Human G protein alpha subunit gail with at least one mutated amino acid residue

Abstract

The present application discloses in detail mutant ligands of the human G protein alpha-subunit -Gi1-, wherein at least one amino acid residue has been replaced with alanine if the at least one amino acid residue is a non-alanine residue, or at least one amino acid residue has been replace with glycine if the at least one amino acid residue is alanine and wherein the at least one amino acid residue is comprised in a first group containing of the amino acid residues with position R32A, K54A, I55A, I56A, H57A, R176A, E245A, Y296A, T327A, N331A, V332A and D350A or is comprised in a second group containing G42A, A59G, T177A, D200A, A226G, E297A, A300G and F334A or is comprised in a third group containing V50A, A59G, R178A 30 and K180A.

Claims

1. A mutant human G protein alpha-subunit -G.sub.i1-, wherein: (A) at least one amino acid residue of wild-type of the human G-protein-alpha-subunit-G.sub.i1-, has been replaced; (B) the at least one amino acid residue replaced is selected from (1) a first group consisting of the amino acid residues with position R32A, K51A, K54A, I55A, I56A, H57A, R176A, E245A, T327A, N331A, V332A, and D350A (2) a second group consisting of amino acid residues with position G42A, A59G, T177A, D200A, A226G, E297A, A300G, and F334A, or (3) a third group consisting of amino acid residues with position V50A, R178A, and K180A; and (C) the wild-type of the human G protein alpha-subunit -G.sub.i1- comprises residues 23-380 of SEQ ID NO:1: MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEE ECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQL VLAGAAEEGFMTAELAGVI KRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLF DSICNNKWFTDTSIILFLNKKDLFEEKIKKKEIYTHFTCATDTKNVQFVFDAVTDVIIKNCGLF.

2. A mutant G protein comprising a mutant human G protein alpha-subunit -G.sub.a1-, wherein: (A at least one amino acid residue of wild-type human G protein alpha-subunit-G.sub.i1- has been replaced with (B) the at least one amino acid residue replaced is selected from (1) a first group consisting of R32G.HNS1.3, K51G.H1.6, K54G.H1.9, I55G.H1.10, I56G.H1.11, H57G.H1.12, R176H.HF.6, E245G.H3.4, T327G.S6H5.4, N331G.H5.3, V332G.H5.4, and D350G.H5.22 (2) a second group consisting of G42G.S1H1.3, A59G.H1HA.2, T177G.HFS2.1, D200G.S3.7, A226G.S4.7, E297G.H4.2, A300G.H4.5, and F334G.H5.6, (3) a third group consisting of V50G.H1.5, R178G.HFS2.2, and K180G.HFS2.4, (C a common G protein numbering system (CGN) is used in the first, second, and third groups, wherein in said common G protein numbering system, the superscript next to the residue number denotes (i) either the GTPase (G) or helical (H) domain, (ii) the secondary structure element within each domain, and (iii) its position within this structural element according to a sequence alignment of 973 G protein sequences And (D) (the wild-type of the human G protein alpha-subunit -G.sub.i1- comprises residues 23-380 of SEQ ID NO:1: MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEE ECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQL VLAGAAEEGFMTAELAGVI KRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTF KDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLF DSICNNKWFTDTSIILFLNKKDLFEEKIKKKEIYTHFTCATDTKNVQFVFDAVTDVIIKNCGLF.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) Preferred examples of the present invention are hereinafter described in more detail with reference to the attached drawings which depict in:

(2) FIG. 1 schematically an HTP assay for monitoring effects of Gi1 alanine mutants in R*-Gi complex;

(3) FIG. 2 a visualization of R*_Gi (WT) complex by native gel electrophoresis;

(4) FIG. 3 the monitoring of the thermal dissociation (Td) of R*-Gi complex by native gel electrophoresis;

(5) FIG. 4 a statistics analysis of R*-Gi (WT) complex and Tm of WT Gi1-GDP or GTPS;

(6) FIG. 5 a characterization of Gi1 alanine mutants impaired in formation of R*-Gi complex;

(7) FIG. 6 a characterization of Gi1 alanine mutants stabilizing the R*-Gi complex;

(8) FIG. 7 a characterization of heterotrimer (Gi) formation by analytical size-exclusion chromatography (FSEC);

(9) FIG. 8 the legend for the Tables 1 to 3 shown in FIGS. 9 to 11;

(10) FIG. 9 Table 1 showing twelve Gi1 mutants having a higher binding ability in the R*-Gi complex as compared to the WT;

(11) FIG. 10 Table 2 showing eight Gi1 mutants having a higher capability to stabilize the GDP-bound state as compared to the WT; and

(12) FIG. 11 Table 3 showing four Gi1 mutants having a capability to stabilize the GTP-bound state as compared to the WT.

DETAILED DESCRIPTION OF THE INVENTION

(13) According to the present invention, an alanine scanning study covering 99% of the G.sub.i1 sequence was performed and the effects of each amino acid on Rhodopin-G.sub.i complex formation and complex stability, as well as on the stability of GDP and GTPS (non-hydrolysable analog of GTP)-bound states of G.sub.i1 is characterized. Comparison of the effects contributed by each residue provide one functional map of G subunit in inactive and active conformations, which significantly extending the understanding of the G protein activation process. The alanine scanning study has been systematically executed as HTP assay for monitoring effects of G.sub.i1 alanine mutants in R*-G.sub.i complex. The recombinant alanine mutants were prepared by HTP purification and the endogenous rhodopsin and subunit were prepared from bovine retinas. For formation of R*_Gi complex, Gi1 and subunit were reconstituted to Gi heterotrimer, followed by mixing with rhodopsin and light activation. The formed R*_Gi complexes were visualized by native gel electrophoresis and the gel bands of complexes were quantified by ImageJ software. In each round, wild-type G.sub.i1 was always included as reference control.

(14) To examine how each single alanine mutant of G.sub.i1 responses to rhodopsin-mediated activation, a novel HTP screening assay based on native gel electrophoresis (NPAGE) was developed by which the relative amount (see methods) and the relative stability (see methods) of activated rhodopsin-bound complex (R*-G.sub.i) constituted with each alanine mutant of G.sub.i1 could be measured and compared. The most interesting results are shown in Tables 1 to 3 provided in FIGS. 9 to 11.

(15) FIG. 8 shows the legend for a better understanding of FIGS. 9 to 11. The tables show for example the residue number that has been replaced with alanine if the amino acid at that position is a non-alanine residue and has been replaced with glycine if the amino acid at that position is an alanine residue. The tables further comprise the experimental data on the thermostability of the GDP and GTPS bound states of the G.sub.i1, the data on the complex formation efficiency relative to the wt G.sub.i1 and the stability of the complex after incubation at elevated temperature, again relative to the complex of rhodopsin with wt G.sub.i1. A detailed description of the experimental procedures and the definition of the complex stability is provided in the Section Materials and Methods.

(16) Meanwhile, to compare together with nucleotide-bound state, the thermal stability of each single alanine mutant of G.sub.i1 was measured in addition of GDP or GTPS (see also FIG. 2).

(17) FIG. 2 shows a visualization of R*_Gi (WT) complex by native gel electrophoresis. The displayed R*_Gi complex was formed with wild-type Gi1 as described in methods and FIG. 1. To further confirm the complex, the R*_Gi (WT) was incubated with 100 M GTPS at 20 C. for 1 hour. The R*_Gi (WT) complex (+/GTPS) were visualized by native gel electrophoresis, as well as WT Gi1, subunit, Gi1 heterotrimer, and activated rhodopsin as reference markers. It clearly shows that the R*_Gi complex with empty-pocket becomes disassociated in addition of GTPS.

(18) FIG. 3 illustrates the monitoring of the thermal dissociation (Td) of R*-Gi complex by native gel electrophoresis. The formation of R*_Gi complex was performed as described in methods and FIG. 1. The R*_Gi complex formed with wild-type Gi1 (a), R32A (b), I55A (c) or N331A (d) were heated in the indicated temperature and the heated samples were visualized by native gel electrophoresis; e) The relative amount of complex at each temperature was normalized (0-100%) to the amount of complex at 16.4 C. and fitted with sigmoidal Boltzmann equation to obtain Td50 values. The determined Td50 of R*_Gi (WT) is 36.00.12 C. The Td50 of R*_Gi (R32A), R*_Gi (I55A) and R*_Gi (N331A) are 36.70.08 C., 37.40.05 C. and 37.80.08 C., respectively. Data points represent means.d. from three individual experiments.

(19) FIG. 4 shows a statistics analysis of R*-Gi (WT) complex and Tm of WT Gi1-GDP or GTPS. The formation of R*-Gi (WT) complex with wild-type Gi1 and measurement of Tm were performed as described in methods and FIG. 1. a) The relative amount of R*-Gi (WT) at 4 C. was derived from 33 individuals measurements. The mean is 1003.61%. The individual values are grouped in intervals with widths of 3.61% and are shown in their frequency. The frequency distribution is fitted with Gaussian model (dotted line) with an R2 of 0.9839. b) The relative stability of R*-Gi (WT) at 36.3 C. was determined from 38 individual measurements with the mean of 43.93.20%. The fitted frequency distribution with Gaussian model is with an R2 of 0.9631. The frequency distributions of Tm of WT Gi1 in addition of 1 mM GDP and 0.1 mM GTPS are shown in (c) and (d) from 25 and 24 individual measurements, respectively. The mean of Tm of WT Gi1-GDP or GTPS are 63.680.39 C. and 70.510.26 C.

(20) FIG. 5 depicts a characterization of Gi1 alanine mutants impaired in formation of R*-Gi complex. a) The formation of R*-Gi complex with Y320A, L348A, G352A and L353A of Gi1 were performed as described in methods and FIG. 1. The formed complexes were heated at 36.3 C. The R*-Gi complex at 4 C. and the heated R*-Gi complex at 36.3 C. were visualized by native gel electrophoresis. b) The amounts of complexes were determined by quantifying the gel bands of complex with ImageJ software. The relative amount of complex (%) at 4 C. is normalized to the amount of R*-Gi (WT) complex. Data points represent means.d. from three individual experiments. The assay clearly shows that these four alanine mutants are severely impaired in formation of R*-Gi complex.

(21) FIG. 6 illustrates a characterization of Gi1 alanine mutants stabilizing the R*-Gi complex. a) The formation of R*-Gi complexes were proceeded as described in methods and FIG. 1. The formed complexes were heated at 36.3 C. Then, the R*-Gi complex at 4 C. and the heated R*-Gi complex at 36.3 C. were visualized by native gel electrophoresis. b) The amounts of complexes were determined by quantifying the gel bands of complex with ImageJ software. The relative amount of complex (%) at 4 C. and relative stability of complex (%) at 36.3 C. were determined as described in methods. The result shows that these alanine mutants of Gi1 obviously enhance the thermostability of R*-Gi complex. c) Tm of Gi1 alanine mutants in additions of nucleotides (1 mM GDP or 0.1 mM GTPS) were determined by DSF assay. Data points represent means.d. from three individual experiments.

(22) FIG. 7 represents a characterization of heterotrimer (Gi) formation by analytical size-exclusion chromatography (FSEC). The last 48 alanine mutants which are not efficient in formation of R*-Gi complex are reconstituted with subunit to form Gi and characterized by FSEC as described in methods. The retention time of WT Gi1, subunit and reconstituted Gi are 11.15 min, 11.45 min and 10.26 min, respectively. a) and b) show the retention time of alanine mutants which are efficient in heterotrimer reconstitution. The inefficient alanine mutants in formation of heterotrimer are displayed in c) and d). Three alanine mutants forming oligomer reconstitution are shown in e) and f).

(23) While the mutations of the first group (R32G.HNS1.3, K51G.H1.6, K54G.H1.9, I55G.H1.10, I56G.H1.11, H57G.H1.12, R176H.HF.6, E245G.H3.4, T327G.S6H5.4, N331G.H5.3, V332G.H5.4, D350G.H5.22) stabilise the Rho*-G complex and are involved in the activation process, stabilisation or destabilisation of the inter-domain interface, or interactions with the receptor or the subunit (see also Table 1 in FIG. 9), the eight mutations in the second group (G42G.S1H1.3, A59G.H1HA.2, T177G.HFS2.1, D200G.S3.7, A226G.S4.7, E297G.H4.2, A300G.H4.5, F334G.H5.6) contribute to the stabilization of the GDP-bound state (see also Table 2 in FIG. 10, and the four mutations comprised in the third group (V50G.H1.5, A59G.H1HA.2, R178G.HFS2.2, K180G.HFS2.4) stabilize the GTP-bound state (see also Table 3 in FIG. 11.

(24) In order to allow the comparison and extrapolation of the findings to other G proteins, throughout this application the common G protein numbering system (CGN) proposed in Flock et al. [1] is used. In this system, the superscript next to the residue number denotes: i) either the GTPase (G) or helical (H) domain, ii) the secondary structure element within each domain (e.g. HN for helix N or S1 for beta sheet 1), and iii) its position within this structural element (e.g. 1), according to a sequence alignment of 973 G protein sequences. For example, L353G.H5.25 corresponds to the L353 in Gi1, GTPase domain, helix 5, and position 25 of the helix 5 in the universal alignment.

(25) Numerous studies have demonstrated that the last 11 residues in c-terminus of G play the critical role in recognizing and anchoring cognate receptors. Not surprisingly, the present assays also show the consistent results that many alanine mutants in last 11 amino acids (344-354aa) of G.sub.i1 significantly affect the formation of R*-G.sub.i complex, especially alanine substations of two invariantly conserved residues (L348 and L353) and G352 in extreme c-terminus of G.sub.i1 which are severely impaired in coupling with receptor. The thermal stability results also clearly show that these alanine mutants do not affect stability of nucleotide-bound state, but dramatically destabilize (except D350) the receptor-bound state, indicating the local conformational changes in c-terminus of G.sub.i1 induced by activated rhodopsin. It is well agreed with structures of rhodopsin coupled with c-terminal peptide of G and crystal structure of .sub.2AR/G.sub.s in which c-terminus of G reforms to alpha-helix from disordered loop and penetrates into the cytoplasmic core of transmembrane bundle of GPCRs.

(26) In receptor-mediated response, except c-terminus of G undergoes disorder-to-order conformational change, another substantially conformational alteration in GTPase domain is shown in 5-helix with obvious rigid body rotation and translation. The results clearly show that the movement of 5-helix need interrupt one intracellular stabilization network in GTPase domain of nucleotide-bound G.sub.i1, simultaneously, the relocated residues in 5 need quickly form the rearranged intracellular network to further stabilize both GTPase domain and R*-G.sub.i complex conformation. The observed intracellular network in GTPase domain of G.sub.i1 can be regarded as two subnetworks centred with beta sheet sandwich (4, 5 and 6).

(27) The subnetwork in GTPase domain which is characterized with dynamic alternations in conformation is surrounded by six-stranded sheet, 1 and 5. In nucleotide-bound state of G.sub.i1, this subnetwork is mainly formed by many highly conserved hydrophobic residues from 1-3 strands, 1-helix and inward residues of 5-helix. Alanine substitutions of these hydrophobic residues significantly destabilize GDP-bound conformation (4-18 C.) and mildly destabilize GTPS-bound state (2-5 C.). Especially, alanine replacement of F336 (invariantly conserved in G subfamilies) in 5-helix which is relocated to contact with IC2 loop of GPCR severely impairs G.sub.i1 to couple with nucleotides (Table 1), indicating that the relocation of F336 will cause dramatically destabilization of nucleotide-bound G conformation.

(28) Upon interaction with activated receptor, on the one hand, the present stability results show that the subnetwork in nucleotide-bound state of G.sub.i1 is rearranged by dramatically weakening contacts with 1: alanine mutations of residues (I49, M53, and I56 in 1, L38 of (1, T329 and V332 of 5) which are involved to tether 1 in G.sub.i1-GDP severely impair the stability of G.sub.i1-GDP, whereas they do not affect the relative stability of R*-G.sub.i complex. Especially, N331A (invariantly conserved) and adjacent V332A (highly conserved) in 5 obviously enhance the relative complex stability by 18% and 28%, respectively (Table 1, FIG. 6), indicating that the position of relocated N331 and V332 in 5 is characterized with apparent flexibility.

(29) Although it cannot completely concluded that the loose of helicity at the base of the 5-helix observed in .sub.2AR/G.sub.s is caused by losing contact with 1 or by the relocation of N331 and V332, the order-to-disordered transition in N-terminus of 5-helix will increase the flexibility of TCAT loop and facilitate the interruption between the adjacent TCAT site and GDP.

(30) On the other hand, the receptor-medicated response reforms the subnetwork in nucleotide-bound state of G.sub.i1 by strengthening the interaction with 4 and 5: alanine mutations of new introduced residues (I265 of 4, Y320 and H322 of 5, F334, V335, V339 and V342 of 5) are characterized with dramatically destabilizing the R*-G.sub.i complex (19-45%), whereas not affecting the stability of nucleotide-bound state (Table 1).

(31) Interestingly, in this subnetwork, alanine mutations of many residues which are important for stabilizing nucleotide-bound conformation do not affect the R*-G.sub.i complex formation (Table 1). However, except V335A and V339A, alanine replacements of all the new included residues (I265 of 4, Y320 and H322 of 5, F334 and V342 of 5) obviously form less amount of R*-G.sub.i complex (18-78% of WT level) (Table 1). To exclude the possibility that the insufficient formation of R*-G.sub.i complex (less than 20% of WT level) may be caused by inefficient heterotrimer reconstitution, the efficiency of heterotrimer reconstitution with subunit has been examined (See methods). The results show that the new involved residues are characterized with the similar ability of WT upon formation of heterotrimer (see FIG. 7), indicating that these residues play the critical role in allosteric activation of G protein upon receptor response.

(32) Especially, alanine substitution of Y320 (invariantly conserved in G subfamilies) in 5 severely impairs the R*-G.sub.i complex formation (see FIG. 5). In the whole alanine scanning, except three alanine mutants (L348A, G352A and L353A) in extreme c-terminus of G.sub.i1 impairing in complex formation, Y320A is the only one alanine mutant which does not directly interact with receptor, whereas it is deficient in coupling with activated rhodopsin (FIG. 5). It can be predicted that Y320 is one critical signal receiver and transmitter in receptor-mediated G protein activation. Indirectly, it implicates that Y320A may still be able to utilize the well-conserved L348, G352 and L353 in c-terminus of G.sub.i1 to couple with receptor and form the pre-coupled R*-G.sub.i(GDP). However, the pre-coupled conformation can be instantaneously disassembled because Y320A blocks the signal of GDP release transmitted from receptor. The previous researches also showed the existence of pre-coupled receptor complex in vivo and in vitro.

(33) Moreover, in GTPase domain, another observed subnetwork harboured by beta sheet sandwich, 3, 4 and G utilize many highly conserved hydrophobic residues to form hydrophobic interactions which stabilize both nucleotide-bound and receptor-bound conformations. Among those residues, many alanine mutants are characterized with obvious destabilization in GDP-bound state from 3 to 13 C. (Tm) and receptor-bound state from 30 to 40% ( relative complex stability), as well as mild destabilization in GTPS-bound state (1-5 C.) (Table 1). Additionally, the relative amount of R*-G.sub.i complex formed with many alanine mutants in this subnetwork is also less than 10-56% of WT level (Table S1). The results of heterotrimer reconstitution demonstrate that F250A (3), L266A, L268A (5) and I319A (6) show the comparable ability relative to WT in coupling with submit. Since these residues are located far from the receptor binding interface, it suggests that they may also be involved in the allosteric activation of G protein and alanine mutation may affect the signal of GDP release transmitted from receptor.

(34) Upon formation of GPCR/G complex, HD domain was observed to be largely displaced again GTPase domain and stay in dynamic equilibrium with multiple conformations. The present stability results show that many hydrophobic residues in HD domain of G.sub.i1 form hydrophobic core packing to stabilize both nucleotide-bound and receptor-bound conformations. The sequence alignment result shows that these hydrophobic residues are highly conserved in G subtypes. It indicates that the observed inherent hydrophobic core packing can be supposed to play the critical role in stabilizing the dynamic conformations of HD domain in receptor-bound state. Especially, alanine mutants in E obviously destabilize R*-G.sub.i conformation, without affecting the stability of nucleotide-bound states, suggesting that the subtly internal-arrangement in HD domain is required to keep the integrity of displaced HD domain and stabilize the empty-pocket conformation of R*-G.sub.i complex.

(35) Furthermore, in the present binding assay with R*, except I78A of A and L175A of F show mild decrement (20%) in R*-G.sub.i complex formation, all alanine mutants in HD (63aa-176aa) of G.sub.i1 form highly comparable R*-G.sub.i complex (90-100% of WT level), implicating that helical domain in receptor-regulated response may function as one passive participant which exits with independent integrity without affecting overall ability of G subunit to couple with receptor.

(36) Another hallmark of G protein activation by receptors is to release GDP accompanied with separation between GTPase domain and HD domain. The stability results of interdomain interface in Gi1 (composed by N-terminal of A, F and 1) reveal that alanine mutations of involved residue dramatically destabilize GDP-bound state (5-14 C.), whereas they do not affect the relative stability of R*-Gi complex.

(37) The sequence alignment displays that the residues located in interdomain interface of Gi1 are highly conserved in G subfamilies. It implicates that any subtle conformational perturbations are possible to cause the destabilization in interdomain interaction of G-GDP, which will facilitate the domain separation in G subunit and release GDP. Interestingly, K51A, K54A and I55A of 1 obviously increase the relative R*-Gi complex stability by 17%, 22%, and 25% of WT level, respectively. The similar scenario is also observed in L175A and adjacent R176A in N-terminus of F by increment in relative complex stability of 9% and 17%.

(38) The enhanced stability in R*-Gi complex can be ascribed as decreasing the flexibility of areas composed by these residues, which is consistent with crystal structure of 2AR/Gs in which top of A and loop connected with N-terminus of F in Gs is disordered and invisible in structure. It indicates that the flexibility shown in N-terminus of F and top of A can be one intrinsic character and they function as hinge together with loop regions to allow a range of dynamic motion of HD domain in receptor-mediated response.

(39) Alternatively, the present results highlight the discriminate stability character of 1-helix in G.sub.i1: alanine replacement of residues in 1-helix (46-57aa) severely destabilizes GDP-bound conformation (except S47A, V50A and H57A), but not affects the relative stability of receptor-bound conformation (except Q52A) (FIG. 6), conversely, alanine mutants located in the top of 1 significantly enhance the relative complex stability. It is consistent with enhanced hydrogen exchange observed in 1-helix of Gs in 2AR-mediated response by DXMS analysis. Additionally, the sequence alignment shows that 1-helix is completely conserved in G subfamilies as KST (I/F) (V/L/I) KQM (K/R) I (I/L) H, among of which conserved KST sequence is part of prominent P-loop.

(40) Collectively, it can conclude that 1-helix functions as a central hub in nucleotide-bound conformation, which plays the predominant role in stabilizing GTPase domain together with linked 5-helix, tethering interdomain interaction and encapsulating the bound-nucleotide. Particularly, 1-helix is existence in metastable status in GDP-bound conformation. Once upon coupling with receptor, the distortion of 5-helix dramatically interrupts the interaction with 1-helix, which causes the transition of 1-helix from metastable status to super-unstable status. Consequentially, it leads domain separation and GDP release.

(41) In summary, alanine scanning method is used to provide the first complete molecular mapping of G.sub.i1 subunit in both nucleotide and receptor-bound states at each single residue resolution (FIG. 1 and Table 1). The present results clearly reveal that Gi1 subunit utilizes many highly conserved residues to form one global interaction network which stabilizes different conformational states and regulate the allosteric activation of Gi protein. Based on the observations, it can be expected that receptors firstly sense the disordered -terminus of G subunit in GDP-bound state. Once c-terminus of G subunit is trapped into receptor, it forms pre-coupled R*-G (GDP) conformation. Simultaneously, the signal of GDP release transmitted from receptors is propagated to G protein through unvaried tryptophan (5), which triggers the formation of allosteric activation network through the rotation and translation of 5-helix. The relocation of 5-helix causes the dismantlement of N-terminus of 5 to increase the flexibility of TCAT loop, as well as dramatically interrupts the interactions of 1. The perturbations in 1 lead the metastable 1 to become apparently unstable, which further destabilise the interdomain interface and P-loop. While N-terminal of 1 completes order-to-disordered transition, HD domain is also completely displaced against GTPase domain accompanying with the release of GDP.

Section Materials and Methods

(42) 1) Alanine Scanning Mutagenesis.

(43) The alanine scanning expression library of G.sub.i1 was prepared as reported before, D. Sun, et al., AAscan, PCRdesign and MutantChecher: a suite for programs for primer design and sequence analysis for high-throughput scanning mutagenesis. PLoS ONE, 2013. 8(10): p. e78878. The wild-type (WT) plasmid was constructed by inserting human G protein alpha-subunit (G.sub.i1) into pJ411 vector (DNA 2.0) which incorporated a N-terminal 10-histidine tag followed by a TEV cleavage site. The alanine mutants were produced based on the WT plasmid by high-throughput (HTP) alanine mutagenesis as reported previously (Sun et al.). All 354 amino acid residues in G.sub.i1 were mutated. All non-alanine residues were replaced to alanine and alanine residues were substituted to glycine. The protein sequence of the construct used in the experiments was SEQ ID NO:1 set forth below:

(44) TABLE-US-00001 MKKHHHHHHHHHHENLYFQGGSMGCTLSAEDKAAVERSKMIDRNLREDGE KAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTI QSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIK RLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTR VKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALS DYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKI KKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATD TKNVQFVFDAVTDVIIKNNLKDCGLF*

(45) The amino acid numbers refer to the positions in the WT protein (starting MGC . . . ).

(46) 2) Preparation of native subunit (G).

(47) G was separated from endogenous transducin (Gt) as previously described S. Maeda, et al., Crystallization scale preparation of a stable GPCR signaling complex between constitutively active rhodopsin and G protein. PLoS ONE, 2014. 9(6): p. e98714. Briefly, dark-adapted bovine retinas (W L Lawson, USA) were exposed to room light at 4 C. overnight. The rod outer segment (ROS) membranes were collected by centrifugation in a 25-30% (w/w) sucrose gradient. After isotonic and hypotonic washes, Gt was dissociated from ROS membrane by adding GTP (Sigma-Aldrich). The collected Gt was filtered through 0.22 m membrane (Millipore Corp) and dialyzed against the dialysis buffer (10 mM Tris-HCl, pH 7.4, 2 mM MgC12, 1 mM DTT) containing 50% glycerol. G was further separated from the Gt on a Blue-Sepharose column (GE Healthcare) by a linear salt gradient (0-500 mM NaCl) in the dialysis buffer supplemented with 30% glycerol. The G was concentrated to 1-5 mg/ml and stored at 80 C.

(48) 3) Preparation of Bovine Rhodopsin.

(49) Bovine rhodopsin was extracted from dark-adapted ROS membranes which were prepared according to known Okada's method. The dark-adapted ROS membranes were solubilized in solubilization buffer (50 mM sodium acetate, pH 6, 1 mM EDTA, 2 mM 2-mercaptoethanol, 3 mM CaCl2, 3 mM MgCl2, 3 mM MnCl2, 100 mM NaCl) supplemented with 80 mM (4.1%) -dodecyl-D-n-maltoside (DDM) at 4 C. overnight. After centrifugation at 30,000 rpm in a Ti70 rotor, the supernatant was diluted with solubilisation buffer to a concentration of DDM as 0.4%. The diluted sample was loaded to a column packed with ConA Sepharose resin (GE Healthcare) which was equilibrated with washing buffer (solubilisation buffer supplemented with 0.02% DDM). After extensive washing, bovine rhodopsin was eluted with solubilisation buffer supplemented with 0.02% DDM and 0.2 M -D-methylmannoside. The eluted bovine rhodopsin was concentrated to 1-4 mg/ml and stored at 80 C.

(50) 4) High Throughput (HTP) Culturing and Purification of Gi1 Alanine Mutants.

(51) The recombinant Gi1 alanine mutants were expressed in BL21 (DE3) competent cells. The cultures were grown at 37 C. in TB media (GERBU Biotechnik GmbH) by using 24 well plates (mutant/well) (Whatman UniFilter Microplates, GE Healthcare). The culture volume was 5 ml/well. When the OD600 reached 0.6, cells were induced with 0.5 mM IPTG and continued to grow for 20 hours at 20 C. The cell were harvested by centrifugation resuspended in the binding buffer (25 mM Tris-HCl, pH 7.4, 500 mM NaCl, 10% glycerol, 50 mM imidazole, 5 mM 2-mercaptoethanol) and transferred to a 96 deep-well plate (Thermo Scientific). The re-suspended cells were disrupted by sonication for 1 min using a SONICS VCX-600 sonicator equipped with an 8-pin probe.

(52) After clarifying cell lysates by centrifugation, the supernatants were loaded to a 96 deep-well filter plate (one mutant per well) pre-loaded with 500 l cobalt chelating resin (GE Healthcare) and equilibrated with binding buffer. After extensive washing with binding buffer, the recombinant Gi1 alanine mutants were eluted with elution buffer (25 mM Tris-HCl, pH 7.4, 500 mM NaCl, 10% glycerol, 500 mM imidazole, 5 mM 2-mercaptoethanol). The eluted proteins were dialyzed against 25 mM Hepes, pH 7.4, 100 mM NaCl and 2 mM DTT using Slide-A-Lyzer MINI Dialysis Device (Thermo Scientific). Among of 354 alanine mutants, the purified R142AH.HD.9, Y230AG.s4h3.4, K270AG.s5hg.1 and D272AG.HG.2 were severely aggregated and could not be used in the further assays. The flowchart of HTP purification is shown in FIG. 1.

(53) 5) Characterization of the Effect of Gi1 Alanine Mutants on the Receptor-Bound State by a HTP Assay.

(54) In each round, WT Gi1 was always prepared in parallel with the Gi1 alanine mutants [Gi1(Ala)] to form rhodopsin-Gi protein complex [Rho*-Gi(WT)] as the reference control. The recombinant Gi1 alanine mutants (12.5 M) from HTP purification and the native Gt (10 M) were reconstituted to form heterotrimer (Gi) by incubation in a 96-well PCR plate (one mutant per well) (Eppendorf) on ice for 2 h. Under the dim-red light in the dark room, purified rhodopsin (18 M) was added and mixed with Gi in ice-cold assay buffer (25 mM Hepes, pH 7.4, 100 mM NaCl, 2 mM DTT, 0.02% DDM, 1 mM MgCl2, 0.16 unit/ml apyrase). After irradiation with orange light (>495 nm) on ice for 10 min, the tetramer complex Rho*-Gi(Ala) was formed by coupling the activated rhodopsin with Gi and the formed Rho*-Gi(Ala) complex was further incubated in the dark at 4 C. overnight. The reaction volume was 50 l for each alanine mutant. 20 l of each Rho*-Gi(Ala) complex was transferred to another 96-well PCR plate and heated for 30 min in a PCR machine (Eppendorf Mastercycler Gradient) at 36.3 C. After centrifugation at 3000 rpm for 10 min at 4 C., 14 l of formed Rho*-Gi(Ala) complex (4 C.) and 14 l of heated Rho*-Gi(Ala) complex (36.3 C.) were mixed with NativePAGE Sample Buffer (4) (Invitrogen) and NativePAGE 5% G-250 Sample Additive (Invitrogen), respectively. The mixtures were loaded onto 4-16% NativePAGE Bis-Tris-HCl Gels (Invitrogen) and gel electrophoresis was performed in a 4 C. cold room according to the manufacturer's protocol (Invitrogen). Protein markers were used with NativeMark Unstained Protein Standard (Invitrogen). The gel bands of Rho*-Gi complex were integrated and quantified using the ImageJ software. The complex formation efficiency (CF) (%) was obtained from the normalization of integrated density of Rho*-Gi complex band [IDC(Ala or WT), 4 C.] with integrated density of Rho*-Gi(WT) complex band [IDC(WT), 4 C.]. The complex stability (CS) (%) was defined as the normalization of integrated density of Rho*-Gi complex band [IDC(Ala or WT), 36.3 C.] with integrated density of Rho*-Gi(WT) complex band [IDC(Ala or WT), 4 C.].

(55) $\mathrm{CF}\left(\mathrm{Ala}\right)=\frac{{\mathrm{ID}}_c\left(\mathrm{Ala},4C.\right)}{{\mathrm{ID}}_c\left(\mathrm{WT},4C.\right)}100\%$$\mathrm{CS}\left(\mathrm{WT}\right)=\frac{{\mathrm{ID}}_c\left(\mathrm{WT},36.3C.\right)}{{\mathrm{ID}}_c\left(\mathrm{WT},4C.\right)}100\%$$\mathrm{CS}\left(\mathrm{Ala}\right)=\frac{{\mathrm{ID}}_c\left(\mathrm{Ala},36.3C.\right)}{{\mathrm{ID}}_c\left(\mathrm{Ala},4C.\right)}100\%$

(56) The CF (%) and CS (%) were defined as:
CF=CF(Ala)CF(WT)
CS=CS(Ala)CS(WT)

(57) The distribution and summary of CF efficiency and CS of each Gi1 alanine mutant are listed in FIG. 2 and Table 1. The flowchart diagram of HTP assay is shown in FIG. 1.

(58) 6) HTP Measurements of Thermal Stability Gi1 Alanine Mutants by Differential Scanning Fluorimetry (DSF).

(59) The thermostability of each Gi1 alanine mutant in the nucleotide-bound states was measured by HTP differential scanning fluorimetry (DSF). The samples were prepared on ice. 10 l of recombinant Gi1 alanine mutant stocks (0.7 g/l) were dispensed into a 96-well PCR plate (one mutant per well) (Eppendorf) and mixed with 100 l ice-cold assay buffer (25 mM Hepes, pH 7.4, 100 mM NaCl, 2 mM DTT) containing 5SYPRO-orange (Invitrogen) and nucleotides (1 mM GDP or 100 M GTPS). After mixing, 110 l reaction mixture of each alanine mutant was divided into 0.2 ml PCR tubes (Qiagen) as three samples of 35 l. The DSF experiments were performed with Rotor GeneQ (Qiagen) by ramping from 25 C. to 95 C. at a rate of 3 C./min. The melting temperature (Tm) was defined as the inflection point of the melting curve as analysed by the Rotor Gene Q Series Software. The Tm value of each Gi1 alanine mutant [Tm(Ala)] upon addition of the nucleotides was averaged from three individual experiments. The Tm value was defined as:
Tm=Tm(Ala)Tm(WT)

(60) In each round, WT Gi1 was always prepared in parallel with Gi1 alanine mutants as a reference control.

(61) In addition, the thermal shift of WT Gi1 in titration with GDP and GTPS were also performed with HTP DSF.

(62) 7) Analysis of Heterotrimer Formation by Fluorescence Assisted Size Exclusion Chromatography (FSEC)

(63) The recombinant Gi1 alanine mutants (6 M) and Gt (2 M) were reconstituted to form heterotrimer (Gi) in 100 l running buffer (25 mM Hepes, pH 7.4, 100 mM NaCl) overnight on ice. 80 l of reconstituted Gi was injected to superdex 200 packed in a Tricorn 10/200 column (GE Healthcare) equilibrated with the running buffer. The elution profile was monitored by protein-intrinsic fluorescence with ex: 280 nm and em: 340 nm at a flow rate of 1 ml/min. The retention time of the reconstituted Gi was integrated with UNICORN 5.2 software (GE Healthcare).