similarly, I3-01 is an engineered protein that can self-assemble into hyperstable nanoparticles. See, e.g., Hsia et al., Nature 535, 136-139, 2016. Sequences of the subunits of these proteins are known in the art. See, e.g., WO2017/192434. Ferritin is a globular protein found in all animals, bacteria, and plants. The globular form of ferritin is made up of monomeric subunit proteins (also referred to as monomeric ferritin subunits), which are polypeptides having a molecule weight of approximately 17-20 kDa. Amino acid sequences of E2p, I3-01 and ferritin nanoparticle subunits as exemplified herein are shown in SEQ ID NOs:39-41, respectively. Relative to the original sequence, E2p sequence shown in SEQ ID NO:39 contains an Ala substitution at residue 92 as underscored in the sequence below. In various embodiments, the HCV E2 nanoparticle vaccines of the invention can employ any of these known nanoparticles, as well as their conservatively modified variants or variants with substantially identical (e.g., at least 90%, 95% or 99% identical) sequences.
TABLE-US-00001 E2psubunitsequence (SEQIDNO:39) AAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTK LVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTAIDDETEEI IQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKL TPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGE IVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLM I3-01subunitsequence (SEQIDNO:40) MKMEELFKKHKIVAVLRANSVEEAKKKALAVFLGGVHLIEITFTVPDADT VIKELSFLKEMGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFC KEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPN VKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGTPVEVAEKAKAFVEKI RGCTE Ferritinsequence (SEQIDNO:41) MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEE YEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISES INNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHG LYLADQYVKGIAKSRKS
[0068] In addition to these exemplified nanoparticle sequences, many other nanoparticles or VLPs known in the art may also be used in the practice of the invention. These include, e.g., Aquifex aeolicus lumazine synthase, Thermotoga Maritima encapsulin, Myxococcus xanthus encapsulin, bacteriophage Qbeta virus particle, Flock House Virus (FHV) particle, ORSAY virus particle, and infectious bursal disease virus (IBDV) particle. Other molecules that may be used as the presenting platform of the nanoparticle vaccines of the invention include, e.g., molecules with the following PDB IDs: 1JIG (12-mer Dlp-2 from Bacillus anthraces), 1UVH (12-mer DPS from Mycrobacterium smegmatis), 2YGD (24-mer eye lens chaperone B-crystallin), 3CS0 (24-mer DegP24), 3MH6 and 3MH7 (24-mer HtrA proteases), 3PV2 (12-mer HtrA homolog DegQ WT), 4A8C (12-mer DegQ from E. coli.), 4A9G (24-mer DegQ from E. Coli.), 4EVE (12-mer HP-NAP from Helicobacter pylori strain YS29), and 4GQU (24-mer HisB from Mycobacterium tuberculosis).
[0069] Some HCV E2 nanoparticle vaccine compositions can additionally contain other structural components that function to further enhance stability and antigenicity of the displayed immunogen. In some embodiments, a locking protein domain can be inserted into the nanoparticle construct, e.g., by covalently fused to the C-terminus of the nanoparticle subunit. The locking domain can be any dimeric protein that is capable of forming an interface through specific interactions such as hydrophobic (van der Waals) contacts, hydrogen bonds, and/or salt bridges. General guidance on selecting locking domains and specific examples are described in the art, e.g., PCT2019/036917. In some embodiments, HCV E2 nanoparticle vaccines of the invention can also contain a T-cell epitope to promote robust T-cell responses and to steer B cell development towards bNAbs. The T-cell epitope can be located at any position in relation to the other structural components as long as it does not impact presentation of the immunogen polypeptides on the nanoparticle surface. Any T-cell epitope sequences or peptides known in the art may be employed in the practice of the present invention. They include any polypeptide sequence that contain MHC class-II epitopes and can effectively activate CD4+ and CD8+ T cells upon immunization, e.g., T-helper epitope that activates CD4+T helper cells. See, e.g., Alexander et al., Immunity 1, 751-761, 1994; Ahlers et al., J. Clin. Invest. 108:1677-1685, 2001; Fraser et al., Vaccine 32, 2896-2903, 2014; De Groot et al., Immunol. Cell Biol. 8:255-269, 2002; and Gene Ther. 21: 225-232, 2014. In some embodiments, the HCV E2 nanoparticle vaccines of the invention also contain a neck region or domain to facilitate display of the immunogen on the surface of nanoparticles. The neck region can be a three-helix bundle derived from a viral protein, e.g., Hendra virus domain (PDB ID: 4HEO) or Measles virus domain (PDB ID: 1OKS). It is typically inserted between the immunogen and the nanoparticle subunit, thereby elevating the immunogen polypeptide from the nanoparticle surface. In still some embodiments, the nanoparticle vaccines of the invention can contain a protein domain that serves to stabilize the immunogen polypeptide. For example, the protein domain can be the C-terminal trimerization motif of T4 fibritin (foldon) that is well known in the art. This foldon domain constitutes the C-terminal 30 amino acid residues of the trimeric protein fibritin from bacteriophage T4, and functions in promoting folding and trimerization of fibritin. See, e.g., Papanikolopoulou et al., J. Biol. Chem. 279: 8991-8998, 2004; and Guthe et al., J. Mol. Biol. 337: 905-915, 2004.
[0070] The scaffolded HCV E2 vaccine compositions of the invention can be constructed in accordance with standard recombinant techniques and the methods described herein (e.g., Examples 4 and 8) and/or other methods that have been described in the art, e.g., He et al., Nat. Comm. 7, 12041, 2016; Kong et al., Nat. Comm. 7, 12040, 2016; and He et al., Sci Adv. 4(11):eaau6769, 2018. In various embodiments, nanoparticle displaying any of the redesigned HCV E2 polypeptides can be constructed by fusing the E2 polypeptide to the subunit of the nanoparticle (e.g., E2p subunit). Preferably, C-terminus of the HCV E2 polypeptide is fused to the N-terminus of the nanoparticle subunit. In some embodiments, a short peptide linked can be used to connect the E2 polypeptide and the nanoparticle, e.g., the 10GS linker (GGGGSGGGGS) (SEQ ID NO:42) exemplified herein. Once constructed, the antigeniciy and structural integrity of the nanoparticle displayed HCV E2 polypeptides can be readily analyzed via standard assays, e.g., antibody binding assays, biolayer interferometry, and negative-stain electron microscopy (EM). As exemplified herein, the various fusion molecules can all self-assemble into nanoparticles that display immunogenic epitopes of the HCV E2 polypeptides. By eliciting a robust neutralizing antibody response, these nanoparticles are useful for vaccinating individuals against a broad range of HCV viruses.
V. Polynucleotides and Expression Constructs
[0071] The redesigned HCV E2 polypeptides and the nanoparticle vaccine compositions of the invention are typically produced by first generating expression constructs (i.e., expression vectors) that contain operably linked coding sequences of the various structural components described herein. Accordingly, in some related aspects, the invention provides substantially purified polynucleotides (DNA or RNA) that encode the redesigned HCV E2 polypeptides and nanoparticle displayed HCV E2 immunogens as described herein, as well as expression vectors that harbor such polynucleotides and host cells for producing the HCV E2 immunogen polypeptides and the vaccine compositions (e.g., HEK293 F cells and ExpiCHO cells exemplified herein). The fusion polypeptides encoded by the polynucleotides or expressed from the vectors are also included in the invention.
[0072] The polynucleotides and related vectors can be readily generated with standard molecular biology techniques or the protocols exemplified herein. For example, general protocols for cloning, transfecting, transient gene expression and obtaining stable transfected cell lines are described in the art, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, N.Y., (3.sup.rd ed., 2000); and Brent et al., Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (ringbou edition, 2003). Introducing mutations to a polynucleotide sequence by PCR can be performed as described in, e.g., PCR Technology: Principles and Applications for DNA Amplification, H. A. Erlich (Ed.), Freeman Press, NY, NY, 1992; PCR Protocols: A Guide to Methods and Applications, Innis et al. (Ed.), Academic Press, San Diego, Calif., 1990; Manila et al., Nucleic Acids Res. 19:967, 1991; and Eckert et al., PCR Methods and Applications 1:17, 1991.
[0073] The selection of a particular vector depends upon the intended use of the fusion polypeptides. For example, the selected vector must be capable of driving expression of the fusion polypeptide in the desired cell type, whether that cell type be prokaryotic or eukaryotic. Many vectors contain sequences allowing both prokaryotic vector replication and eukaryotic expression of operably linked gene sequences. Vectors useful for the invention may be autonomously replicating, that is, the vector exists extrachromosomally and its replication is not necessarily directly linked to the replication of the host cell's genome. Alternatively, the replication of the vector may be linked to the replication of the host's chromosomal DNA, for example, the vector may be integrated into the chromosome of the host cell as achieved by retroviral vectors and in stably transfected cell lines. Both viral-based and nonviral expression vectors can be used to produce the immunogens in a mammalian host cell. Nonviral vectors and systems include plasmids, episomal vectors, typically with an expression cassette for expressing a protein or RNA, and human artificial chromosomes (see, e.g., Harrington et al., Nat. Genet. 15:345, 1997). Useful viral vectors include vectors based on lentiviruses or other retroviruses, adenoviruses, adeno associated viruses, cytomegalovirus, herpes viruses, vectors based on SV40, papilloma virus, HBP Epstein Barr virus, vaccinia virus vectors and Semliki Forest virus (SFV). See, Brent et al., supra; Smith, Annu. Rev. Microbiol. 49:807, 1995; and Rosenfeld et al., Cell 68:143, 1992.
[0074] Depending on the specific vector used for expressing the fusion polypeptide, various known cells or cell lines can be employed in the practice of the invention. The host cell can be any cell into which recombinant vectors carrying a fusion of the invention may be introduced and wherein the vectors are permitted to drive the expression of the fusion polypeptide is useful for the invention. It may be prokaryotic, such as any of a number of bacterial strains, or may be eukaryotic, such as yeast or other fungal cells, insect or amphibian cells, or mammalian cells including, for example, rodent, simian or human cells. Cells expressing the fusion polypeptides of the invention may be primary cultured cells or may be an established cell line. Thus, in addition to the cell lines exemplified herein (e.g., CHO cells), a number of other host cell lines capable well known in the art may also be used in the practice of the invention. These include, e.g., various Cos cell lines, HeLa cells, HEK293, AtT20, BV2, and N18 cells, myeloma cell lines, transformed B-cells and hybridomas.
[0075] The use of mammalian tissue cell culture to express polypeptides is discussed generally in, e.g., Winnacker, From Genes to Clones, VCH Publishers, N.Y., N.Y., 1987. The fusion polypeptide-expressing vectors may be introduced to the selected host cells by any of a number of suitable methods known to those skilled in the art. For the introduction of fusion polypeptide-encoding vectors to mammalian cells, the method used will depend upon the form of the vector. For plasmid vectors, DNA encoding the fusion polypeptide sequences may be introduced by any of a number of transfection methods, including, for example, lipid-mediated transfection (lipofection), DEAE-dextran-mediated transfection, electroporation or calcium phosphate precipitation. These methods are detailed, for example, in Brent et al., supra. Lipofection reagents and methods suitable for transient transfection of a wide variety of transformed and non-transformed or primary cells are widely available, making lipofection an attractive method of introducing constructs to eukaryotic, and particularly mammalian cells in culture. For example, LipofectAMINE (Life Technologies) or LipoTaxi (Stratagene) kits are available. Other companies offering reagents and methods for lipofection include Bio-Rad Laboratories, Clontech, Glen Research, Life Technologies, JBL Scientific, MBI Fermentas, PanVera, Promega, Quantum Biotechnologies, Sigma-Aldrich, and Wako Chemicals USA.
[0076] For long-term, high-yield production of recombinant fusion polypeptides, stable expression is preferred. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with the fusion polypeptide-encoding sequences controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and selectable markers. The selectable marker in the recombinant vector confers resistance to the selection and allows cells to stably integrate the vector into their chromosomes. Commonly used selectable markers include neo, which confers resistance to the aminoglycoside G-418 (Colberre-Garapin, et al., J. Mol. Biol., 150:1, 1981); and hygro, which confers resistance to hygromycin (Santerre et al., Gene, 30: 147, 1984). Through appropriate selections, the transfected cells can contain integrated copies of the fusion polypeptide encoding sequence.
VI. Pharmaceutical Compositions and Therapeutic Applications
[0077] The invention provides pharmaceutical or immunogenic compositions and related methods of using the redesigned HCV E2 polypeptides and nanoparticles displaying the polypeptides as described herein for preventing and treating HCV infections. In some embodiments, a redesigned HCV E2 polypeptide or a nanoparticle displaying the polypeptide is included in a pharmaceutical composition. The pharmaceutical composition can be either a therapeutic formulation or a prophylactic formulation. Typically, the composition additionally includes one or more pharmaceutically acceptable vehicles and, optionally, other therapeutic ingredients (for example, antibiotics or antiviral drugs). Various pharmaceutically acceptable additives can also be used in the compositions.
[0078] Some of the pharmaceutical compositions of the invention are vaccines. For vaccine compositions, appropriate adjuvants can be additionally included. Examples of suitable adjuvants include, e.g., aluminum hydroxide, lecithin, Freund's adjuvant, MPL and IL-12. In some embodiments, the resigned HCV E2 polypeptides disclosed herein can be formulated as a controlled-release or time-release formulation. This can be achieved in a composition that contains a slow release polymer or via a microencapsulated delivery system or bioadhesive gel. The various pharmaceutical compositions can be prepared in accordance with standard procedures well known in the art. See, e.g., Remington's Pharmaceutical Sciences, 19.sup.th Ed., Mack Publishing Company, Easton, Pa., 1995; Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978); U.S. Pat. Nos. 4,652,441 and 4,917,893; 4,677,191 and 4,728,721; and 4,675,189.
[0079] Therapeutic methods of the invention involve administering a redesigned HCV E2 polypeptide of the invention or a pharmaceutical composition containing the polypeptide to a subject having or at risk of developing HCV infection. In some embodiments, a pharmaceutical compositions of the invention is employed in therapeutic or prophylactic applications for treating HCV infection or eliciting an protective immune response against HCV in a subject. For example, the composition can be administered to a subject to induce an immune response to HCV, e.g., to induce production of broadly neutralizing antibodies to HCV. For subjects at risk of developing an HCV infection, a vaccine composition of the invention can be administered to provide prophylactic protection against viral infection. Depending on the specific subject and conditions, the pharmaceutical compositions of the invention can be administered to subjects by a variety of administration modes known to the person of ordinary skill in the art, for example, intramuscular, subcutaneous, intravenous, intra-arterial, intra-articular, intraperitoneal, or parenteral routes. In general, the pharmaceutical composition is administered to a subject in need of such treatment for a time and under conditions sufficient to prevent, inhibit, and/or ameliorate a selected disease or condition or one or more symptom(s) thereof. Symptoms of HCV exposure or infection include, e.g., inflammation of the liver, decreased appetite, fatigue, abdominal pain, jaundice, flu-like symptoms, itching, muscle pain, joint pain, intermittent low-grade fevers, sleep disturbances, nausea, dyspepsia, cognitive changes, depression headaches and mood changes.
[0080] Typically, the immunogenic composition of the invention is administered in an amount sufficient to induce an immune response against HCV. For therapeutic applications, the compositions should contain a therapeutically effective amount of a redesigned HCV E2 polypeptide or nanoparticle vaccine composition described herein. For prophylactic applications, the compositions should contain a prophylactically effective amount of the HCV E2 polypeptide or a nanoparticle displaying the polypeptide. The appropriate amount of the polypeptide immunogen or the nanoparticle composition can be determined based on the specific disease or condition to be treated or prevented, severity, age of the subject, and other personal attributes of the specific subject (e.g., the general state of the subject's health and the robustness of the subject's immune system). Determination of effective dosages is additionally guided with animal model studies followed up by human clinical trials and is guided by administration protocols that significantly reduce the occurrence or severity of targeted disease symptoms or conditions in the subject.
[0081] For prophylactic applications, the immunogenic composition is provided in advance of any symptom, for example in advance of infection. The prophylactic administration of the immunogenic compositions serves to prevent or ameliorate any subsequent infection. Thus, in some embodiments, a subject to be treated is one who has, or is at risk for developing, an HCV infection, for example because of exposure or the possibility of exposure to HCV. Following administration of a therapeutically effective amount of the disclosed therapeutic compositions, the subject can be monitored for HCV infection, symptoms associated with HCV infection, or both.
[0082] For therapeutic applications, the immunogenic composition is provided at or after the onset of a symptom of disease or infection, for example after development of a symptom of HCV infection, or after diagnosis of HCV infection. The immunogenic composition can thus be provided prior to the anticipated exposure to HCV virus so as to attenuate the anticipated severity, duration or extent of an infection and/or associated disease symptoms, after exposure or suspected exposure to the virus, or after the actual initiation of an infection.
[0083] The pharmaceutical composition of the invention can be combined with other agents known in the art for treating or preventing HCV infections. These include, e.g., (1) Daclatasvir, (2) Elbasvir and grazoprevir, (3) Glecaprevir and pibrentasvir, (4) Ledipasvir and sofosbuvir, (5) Ombitasvir, paritaprevir, and ritonavir, (6) Simeprevir (Olysio) and sofosbuvir (Sovaldi), (7) Sofosbuvir and velpatasvir (Epclusa), and (8) Sofosbuvir, velpatasvir, and voxilaprevir (Vosevi). See, e.g., Kish et al., P T. 42:316-329, 2017; and Dahiya et al., BCMJ 61:72-77, 2019. Administration of the pharmaceutical compositions and the known anti-HCV agents can be either concurrently or sequentially.
[0084] Pharmaceutical compositions containing a redesigned HCV E2 polypeptide or nanoparticle vaccine of the invention can be provided as components of a kit. Optionally, such a kit includes additional components including packaging, instructions and various other reagents, such as buffers, substrates, antibodies or ligands, such as control antibodies or ligands, and detection reagents. An optional instruction sheet can be additionally provided in the kits.
EXAMPLES
[0085] The following examples are offered to illustrate, but not to limit the present invention.
Example 1 Structure-Based Optimization of HCV Envelope Glycoprotein E2 Core
[0086] The HCV E2 ectodomain (E2TM or E2.sub.ECTO) is stabilized by nine conserved disulfide bonds, contains three variable regions including hypervariable region 1 (HVR1, a.a. 384-410), VR2 (a.a. 460-485), and VR3 (a.a. 570-580) and is covered with 11 N-linked glycans (see Goffard et al., Biochimie 85, 295-301, 2003) (
[0087] Here, we redesigned the VR2 disordered region that is anchored to the back layer and -sandwich by two disulfide bonds, C452-C620 and C494-0564 (
Example 2 Biochemical, Biophysical, and Antigenic Assessment of HCV E2mc3 Designs
[0088] 13 E2mc3 constructs from H77 and HK6a and two parental E2c3 constructs (see, Tzarum et al., Sci Adv 5, eaav1882, 2019; and Kong et al., Proc. Natl. Acad. Sci. U.S.A. 113, 12768-12773, 2016) were transiently expressed in HEK293 F cells and purified using immunoaffinity (see Kong et al., Science 342, 1090-1094, 2013) followed by size exclusion chromatography (SEC). Overall, the purified E2mc3 variants showed greater yield than their respective E2c3 constructs ranging from 5.0 to 11.5 mg from 1 L 293F transfection. AR3A-purified E2mc3 was mostly in monomeric form with a small aggregate peak (
Example 3 Characterization of Minimized Cores Derived from H77 and HK6a
[0089] Crystallization of H77 and HK6a E2 cores with Fabs from AR3A/B/C/D bNAbs led to structures of H77 E2mc3-v1 and E2mc3-v6 with AR3C and HK6a E2mc3-v1 with AR3B at 1.90 , 2.85 , and 2.06 , respectively (
Example 4 Design and Characterization of Nanoparticles Presenting Optimized E2 Cores
[0090] Recently, improved immunogenicity in mice was reported for a ferritin nanoparticle carrying soluble E2 (sE2, a.a. 384-661) that contains three full-length immunodominant variable loops (Yan et al., J. Infect. Dis. [Epub ahead of print], 2019). Here, we displayed our E2mc3 variants, which only present the conserved bNAb epitopes, on self-assembling nanoparticles as multivalent HCV vaccine candidates (
Example 5 E2 Core Nanoparticles Elicit Stronger Immune Responses than E2 Cores
[0091] We assessed H77 and HK6a E2 core nanoparticles in wild-type BALB/c mice in studies #1 and #2, respectively, using a short regimen (
Example 6 Distinctive Patterns of E2 Core and Nanoparticle Induced B Cell Response
[0092] We combined antigen-specific B cell sorting and antibody NGS to obtain a quantitative readout of vaccine-induced B cell responses and determine B cell patterns associated with different vaccine platforms (
Example 7 NAbs Induced by E2 Core and E2 Nanoparticle Target Different Epitopes
[0093] Mouse serum contains nonspecific antiviral activity, which may interfere with HCVpp assays. We purified mouse IgG from study #1 at week 11 for neutralization of H77 and SA13 HCVpps with starting IgG at 100 g/ml followed by a series of three-fold dilutions (
Example 8 Some Exemplified Materials and Methods
[0094] Structural design of truncated VR2 (tVR2): Based on the structure of bNAb AR3C-bound H77 E2c (PDB ID: 4MWF), the already shortened VR2 loop in E2c, i.e. the segment between C452 and C494, was manually truncated by removing exposed hydrophobic residues and a disulfide bond (C459-C486), resulting in the H77 E2mc3 construct (
[0095] Expression and purification of E2 antigens: All E2 cores (E2c3, E2mc3, and E2mc3 v1-v10) and E2p-based nanoparticles were transiently expressed in HEK293 F cells (Thermo Fisher) for biochemical, biophysical, and antigenic analyses. Briefly, 293 F cells were thawed and incubated with FreeStyle 293 Expression Medium (Life Technologies, CA) in a shaker incubator at 37 C., 135 rpm and 8% CO.sub.2. When the cells reached a density of 2.010.sup.6/ml, expression medium was added to reduce cell density to 1.010.sup.6/ml for transfection with polyethyleneimine (PEI) (Polysciences, Inc). Next, 900 g of plasmid in 25 ml of Opti-MEM transfection medium (Life Technologies, CA) was mixed with 5 ml of PEI-MAX (1.0 mg/ml) in 25 ml of Opti-MEM. After 30-min incubation, the DNA-PEI-MAX complex was added to 1 L 293 F cells. Culture supernatants were harvested five days after transfection, clarified by centrifugation at 1800 rpm for 20 min, and filtered using a 0.45 m filter (Thermo Scientific). E2 proteins were extracted from the supernatants using an AR3A antibody column as previously described (Long et al., Science 342, 1090-1094, 2013; and Tzarum et al., Sci Adv 5, eaav1882, 2019). Bound proteins were eluted three times, each with 5 ml of 0.2M Glycine (pH=2.2) and neutralized with 0.5 ml of Tris-Base (pH=9.0). The proteins were further purified by size exclusion chromatography (SEC) on a Superdex 75 Increase 10/300 GL column (GE Healthcare) for E2 cores and on a Superose 6 10/300 GL column (GE Healthcare) for E2p nanoparticles. E2mc3-v1-attached ferritin and I3-01 nanoparticles were produced in ExpiCHO cells (Thermo Fisher). Briefly, ExpiCHO cells were thawed and incubated with ExpiCHO Expression Medium (Thermo Fisher) in a shaker incubator at 37 C., 135 rpm and 8% CO.sub.2. When the cells reached a density of 1010.sup.6 ml.sup.1, ExpiCHO Expression Medium was added to reduce cell density to 610.sup.6 ml.sup.1 for transfection. The ExpiFectamine CHO/plasmid DNA complexes were prepared for 100-ml transfection in ExpiCHO cells following the manufacturer's instructions. For these two nanoparticles, 100 g of plasmid and 320 l of ExpiFectamine CHO reagent were mixed in 7.7 ml of cold OptiPRO medium (Thermo Fisher). After the first feed on day one, ExpiCHO cells were cultured in a shaker incubator at 32 C., 120 rpm and 8% CO.sub.2 following the Max Titer protocol with an additional feed on day five (Thermo Fisher). Culture supernatants were harvested 13 to 14 days after transfection, clarified by centrifugation at 4000 rpm for 20 min, and filtered using a 0.45 m filter (Thermo Fisher). The AR3C antibody column was used to extract E2mc3-attached nanoparticles from the supernatants, which was followed by SEC on a Superose 6 10/300 GL column. For E2 cores and nanoparticles, protein concentration was determined using UV.sub.280 absorbance with theoretical extinction coefficients.
[0096] Blue native polyacrylamide gel electrophoresis (BN-PAGE): HCV E2 core nanoparticles were analyzed by blue native polyacrylamide gel electrophoresis (BN-PAGE) and stained with Coomassie blue. The protein samples were mixed with G250 loading dye and added to a 4-12% Bis-Tris NuPAGE gel (Life Technologies). BN-PAGE gels were run for 2.5 hours at 150 V using the NativePAGE running buffer (Life Technologies) according to the manufacturer's instructions.
[0097] Enzyme-linked immunosorbent assay (ELISA): Each well of a Costar 96-well assay plate (Corning) was first coated with 50 l PBS containing 0.2 g of the appropriate antigens. The plates were incubated overnight at 4 C., and then washed five times with wash buffer containing PBS and 0.05% (v/v) Tween 20. Each well was then coated with 150 l of a blocking buffer consisting of PBS, 20 mg ml.sup.1 blotting-grade blocker (Bio-Rad), and 5% (v/v) FBS. The plates were incubated with the blocking buffer for 1 hour at room temperature, and then washed five times with wash buffer. In the mouse sample analysis, serum or plasma was diluted by 50-fold in the blocking buffer and subjected to a 10-fold dilution series. For each sample dilution, a total of 50 l volume was added to the wells. Each plate was incubated for 1 hour at room temperature, and then washed five times with wash buffer. A 1:2000 dilution of horseradish peroxidase (HRP)-labeled goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories) was then made in the wash buffer, with 50 al of this diluted secondary antibody added to each well. The plates were incubated with the secondary antibody for 1 hour at room temperature, and then washed five times with wash buffer. Finally, the wells were developed with 50 l of TMB (Life Sciences) for 3-5 min before stopping the reaction with 50 l of 2 N sulfuric acid. The resulting plate readouts were measured at a wavelength of 450 nm.
[0098] Bio-layer interferometry (BLI): The kinetics of E2 cores and nanoparticle binding to HCV-specific antibodies was measured using an Octet Red96 instrument (fortBio, Pall Life Sciences). All assays were performed with agitation set to 1000 rpm in fortBio 1 kinetic buffer. The final volume for all the solutions was 200 l per well. Assays were performed at 30 C. in solid black 96-well plates (Geiger Bio-One). 5 g ml.sup.1 of antibody in 1 kinetic buffer was loaded onto the surface of anti-human Fc Capture Biosensors (AHC) for E2 cores and of anti-human Fc Quantitation Biosensors (AHQ) for nanoparticles for 300 s. A 60 s biosensor baseline step was applied prior to the analysis of the association of the antibody on the biosensor to the antigen in solution for 200 s. A two-fold concentration gradient of antigen, starting at 3.57 M for E2 cores and 52.08 nM for nanoparticles, depending on the size, was used in a titration series of six. The dissociation of the interaction was followed for 300 s. Correction of baseline drift was performed by subtracting the mean value of shifts recorded for a sensor loaded with antibody but not incubated with antigen and for a sensor without antibody but incubated with antigen. Octet data were processed by FortBio's data acquisition software v.8.1. Experimental data were fitted with the binding equations describing a 2:1 interaction to achieve optimal fitting. Of note, E2mc3-v1 binding was also measured using AHQ to facilitate the comparison of antibody binding signals with nanoparticles.
[0099] Differential scanning calorimetry (DSC): Thermal melting curves of HCV E2 core glycoproteins were obtained with a MicroCal VP-Capillary calorimeter (Malvern). The purified E2 glycoproteins produced from 293S cells were buffer exchanged into 1PBS and concentrated to 27-50 M before analysis by the instrument. Melting was probed at a scan rate of 90 C..Math.h.sup.1 from 25 C. to 110 C. Data processing, including buffer correction, normalization, and baseline subtraction, was conducted using the standardized protocol from the Origin 7.0 software.
[0100] Protein expression and purification for crystallization: The E2 constructs were expressed and purified as described above. Fabs AR3A and AR3B were expressed and purified as previously described by Giang et al., Proc. Natl. Acad. Sci. U.S.A. 109:6205-6210, 2012). The mAbs were purified on a protein G affinity column followed by size exclusion chromatography using a Superdex-200 column (Pharmacia) in 50 mM NaCl, 20 mM Tris-HCl (pH=7.2) buffer.
[0101] Crystallization and structural determination of HK6a E2c3-Fab E1-AR3A-protein G complex. The HK6a E2c3-Fab E1-AR3A complex was formed by overnight incubation of purified E2 and Fabs in a molar ratio of 1:1.2:1.25 (E2:Fab E1:Fab AR3A) at room temperature followed by size exclusion chromatography (Superdex-200) to remove unbound Fabs using 20 mM Tris and 50 mM NaCl (pH=7.2) buffer. Crystallization experiments were performed using our high-throughput CrystalMation robotic system (Rigaku) using the vapor diffusion sitting drop method (drop size 0.3 l) at 20 C. and resulted with crystals that diffracted to 5 . To improve crystal resolution, prior to the crystallization experiment, domain III of protein G (PDB entry 1IGC) was added to the HK6a E2c3-Fab E1-AR3A complex in a molar ratio of 1:2 (complex: protein G). These experiments resulted in crystals of HK6a E2c3-Fab E1-AR3A-protein G that diffracted to 3.40 . Crystals were obtained using a reservoir solution of 0.2M magnesium chloride, 10% (w/v) PEG 3000, 15% ethylene glycol, 0.1M Na-cacodylate, pH=6.5. Prior to data collection, crystals were flash cooled in liquid nitrogen. Diffraction data sets were collected at Stanford Synchrotron Radiation Lightsource (SSRL). Data were integrated and scaled using HKL2000 and structure was solved by molecular replacement method using Phaser with the HK6a E2c3-AR3A (PDB entry 6BKB) as a search model. Structure refinement was carried out in Phenix and model building with COOT.
[0102] Crystallization and structural determination of E2mc3-Fab complexes: Crystallization experiments were performed for H77 E2mc3, H77 E2mc3v-1, H77 E2mc3v-6, HK6a E2mc3, and HK6a E2mc3v-1 in complex with AR3A, AR3B, AR3C, and AR3D Fabs. The E2-Fab complexes were formed by overnight incubation of purified E2 and Fabs in a molar ratio of 1:1.25 (E2:Fab) at room temperature followed by size exclusion chromatography (Superdex-200) to remove unbound Fabs using 20 mM Tris and 50 mM NaCl (pH=7.2) buffer. Crystallization screening using our high-throughput CrystalMation robotic system (Rigaku) using the vapor diffusion sitting drop method (drop size 0.3 l) at 20 C. resulted in crystals of H77 E2mc3-v1-AR3C, H77 E2mc3-v6-AR3C, and HK6a E2mc3-v1-AR3B that diffracted to 1.90 , 2.85 , and 2.06 , respectively. Crystals of the H77 E2mc3-v1-AR3C complex were obtained using a reservoir solution of 20% (w/v) PEG 3500, 0.2M di-ammonium hydrogen phosphate; H77 E2mc3-v6-AR3C complex from 20% (w/v) PEG 3500, 0.2M Na-thiocyanate, pH=6.9; and HK6a E2mc3-v1-AR3B complex from 20% (w/v) PEG 8000, 0.1M HEPES pH=7.5. Prior to data collection, H77 E2mc3-v6-AR3C and HK6a E2mc3-v1-AR3B crystals were cryoprotected with 10-15% ethylene glycol and flash cooled in liquid nitrogen. Diffraction data sets were collected at the Advanced Photon Source (APS). Data were integrated and scaled using HKL2000. Structures were solved by molecular replacement method using Phaser with the H77 E2c-AR3C or HK6a E2c3-AR3B (PDB entry 4MWF or 6BKC) as a search model. Structure refinement was carried out in Phenix and model building with COOT.
[0103] Negative stain electron microscopy (EM): The EM experiments were conducted at the Scripps Core Microscopy Facility. Briefly, nanoparticle samples were prepared at the concentration of 0.01 mg/ml. Carbon-coated copper grids (400 mesh) were glow-discharged and 8 L of each sample was adsorbed for 2 minutes. Excess sample was wicked away and grids were negatively stained with 2% uranyl formate for 2 minutes. Excess stain was wicked away and the grids were allowed to dry. Samples were analyzed at 80 kV with a Talos L120C transmission electron microscope (Thermo Fisher) and images were acquired with a CETA 16M CMOS camera.
[0104] Mouse immunization and sample collection: The Institutional Animal Care and Use Committee (IACUC) guidelines were followed with animal subjects tested in the immunization study. Eight-week-old BALB/c mice were purchased from The Jackson Laboratory. The mice were housed in ventilated cages in environmentally controlled rooms at TSRI, in compliance with an approved IACUC protocol and AAALAC guidelines. At week 0, each mouse was immunized with 200 l of antigen/adjuvant mix containing 50 g of antigen and 100 l AddaVax adjuvant (Invivogen) per manufacturer's instruction via the intramuscular (i.m.) route. At weeks 3, 6 and 9, the animals were boosted with 50 g of antigen formulated in AddaVax adjuvant. At week 11, the animals were terminally bled through the retro orbital membrane using heparinized capillary tubes. Samples were diluted with an equal volume of PBS and then overlaid on 4.5 ml of Ficoll/Histopaque in a 15 ml SepMate tube (StemCell) and spun at 1200 RPM for 10 min at 20 C. to separate plasma and cells. The plasma was heat inactivated at 56 C. for 30 min, spun at 1200 RPM for 10 min, and sterile filtered. The cells were washed once in PBS and then resuspended in 1 ml of ACK Red Blood Cell lysis buffer (Lonza). After two rounds of washing with PBS, PBMCs were resuspended in 2 ml of Bambanker Freezing Media (Lymphotec Inc.). Spleens were also harvested and grounded against a 40-m cell strainer (BD Falcon) to release the splenocytes into a cell suspension. The cells were centrifuged, washed in PBS, treated with 10 ml of RBC lysis buffer per manufacturer's specifications, and resuspended in Bambanker Freezing Media for cell freezing. While serum and plasma were used in HCVpp neutralization assays, 80% of the serum from individual mice in study #1 (9, 10, and 10 in groups 1, 2, and 3, respectively) was purified using a 0.2-ml protein G spin kit (Thermo Scientific) following the manufacturer's instructions. Purified IgGs were used to assess the polyclonal serum NAb response in HCVpp assays.
[0105] HCV neutralization assay: HCV pseudotyped particle (HCVpp) assays were utilized to assess the neutralizing activity of vaccine-induced antibody response in mouse sera, as well as synthesized antibodies from the next-generation sequencing (NGS) analysis of bulk-sorted mouse splenic B cells. Briefly, HCVpps were generated by co-transfection of 293T cells with pNL4-3.lucR-E-plasmid and the corresponding expression plasmids encoding the E1E2 genes at a 4:1 ratio by polyethylenimine as previously described by Bazzill et al., Nano Lett. 18:7832-7838, 2018. In vitro neutralization was carried on Huh7.5 cells using a single dilution of 1:50 for mouse sera and three concentrations (10 g/ml, 1.0 g/ml, and 0.1 g/ml) for antibodies. Full neutralization curves were determined for IgGs purified from mice in study #1 against autologous H77 (1a) and heterologous SA13 (5a), with a starting IgG concentration of 100 g/ml and a series of three-fold dilutions.
[0106] Bulk sorting of HCV E2-specific mouse B cells: Spleens were harvested from immunized mice 15 days after the last immunization and cell suspension was prepared. Cells were stained as follows: dead cells were excluded by staining with Fixable Aqua Dead Cell Stain kit (Thermo Fisher L34957). Receptors FcIII (CD16) and FcII (CD32) were blocked by adding 20 l of 2.4G2 mAb (BD Pharmigen N553142). Cells were then incubated with 10 g/ml of biotinylated HCV E2mc3 protein. Briefly, E2mc3 was generated by biotinylation of the individual Avi-tagged HCV E2mc3 using biotin ligase BirA according to the manufacturer's instructions (Avidity LLC). Biotin excess was removed by SEC on a Superdex 200 column (GE Healthcare). In the SEC profile, the Avi-tagged E2mc3 peak is centered at 14.5 ml, while a broader peak of biotin ligase can be found at 18-23 ml. Cells and biotinylated proteins were incubated for 5 min at 4 C., followed by the addition of 2.5 l of anti-mouse IgG fluorescently labeled with FITC (Jackson ImmunoResearch 115-095-071) and incubated for 15 min at 4 C. Finally, 5 l of premium-grade allophycocyanin (APC)-labeled streptavidin were added to the cells and incubated for 15 min at 4 C. In each step, cells were washed with DPBS and the sorting buffer was 0.5 ml FACS buffer. FITC.sup.+ APC.sup.+ E2mc3 specific B cells were sorted using BD FACSAria II into Eppendorf tube with 500 l of FACS buffer.
[0107] Next-generation sequencing (NGS) and bioinformatics analysis of mouse B cells: A 5-rapid amplification of cDNA ends (RACE) protocol has been reported for unbiased sequencing of mouse B cell repertoires. See He et al., Sci. Adv. 4, eaau6769, 2018; and Morris et al., mBio 8, e00036-00017, 2017. Here, this protocol was applied to bulk-sorted, E2-specific mouse splenic B cells. Briefly, 5-RACE cDNA was obtained from bulk-sorted splenic B cells of each mouse with SMART-Seq v4 Ultra Low Input RNA Kit for Sequencing (TaKaRa). The immunoglobulin PCRs were set up with Platinum Taq High-Fidelity DNA Polymerase (Life Technologies) in a total volume of 50 l, with 5 l of cDNA as template, 1 l of 5-RACE primer, and 1 l of 10 M reverse primer. The 5-RACE primer contained a PGM/S5 P1 adaptor, while the reverse primer contained a PGM/S5 A adaptor. We adapted the mouse 3-C.sub.1-3/3-C.sub. inner primers and 3-mCK outer primer as reverse primers for 5-RACE PCR processing of heavy and light (K) chains. A total of 25 cycles of PCR was performed and the expected PCR products (500-600 bp) were gel purified (Qiagen). NGS was performed on the Ion S5 GeneStudio system. Briefly, heavy and light (K) chain libraries from the same mouse were quantitated using Qubit 2.0 Fluorometer with Qubit dsDNA HS Assay Kit, and then mixed using a ratio of 3:1 before being pooled with antibody libraries of other mice at an equal ratio for sequencing. Template preparation and (Ion 530) chip loading were performed on Ion Chef using the Ion 520/530 Ext Kit, followed by sequencing on the Ion S5 system with default settings. The mouse Antibodyomics pipeline was used to process the raw data and to determine distributions for germline gene usage, somatic hypermutation (SHM), germline divergence, and H/KCDR3 loop length.
[0108] List of some sequences disclosed herein.
TABLE-US-00002 E2(H77genotype1a)(SEQIDNO:1),HCV polyproteinresidues384-746 ETHVTGGSAGHTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNDSL TTGWLAGLFYRHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDER PYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAND TDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPT DCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYV GGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLP ALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCS CLWMMLLISQAEA E2TM(H77isolate)(SEQIDNO:2),HCV polyproteinresidues384-717 ETHVTGGSAGHTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNDSL TTGWLAGLFYRHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDER PYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAND TDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPT DCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYV GGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLP ALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWE E2c(H77isolate)(SEQIDNO:3),engineeredcore sequence QLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFDSSGCPERLASCGS SGCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAND TDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGDNTLLCPT DCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYV GGVEHRLEAACN(theVR2disorderedregionunderlined) E2c3(H77isolate)(SEQIDNO:4),engineeredcore sequence QLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFDSSGCPERLASCGS SGCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAND TDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPGGPTDGGSGPWITPR CMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACN(theVR2 disorderedregionunderlined) E2mc3(SEQIDNO:26),redesignedE2core QLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFDSSGCPERASGHYP RPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNN TGNWFGCTWMNSTGFTKVCGAPPGGPTDGGSGPWITPRCMVDYPYRLWHY PCTINYTIFKVRMYVGGVEHRLEAACN(tVR2sequence underlined) E2mc3variants1-10(SEQIDNOs:27-36):the PERSAG(SEQIDNO:52)motifisreplaced respectivelywiththe6aaor5aasequencesshown inSEQIDNOs:11-20. E2mc3(HK6agenotype6a),redesignedE2core(SEQ IDNO:37) QLINTNGSWHINRTALNCNDSLQTGFITSLFYAKNVDSSGCPERASGHYP RPCDVVSARTVCGPVYCFTPSPVVVGTTDKLGIPTYNWGENETDVFMLES LGGWFGCTWMNSTGFTKTCGAPPGGPTDGGSGPWITPRCLVDYPYRLWHY PCTVNFTLHKVRMFVGGIEHRFDAACN(tVR2sequence underlined) E2mc3(HK6agenotype6a)variant1(SEQIDNO:38): QLINTNGSWHINRTALNCNDSLQTGFITSLFYAKNVDSSGCQNWDEPHYP RPCDVVSARTVCGPVYCFTPSPVVVGTTDKLGIPTYNWGENETDVFMLES LGGWFGCTWMNSTGFTKTCGAPPGGPTDGGSGPWITPRCLVDYPYRLWHY PCTVNFTLHKVRMFVGGIEHRFDAACN(changedresiduesin tVR2underlined) tVR2sequencesofE2mc3variants1-10: CQNWDEPHYPRPC(SEQIDNO:65),CKVNIDPHYPRPC (SEQIDNO:66),CEKVEELHYPRPC(SEQIDNO:67), CPDENMKHYPRPC(SEQIDNO:68),CKREEKMHYPRPC (SEQIDNO:69),CPKTEVHYPRPC(SEQIDNO:70), CKRVDIHYPRPC(SEQIDNO:71),CPSDMVHYPRPC(SEQID NO:72),CPNEEEHYPRPC(SEQIDNO:73),and CKKEIRHYPRPC(SEQIDNO:74).
[0109] The invention thus has been disclosed broadly and illustrated in reference to representative embodiments described above. It is understood that various modifications can be made to the present invention without departing from the spirit and scope thereof.
[0110] It is further noted that all publications, sequence accession numbers, patents and patent applications cited herein are hereby expressly incorporated by reference in their entirety and for all purposes as if each is individually so denoted. Definitions that are contained in text incorporated by reference are excluded to the extent that they contradict definitions in this disclosure.