B7-H3 antibody, antigen-binding fragment thereof and medical use thereof

10899837 ยท 2021-01-26

Assignee

Inventors

Cpc classification

International classification

Abstract

A B7-H3 antibody, an antigen-binding fragment thereof and a medical use thereof are provided. Furthermore, a pharmaceutical composition containing the B7-H3 antibody or antigen-binding fragment thereof, and the use thereof as a medicament are provided. In particular, a use of a human B7-H3 antibody or antigen-binding fragment thereof for the manufacture of a medicament for the treatment of a B7-H3-associated disease or condition are described.

Claims

1. A monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof, which binds to human B7-H3, comprising: (i) an antibody heavy chain variable region comprising HCDR1, HCDR2, and HCDR3 having the amino acid sequences of SEQ ID NOs: 10, 11 and 12, respectively; and an antibody light chain variable region comprising LCDR1, LCDR2, and LCDR3 having the amino acid sequences of SEQ ID NOs: 13, 14 and 15, respectively; or (ii) an antibody heavy chain variable region comprising HCDR1, HCDR2, and HCDR3 having the amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively; and an antibody light chain variable region comprising LCDR1, LCDR2, and LCDR3 having the amino acid sequences of SEQ ID NOs: 19, 20 and 21, respectively.

2. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof according to claim 1, wherein the monoclonal antibody is a recombinant antibody.

3. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof according to claim 2, wherein the monoclonal antibody is a human recombinant antibody or antigen-binding fragment thereof.

4. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof according to claim 1, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a human germline light chain framework (FR) sequence or a modified human germline light chain FR sequence, and a human germline heavy chain FR sequence or a modified human germline heavy chain FR sequence.

5. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof according to claim 4, wherein the human recombinant antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 6 or 8 or a variant thereof; wherein the variant has a deletion, substitution or addition of 1-10 amino acids in the heavy chain variable region of SEQ ID NO: 6 or 8.

6. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof according to claim 4, wherein the human recombinant antibody comprises a light chain variable region having the amino acid sequence of SEQ ID NO: 7 or 9 or a variant thereof; wherein the variant has a deletion, substitution or addition of 1-10 amino acids in the light chain variable region of SEQ ID NO: 7 or 9.

7. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 1, wherein the anti-B7-H3 antibody further comprises a human antibody constant region, and the anti-B7-H3 antibody is a full-length antibody having the heavy chain and light chain amino acid sequences as shown in SEQ ID NOs: 22 and 23, respectively, or a full-length antibody having the heavy chain and light chain amino acid sequences as shown in SEQ ID NOs: 22 and 26, respectively, or a full-length antibody having the heavy chain and light chain amino acid sequences as shown in SEQ ID NOs: 24 and 25, respectively.

8. The monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 1, wherein the antigen-binding fragment is selected from the group consisting of a Fab, Fab, F(ab)2 and single-chain antibody (scFv), dimerized V region (diabody), and disulfide-stabilized V region (dsFv).

9. A pharmaceutical composition comprising a therapeutically effective amount of the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 1, and one or more pharmaceutically acceptable carriers, diluents or excipients.

10. A nucleic acid molecule encoding the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 1.

11. A recombinant vector, comprising the nucleic acid molecule of claim 10.

12. A host cell transformed with the recombinant vector according to claim 11, wherein the host cell is selected from the group consisting of a prokaryotic cell and eukaryotic cell, preferably.

13. A method for producing the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof according to claim 1, wherein the method comprises: cultivating a host cell transformed with a recombinant vector comprising a nucleic acid molecule encoding the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof in a culture to form and accumulate the monoclonal anti-B7-H3 antibody or antigen- binding fragment thereof and recovering the accumulated monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof from the culture.

14. A method for immunologically detecting or measuring B7-H3, wherein the method comprises detecting the B7-H3 by contacting with the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 1.

15. A method for diagnosing a disease related to a human B7-H3 positive cell, wherein the method comprises a detecting or measuring the B7-H3 or B7-H3 positive cell by contacting with the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 1.

16. A monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof, comprising a heavy chain variable region and a light chain variable region having the amino acid sequences of SEQ ID NOs: 6 and 7, respectively; or the amino acid sequences of SEQ ID NOs: 8 and 9, respectively.

17. A pharmaceutical composition comprising the monoclonal anti-B7-H3 antibody or antigen-binding fragment thereof of claim 16, and one or more pharmaceutically acceptable carriers, diluents or excipients.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1: Binding ability of different antibodies to human 2Ig-B7-H3 antigen;

(2) FIG. 2: Binding ability of different antibodies to human 4Ig-B7-H3 antigen;

(3) FIG. 3: Cross-binding ability of different antibodies to murine B7-H3 antigen;

(4) FIG. 4: Binding ability of different antibodies to U87MG cells;

(5) FIG. 5: Endocytic effect of different antibodies on U87MG cells.

DETAILED DESCRIPTION OF THE INVENTION

1. Terms

(6) In order to more readily understand the present invention, certain technical and scientific terms are specifically defined below. Unless specifically indicated elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention pertains.

(7) As used herein, the three-letter code and the single-letter code for amino acids are as described in J. biol. chem, 243, p 3558 (1968).

(8) As used herein, antibody refers to immunoglobulin, a structure of four-peptide chains connected together by disulfide bonds between two identical heavy chains and two identical light chains. Different immunoglobulin heavy chain constant regions exhibit different amino acid compositions and rank orders, hence present different kinds of antigenicity. Accordingly, immunoglobulin can be divided into five categories, or immunoglobulin isotypes, namely IgM, IgD, IgG, IgA and IgE, with heavy chain , , , and , respectively. According to its amino acid composition of the hinge region and the number and location of heavy chain disulfide bonds, the same type of Ig can be divided into different sub-categories. For example, IgG can be divided into IgG1, IgG2, IgG3, and IgG4. Light chains can be divided into or chain, due to different constant regions. Each IgG among the five types has or chain.

(9) In the present invention, the antibody light chain as described herein further comprises a light chain constant region, wherein the light constant region comprises a human or murine , chain or a variant thereof.

(10) In the present invention, the antibody heavy chain as described herein further comprises a heavy chain constant region, wherein the heavy chain constant region comprises human or murine IgG1, IgG2, IgG3, IgG4 or a variant thereof.

(11) The sequence of about 110 amino acids closest to the N-terminus of the antibody heavy and light chains, changes largely, known as the variable region (Fv region). The sequence of amino acids closest to the C-terminus is relatively stable, known as constant region. The variable region comprises three hypervariable regions (HVR) and four framework regions (FR) having relatively conserved sequences. Three hypervariable regions determine the specificity of the antibody, also known as complementarity determining regions (CDRs). Each light chain variable region (LCVR) and each heavy chain variable region (HCVR) comprises three CDR regions and four FR regions. Sequentially ordered from the amino terminus to the carboxyl terminus is: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The three light chain CDRs are referred to as LCDR1, LCDR2, and LCDR3. The three heavy chain CDRs are referred to as HCDR1, HCDR2 and HCDR3. The number and location of the CDR amino acid residues in the LCVR and HCVR regions of the antibody or antigen binding fragment herein comply with known Kabat numbering criteria (e.g., LCDR1-3, HCDR2-3), or comply with Kabat and Chothia numbering criteria (e.g., HCDR1).

(12) The terms human antibody and human derived antibody are used interchangeably and refer to an antibody comprising one or more variable and constant regions derived from a human immunoglobulin sequence. In a preferred embodiment of the invention, all of the variable and constant regions are derived from human immunoglobulin sequences, i.e., fully human derived antibody or fully human antibody. These antibodies can be obtained in a variety of ways, including antibodies obtained by using phage display technology, including isolating B cells from human PBMC, spleen, lymph node tissue and constructing natural single-stranded phage human antibody library, or by immunizing transgenic mice expressing human antibody light and heavy chain and screening.

(13) The term murine antibody used in the present invention refers to a monoclonal antibody against human B7-H3 prepared according to the knowledge and skill in the art. During preparation, the test subject is injected with a B7-H3 antigen, and then the hybridoma expressing antibodies having desired sequences or functional properties are isolated. In a preferred embodiment of the invention, the murine B7-H3 antibody or antigen-binding fragment thereof further comprises a light chain constant region of a murine kappa, lambda chain or a variant thereof, or further comprises a heavy chain constant region of murine IgG1, IgG2, IgG3 or variants thereof.

(14) The term chimeric antibody is an antibody which is formed by fusing the variable region of a murine antibody with the constant region of a human antibody, so as to alleviate the murine antibody-induced immune response. To establish a chimeric antibody, a hybridoma secreting a specific murine monoclonal antibody is established and a variable region gene is cloned from the murine hybridoma cells. Then a desired constant region gene of a human antibody is cloned and connected with the murine variable region genes to form a chimeric gene which can be subsequently inserted into an expression vector. Finally the chimeric antibody molecule is expressed in eukaryotic or prokaryotic system. In a preferred embodiment of the present invention, the light chain of the B7-H3 chimeric antibody further comprises a light chain constant region derived from the human kappa, lambda chain or a variant thereof. The heavy chain of the B7-H3 chimeric antibody further comprises a heavy chain constant region derived from human IgG1, IgG2, IgG3 or IgG4 or a variant thereof, and preferably comprises a heavy chain constant region derived from human IgG1, IgG2 or IgG4, or variant of IgG1, IgG2 or IgG4 with amino acid mutations (such as YTE mutation or back mutation).

(15) The term humanized antibody, also known as CDR-grafted antibody, refers to an antibody generated by grafting murine CDR sequences into a variable region framework of a human antibody (i.e. antibodies produced within different types of human germline antibody framework sequences). A humanized antibody overcomes the heterologous response induced by a chimeric antibody that carries a large amount of murine protein components. Such framework sequences can be obtained from public DNA databases including germline antibody gene sequences or published references. For example germline DNA sequences of human heavy and light chain variable region genes can be found in e.g., VBase human germline sequence database (available on the Internet at www.mrccpe.com.ac.uk/vbase), as well as found in Kabat, E A, et al, 1991 Sequences of Proteins of Immunological Interest, 5th edition.

(16) The CDR graft can reduce the affinity of the B7-H3 antibody or antigen-binding fragment thereof to the antigen, due to the framework residues that are in contact with the antigen. Such interaction can be the result of hyper-mutation in somatic cells. Therefore, it may still be necessary to graft such donor framework amino acids onto the framework of humanized antibodies. Amino acid residues from a non-human B7-H3 antibody or antigen-binding fragment thereof which are involved in antigen binding can be identified by examining the murine monoclonal antibody variable region sequences and structures. Each residue in the CDR donor framework that differs from the germline can be considered to be relevant. If the closest germline cannot be determined, the sequence can be compared with the common sequence of a subtype or the sequence of the murine with a high similarity percentage. Rare framework residues are thought to be the result of somatic hyper-mutation and thus play an important role in binding.

(17) The term antigen-binding fragment or functional fragment of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., B7-H3). It has been shown that fragments of full-length antibodies can be used for the antigen-binding function of antibodies. Examples of the binding fragments included in the term antigen-binding fragment of an antibody include: (i) Fab fragment, a monovalent fragment consisting of VL, VH, CL and CH1 domains; (ii) F(ab).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by disulfide bonds in the hinge region, (iii) Fd fragment, consisting of the VH and CH1 domains; (iv) Fv fragment, consisting of the VH and VL domains of one arm of the antibody; (v) single domain or dAb fragment (Ward et al. (1989) Nature 341: 544-546) composed of the VH domain; and (vi) a separate complementarity determining region (CDR); or (vii) a combination of two or more separated CDRs optionally linked by a synthetic linker. Furthermore, although the VL domain and VH domain of the Fv fragment are encoded by separate genes, they can be linked by a synthetic linker using recombinant methods such that they can generate a single protein chain with monovalent molecular structure by pairing the VL and VH domains (called single-chain Fv (scFv); see, e.g., Bird et al. (1988) Science 242: 423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci USA 85: 5879-5883). Such single chain antibodies are also intended to be included in the term antigen-binding fragment of an antibody. Such antibody fragments are obtained using conventional techniques known in the art, and functional screening of fragments are used in the same way as the intact antibodies. The antigen binding sites can be produced by recombinant DNA techniques or by enzymatic or chemical disruption of the intact immunoglobulin. The antibodies may be in different phenotype, e.g., IgG (e.g., IgG1, IgG2, IgG3 or IgG4 subtype), IgA1, IgA2, IgD, IgE or IgM antibody.

(18) The antigen-binding fragments of the present invention include Fab, F(ab).sub.2, Fab, single-chain antibody (scFv), dimerized V region (diabody), disulfide-stabilized V region (dsFv), CDR-containing peptide, etc.

(19) Fab is an antibody fragment having a molecular weight of about 50,000 and having antigen-binding activity, such fragments are obtained by treating an IgG antibody molecule with protease papain (cleaving amino acid residue at position 224 of H chain), wherein about half of the N-terminal side of the H chain and the entire L chain are bound by disulfide bond.

(20) The Fab of the present invention can be produced by treating the monoclonal antibodies of the present invention, which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof, with papain. Furthermore, the Fab can be produced by inserting a DNA encoding Fab of the antibody into a prokaryotic expression vector or eukaryotic expression vector and introducing the vector into prokaryote or eukaryote to express the Fab.

(21) F(ab).sub.2 is an antibody fragment obtained by digesting the lower part of two disulfide bonds in IgG hinge region with pepsin. It has a molecular weight of about 100,000 and antigen-binding activity, and comprises two Fab regions linked at the hinge position.

(22) The F(ab).sub.2 of the present invention can be produced by treating the monoclonal antibody of the present invention, which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof, with pepsin. Furthermore, the F(ab).sub.2 can be produced by linking the Fab described below with a thioether bond or a disulfide bond.

(23) Fab is an antibody fragment having a molecular weight of about 50,000 and having antigen-binding activity. It is obtained by cleaving the disulfide bond in the hinge region of the F(ab).sub.2 mentioned above. The Fab of the present invention may be produced by treating the F(ab).sub.2 of the present invention, which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof, with a reducing agent (such as dithiothreitol).

(24) Furthermore, the Fab can be produced by inserting a DNA encoding a Fab fragment of the antibody into a prokaryotic expression vector or a eukaryotic expression vector and introducing the vector into prokaryote or eukaryote to express the Fab.

(25) The term single-chain antibody, single-chain Fv or scFv refers to a molecule comprising an antibody heavy chain variable domain (or region; VH) and an antibody light chain variable domain (or region; VL) connected by a linker. Such scFv molecules have the general structure: NH.sub.2-VL-linker-VH-COOH or NH.sub.2-VH-linker-VL-COOH. Suitable linkers in prior art consist of repeated GGGGS amino acid sequence or variants thereof, for example a variant having 1-4 repeats (Holliger et al. (1993), Proc. Natl. Acad. Sci. USA 90: 6444-6448). Other linkers that can be used in the present invention are described in Alfthan et al. (1995), Protein Eng. 8: 725-731, Choi et al. (2001), Eur. J. Immunol. 31: 94-106, Hu et al. (1996), Cancer Res. 56: 3055-3061, Kipriyanov et al. (1999), J. Mol. Biol. 293: 41-56 and Roovers et al. (2001), Cancer Immunol.

(26) The scFv of the present invention can be produced by the following steps: obtaining the cDNA encoding VH and VL of the monoclonal antibody of the present invention which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof; constructing a DNA encoding the scFv; inserting the DNA into a prokaryotic expression vector or a eukaryotic expression vector; and then introducing the expression vector into prokaryote or eukaryote to express said scFv.

(27) A diabody is an antibody fragment in which the scFv is dimerized, and is an antibody fragment having bivalent antigen-binding activity. In the bivalent antigen binding activity, the two antigens may be the same or different.

(28) The diabody of the present invention can be produced by the following steps: obtaining the cDNA encoding VH and VL of the monoclonal antibody of the present invention which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof; constructing a DNA encoding scFv such that the length of the linker peptide is 8 or less amino acid residues; inserting the DNA into a prokaryotic expression vector or a eukaryotic expression vector; and then introducing the expression vector into prokaryote or eukaryote to express the diabody.

(29) The dsFv is obtained by substituting one amino acid residue in each of the VH and the VL with cysteine residue, and then linking the polypeptides via disulfide bond between the two cysteine residues. The amino acid residue to be substituted with a cysteine residue can be selected based on a three-dimensional structure prediction of the antibody in accordance with known methods (Protein Engineering, 7, 697 (1994)).

(30) The dsFv of the present invention can be produced by the following steps: obtaining the cDNA encoding the VH and the VL of the monoclonal antibody of the present invention which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof; constructing a dsFv-encoding DNA; inserting the DNA into prokaryotic expression vector or eukaryotic expression vector; and then introducing the expression vector into prokaryote or eukaryote to express said dsFv.

(31) The CDR-containing peptide is constructed by one or more regions of CDRs of VH or VL. Peptides comprising several CDRs can be linked directly or via a suitable peptide linker.

(32) The CDR-containing peptide of the present invention can be produced by the following steps: constructing a DNA encoding CDRs of the VH and the VL of the monoclonal antibody of the present invention which specifically recognizes human B7-H3 and binds to the extracellular region amino acid sequence or three-dimensional structure thereof; inserting the DNA into a prokaryotic expression vector or a eukaryotic expression vector; and then introducing the expression vector into prokaryote or eukaryote to express said peptide. The CDR-containing peptide can also be produced by chemical synthesis methods such as Fmoc method or tBoc method.

(33) The term CDR refers to one of the six hypervariable regions within the variable domain of an antibody that primarily contributes to antigen binding. One of the most commonly used definitions for the six CDRs is provided by Kabat E. A. et al. (1991) Sequences of proteins of immunological interest. NIH Publication 91-3242. As used herein, the Kabat definition of CDR only applies to CDR1, CDR2 and CDR3 of the light chain variable domain (CDR L1, CDR L2, CDR L3 or L1, L2, L3), as well as CDR2 and CDR3 of heavy chain variable domain (CDR H2, CDR H3 or H2, H3).

(34) The term antibody framework as used herein, refers to a portion of the variable domain VL or VH, which serves as a scaffold for the antigen binding loop (CDR) of the variable domain. Essentially, it is a variable domain without CDRs.

(35) The term epitope or antigenic determinant refers to a site on an antigen to which an immunoglobulin or antibody specifically binds (e.g., a specific site on B7-H3 molecule). Epitopes typically include at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 contiguous or non-contiguous amino acids in a unique spatial conformation. See, for example, Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996).

(36) The terms specific binding, selective binding, selectively bind and specifically bind refer to the binding of an antibody to an epitope on a predetermined antigen. Typically, the antibody binds with an affinity (KD) of less than about 10.sup.7 M, such as approximately less than about 10.sup.8 M, 10.sup.9M or 10.sup.10M or less.

(37) The term KD or Kd refers to the dissociation equilibrium constant for a particular antibody-antigen interaction. Typically, the antibody of the present invention binds to B7-H3 with a dissociation equilibrium constant (KD) of less than about 10.sup.7 M, such as less than about 10.sup.8 M, 10.sup.9 M or 10.sup.10 M or less, for example, as determined using surface plasmon resonance (SPR) techniques in a BIACORE instrument.

(38) The term competitive binding refers to an antibody that recognizes and binds to the same epitope (also known as antigenic determinant) or a portion thereof of the extracellular domain of human B7H3 as the one recognized by monoclonal antibody of the present invention. An antibody that binds to the same epitope as the monoclonal antibody of the present invention refers to an antibody that recognizes and binds to the amino acid sequence of human B7-H3 recognized by the monoclonal antibody of the present invention.

(39) The term nucleic acid molecule as used herein refers to a DNA molecule and a RNA molecule. The nucleic acid molecule may be single stranded or double stranded, but is preferably a double stranded DNA. A nucleic acid is effectively linked when it is placed into functional relationship with another nucleic acid sequence. For example, if a promoter or enhancer affects transcription of a coding sequence, the promoter or enhancer is effectively linked to the coding sequence.

(40) The term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. In one embodiment, the vector is a plasmid which refers to a circular double stranded DNA loop into which additional DNA segment can be ligated. In another embodiment, the vector is a viral vector, wherein an additional DNA segment can be ligated into viral genome. The vectors disclosed herein are capable of self-replicating in a host cell into which they have been introduced (for example, a bacterial vector having a bacterial replication origin and a episomal mammalian vector) or can be integrated into the genome of a host cell upon introduction into host cell, thereby is replicated along with the host genome (e.g., a non-episomal mammalian vector).

(41) Methods for producing and purifying antibodies and antigen-binding fragments are well known in the art, such as Cold Spring Harbor Antibody Technical Guide, Chapters 5-8 and 15. For example, mice can be immunized with human B7-H3 or a fragment thereof, and the obtained antibody can be re-natured, purified, and sequenced by using conventional methods known in the art. The antigen-binding fragment can also be prepared by conventional methods. The antibodies or antigen-binding fragments of the invention are genetically engineered to add one or more human FR regions in non-human CDR regions. The human FR germline sequence(s) can be obtained by aligning human antibody variable germlines in gene databases and MOE software from the ImMunoGeneTics (IMGT) website at http://imgt.cines.fr or from the Journal of Immunoglobulins 2001ISBN012441351.

(42) The term host cell refers to a cell into which an expression vector has been introduced. Host cells can include bacterial, microbial, plant or animal cells. Bacteria susceptible to be transformed include members of the Enterobacteriaceae family, such as strains of Escherichia coli or Salmonella; Bacillaceae such as Bacillus subtilis; Pneumococcus; Streptococcus and Haemophilus influenzae. Suitable microorganisms include Saccharomyces cerevisiae and Pichia pastoris. Suitable animal host cell lines include CHO (Chinese hamster ovary cell line) and NS0 cells.

(43) The engineered antibody or antigen-binding fragment of the present invention can be prepared and purified by conventional methods. For example, cDNA sequence(s) encoding a heavy chain and a light chain can be cloned and recombined into a GS expression vector. The recombinant immunoglobulin expression vector can be stably transfected in CHO cells. Mammalian expression systems result in glycosylation of antibodies, particularly at the highly conserved N-terminal site in the Fc region. Stable clones are obtained by expressing antibodies that specifically bind to human B7-H3. Positive clones are expanded in serum-free medium in a bioreactor to produce antibodies. The culture medium containing the secreted antibody can be purified by conventional technique. For example, purification is carried out using an A or G Sepharose FF column that has been equilibrated with a compatible buffer. The non-specifically bound components are removed by washing. The bound antibody is eluted by a pH gradient method, and the antibody fragments are detected by SDS-PAGE and collected. The antibody can be filtered and concentrated by a conventional manner. Soluble aggregate and multimers can also be removed by conventional methods such as size exclusion or ion exchange. The product needs to be frozen immediately, such as at 70 C., or lyophilized.

(44) Administration and treatment, when applied to an animal, human, experimental subject, cell, tissue, organ, or biological fluid, refer to contact with an exogenous pharmaceutical, therapeutic, diagnostic reagent, or composition with the animal, human, subject, cell, tissue, organ, or biological fluid. Administration and treatment can refer, e.g., to therapeutic, pharmacokinetic, diagnostic, research, and experimental methods. Treatment of a cell encompasses contacting the cell with a reagent, as well as contacting a fluid with a reagent, wherein the fluid is in contact with the cell. Administration and treatment also mean in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition or by another cell. Treatment, when applied to a human, veterinary, or research subject, refers to therapeutic treatment, prophylactic or preventative measures, research and diagnostic applications.

(45) Treat means to administer a therapeutic agent, such as a composition comprising any of the binding compounds of the present invention, internally or externally to a patient having one or more disease symptoms for which the agent has known therapeutic activity. Typically, the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated patient or population, so as to induce the regression of such symptom(s) or to prevent the progression by any clinically measurable degree. The amount of a therapeutic agent that is effective to alleviate any particular disease symptom (also referred to therapeutically effective amount) may vary according to factors such as the disease state, age and weight of the patient, and the ability of the agent to elicit desired response in the patient. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom. Even if an embodiment of the present invention (e.g., a treatment method or article of manufacture) is not effective in alleviating the target disease symptom(s) in every patient, it should alleviate the target disease symptom(s) in a statistically significant number of patients as determined by any statistical test known in the art such as the Student's t-test, chi-square test, U-test according to Mann and Whitney, Kruskal-Wallis test (H-test), Jonckheere-Terpstra test and Wilcoxon test.

(46) Conservative modification or conservative replacement or substitution refers to substitutions of amino acids in a protein with other amino acid having similar characteristics (e.g., charge, side chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can be frequently made without altering the biological activity of the protein. It will be appreciated by those skilled in the art that, in general, a single amino acid substitution in a non-essential region of polypeptide does not substantially alter biological activity (see, for example, Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., Page 224, (4th edition)). In addition, substitutions with structurally or functionally similar amino acids are unlikely to disrupt biological activity.

(47) An effective amount includes an amount sufficient to ameliorate or prevent a symptom or condition of medical disease. An effective amount also means an amount sufficient to allow or facilitate the diagnosis. An effective amount for a particular patient or veterinary subject can vary depending on factors such as: the condition to be treated, the overall health condition of the patient, the route and dose of administration, and the severity of side effects. An effective amount can be the maximum dose or dosing regimen that avoids significant side effects or toxic effects.

(48) Exogenous refers to a substance that is produced outside of organism, cell or human, depending on the situation. Endogenous refers to a substance that is produced in a cell, organism or human, depending on the situation.

(49) Identity refers to the sequence similarity between two polynucleotide sequences or two polypeptide sequences. When the positions in two sequences to be compared are occupied by the same base or amino acid monomer subunit, for example, if each position of two DNA molecules is both occupied by adenine, the molecules are considered to be homologous at that position. The percent identity between the two sequences is a function of the number of matched or homologous positions shared by two sequences divided by the number of positions to be compared100. For example, in the optimal alignment of sequence(s), if there are 6 matches or homologs among 10 positions between two sequences, then the two sequences are deemed as having 60% homology; if there are 95 matches or homologs among 100 positions between two sequences, then the two sequences are deemed as having 95% homology. In general, a comparison is performed when the maximum identity percentage is obtained by aligning two sequences.

(50) As used herein, the expressions cell, cell line and cell culture are used interchangeably, and all such terms include the progeny thereof. Thus, the words transformant and transformed cell include primary test cells and cultures derived therefrom, regardless of the number of passages. It should also be understood that all progeny may not be exactly identical in terms of DNA content due to deliberate or inadvertent mutations. The mutant progeny having the same function or biological activity as screened for the primarily transformed cell is included. In the case of a different name, it is clearly understood from the context.

(51) As used herein, polymerase chain reaction or PCR refers to a procedure or technique in which small amount of particular portion of nucleic acid, RNA, and/or DNA are amplified as described for example in U.S. Pat. No. 4,683,195. In general, it is necessary to obtain sequence information from the end or beyond the target region, thereby oligonucleotide primers can be designed; these primers are identical or similar to the opposite strands of the template to be amplified. The 5 terminal nucleotides of the two primers may be identical to the ends of the material to be amplified. PCR can be used to amplify specific RNA sequences, specific DNA sequences from total genomic DNA, and cDNA transcribed from total cellular RNA, phage or plasmid sequences, etc. See generally, Mullis et al. (1987) Cold Spring Harbor Symp. Ouant. Biol. 51:263; Erlich ed., (1989) PCR TECHNOLOGY (Stockton Press, N.Y.). The PCR used herein is considered as an example (but not the only one) of nucleic acid polymerase reaction method for amplifying a nucleic acid test sample, said method comprises the use of known nucleic acids as a primer and nucleic acid polymerase to amplify or produce a specific portion of the nucleic acid.

(52) Optional or optionally means that the event or situation described subsequently may (but need not to) occur, this includes where the event or situation occurs or does not occur. For example, optionally comprising 1-3 antibody heavy chain variable regions means that the antibody heavy chain variable region with specific sequence can be, but need not to, be present.

(53) Pharmaceutical composition means a mixture comprising one or more compounds described herein or a physiologically/pharmaceutically acceptable salt or prodrug thereof, along with other chemical components, such as physiological/pharmaceutically acceptable carrier and excipient. The purpose of the pharmaceutical composition is to promote the administration to the organism, and facilitate the absorption of active ingredient and thereby exert a biological activity.

(54) Furthermore, the present invention relates to a method for immunologically detecting or measuring B7-H3, a reagent for immunologically detecting or measuring B7-H3, a method for immunologically detecting or measuring cells expressing B7-H3, and a diagnostic reagent for diagnosis of disease related to B7-H3 positive cells, comprising the monoclonal antibody or antibody fragment of the present invention that specifically recognizes human B7-H3 and binds to extracellular region amino acid sequence or three-dimensional structure thereof, as an active ingredient.

(55) In the present invention, the method for detecting or determining the amount of B7-H3 may be any known method. For example, it includes immunodetection or assay.

(56) The immunodetection or assay is a method of detecting or determining the amount of antibody or antigen by using labeled antigen or antibody. Examples of immunodetection or assay include a radioactive substance labeled immunological antibody method (RIA), an enzyme immunoassay (EIA or ELISA), a fluorescent immunoassay (FIA), a luminescent immunoassay, a western blotting method, physicochemical methods, etc.

(57) The above-mentioned diseases related to B7-H3 positive cells can be diagnosed by detecting or measuring cells expressing B7-H3 by using the monoclonal antibodies or antibody fragments thereof of the present invention.

(58) In order to detect cells expressing the polypeptide, a known immunodetection can be used, and preferably immunoprecipitation, fluorescent cell staining or immunohistochemical staining etc. can be used. Furthermore, a fluorescent antibody staining method etc. using FMAT8100HTS system (Applied Biosystem) can be used.

(59) In the present invention, a living sample for detecting or measuring B7-H3 is not particularly limited, so as long as it has a possibility of including cells expressing B7-H3, such as tissue cells, blood, plasma, serum, pancreatic fluid, urine, feces, tissue fluid or culture fluid.

(60) The diagnostic reagent containing the monoclonal antibody or the antibody fragment thereof of the present invention may further contain a reagent for performing antigen-antibody reaction or a reagent for detecting the reaction, depending on desired diagnostic method. The reagent for performing antigen-antibody reaction includes buffers, salts, and the like. The reagent for detection includes reagents commonly used in immunodetection or measurement, such as labeled secondary antibodies that recognize the monoclonal antibodies, antibody fragments or conjugates thereof, substrates corresponding to the labels, etc.

(61) The present invention also relates to a method of treating diseases related to human B7-H3 positive cells, particularly in the treatment of cancer and inflammation.

2. Examples

(62) The present invention is further described below in conjunction with the example, however the scope of the present invention is not limited thereto. In the examples of the present invention, where specific conditions are not described, the experiments are generally conducted under conventional conditions as described in Cold Spring Harbor Antibody Technology Laboratory Manual, Molecular Cloning Manual, or under conditions recommended by the manufacturer of raw material or products. Where the source of the reagents is not specifically given, the reagents are commercially available conventional reagents.

Example 1. Preparation of B7-H3 Antigen and Protein for Detection

(63) Design of B7-H3 Antigen

(64) The human B7-H3 sequence as shown in SEQ ID NO: 1 was used as the template for B7-H3 of the present invention, and the amino acid sequence of the antigen and protein for detection involved in the present invention were designed. Unless otherwise specified, the following B7-H3 antigen is human B7-H3.

(65) Human B7-H3 full-length amino acid sequence (SEQ ID NO: 1):

(66) TABLE-US-00001 MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATL CCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALF PLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKP SMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTS QMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQR SPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTD TKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGS FTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSS YRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGAN embedded image embedded image GQEIA

(67) Note:

(68) The double-underlined portion is the signal peptide (Signal peptide: 1-28);

(69) The underlined portion is the B7-H3 extracellular domain (Extracellular domain: 29-466), wherein 29-139 is Ig-like V-type 1 Domain, and 145-238 is Ig-like C2-type 1 Domain; 243-357 is Ig-like V-type 2 Domain, 363-456 is Ig-like C2-type 2 Domain;

(70) The dot-lined portion is the transmembrane domain portion (Transmembrane domain: 467-487);

(71) The italic portion is the intracellular domain (Cytoplasmic domain: 488-534).

(72) Murine B7-H3 full-length amino acid sequence (SEQ ID NO: 2)

(73) TABLE-US-00002 MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATL RCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALF PDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSK PSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTT SQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQ embedded image DGDGEGSKTALRPLKPSENKEDDGQEIA

(74) Note:

(75) The double-underlined portion is the signal peptide (Signal peptide: 1-28);

(76) The underlined portion is the B7-H3 extracellular domain (Extracellular domain: 29-248), wherein 29-139 is Ig-like V-type Domain, and 145-238 is Ig-like C2-type Domain;

(77) The dot-lined portion is the transmembrane domain portion (Transmembrane domain: 249-269);

(78) The italic portion is the intracellular domain (Cytoplasmic domain: 270-316).

(79) The human B7-H3 antigen (SEQ ID NO: 3) used for screening and detection is a commercial product (R&D cat #1949-B3-050/CF, abbreviated as 2Ig-B7-H3), and the sequence is as follows:

(80) TABLE-US-00003 LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLV HSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFV SIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYP EAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSC LVRNPVLQQDAHSSVTITPQRSPTG-HHHHHH

(81) Note: The underlined portion is the B7-H3 extracellular region; the italic portion is the His-tag marker.

(82) The human B7-H3 antigen (SEQ ID NO: 4) used for detection is a commercial product (SinoBiological cat #11188-H08H, abbreviated as 4Ig-B7-H3), and the sequence is as follows:

(83) TABLE-US-00004 LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLV HSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFV SIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYP EAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSC LVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRC SFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPD LLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPS MTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQ MANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPM T-HHHHHH

(84) Note: The underlined portion is the B7-H3 extracellular region; the italic portion is the His-tag marker.

(85) The murine B7-H3 antigen (SEQ ID NO: 5) used for screening and detection is a commercial product (R&D cat #1397-B3-050/CF), and the sequence is as follows:

(86) TABLE-US-00005 VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLV HSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFV SIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYP EAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSC LVRNPVLQQDAHGSVTITGQPLTF-HHHHHH

(87) Note: The underlined portion is the B7-H3 extracellular region; the italic portion is the His-tag marker.

Example 2. Screening Positive Sequence(s) for Specific Binding to Human B7-H3

(88) B cells were isolated from human peripheral blood mononuclear cells (PBMCs), spleen, and lymph node tissues, and RNA was extracted to construct naive scFv phage antibody library (capacity 3.210.sup.10). The constructed naive scFv phage antibody library was packaged to form phage particles, and then subjected to panning by liquid phase method. The phage was bound to the biotinylated B7-H3 in liquid phase, and then was separated by streptavidin magnetic beads. In order to obtain positive sequence(s) binding to human B7-H3 (R&D cat #1949-B3-050/CF), biotinylated human B7-H3 was used for panning, and 500 monoclonal colonies were picked and packaged into phage scFv antibodies for phage ELISA testing. The binding activity of monoclonal phage to human B7-H3 (R&D cat #1949-B3-050/CF) and murine B7-H3 (R&D cat #1397-B3-050/CF) were tested separately: 1 g/ml human B7-H3 or murine B7-H3 and 1% BSA were coated on ELISA plate, phage supernatant diluted at 1:1 with blocking buffer was added, and detected with anti-M13 HRP; the clones with ELISA OD450 value of greater than 0.5, and with ratios of ELISA OD450 values for binding with human or murine B7-H3 to ELISA OD450 value for binding with 1% BSA greater than 2.0 were selected, and 9 clones were obtained.

Example 3. Construction of Full Length Monoclonal Antibodies

(89) Full length antibodies were constructed for these 9 clones obtained by phage library screening, and then two antibodies (h1702 and h1703, respectively) were confirmed to have strong affinity by ELISA binding assay. The process of constructing full length monoclonal antibody was as follows:

(90) Based on the scFv antibody sequence(s) obtained by phase screening, primers were designed to construct the VH/VK/VL gene fragment of each single-chain antibody sequence by PCR. The heavy and light chain variable regions of h1702 and h1703 were obtained.

(91) TABLE-US-00006 >h1702heavychainvariableregionsequence SEQIDNO:6 QVQLVQSGGGVVQPGTSLRLSCAASGFIFSSSAMHWVRQAPGKGLEWV AVISYDGSNKYYVDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC ARSARLYASFDYWGQGALVTVSS >h1702lightchainvariableregionsequence SEQIDNO:7 QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSHYPSWYQQTPGQAPRM LIYNTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCAIHVDR DIWVFGGGTHKLTVL >h1703heavychainvariableregionsequence SEQIDNO:8 QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWV SAISGSGGSTYYADSVKGRYTISRDNSKNTLYLQMNSLRAEDTAVYYC AKGVGPVHALDVWGQGTTVTVSS >h1703lightchainvariableregionsequence SEQIDNO:9 DIRLTQSPSSLSASVGDRVTITCRASQSISTYLNWYQQKPGKAPILLI NAVSGLQSGVPSRFSGSGSGTHFTLTITSLQPEDFATYYCQQSYSTPM WTFGQGTKVEIK

(92) Note: The order is FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, the italics in sequence are FR sequences, and the CDR sequences are underlined.

(93) The CDR sequences in the light chain and heavy chain of each antibody are shown in Table 1.

(94) TABLE-US-00007 TABLE1 CDRregionsofeachheavyandlightchain Anti- body HC LC 1702 HCDR1 GFIFSSSA LCDR1 SGSVSTSHY SEQIDNO:10 SEQIDNO:13 HCDR2 ISYDGSNK LCDR2 NTN SEQIDNO:11 SEQIDNO:14 HCDR3 ARSARLYASFDY LCDR3 AIHVDRDIWV SEQIDNO:12 SEQIDNO:15 1703 HCDR1 GFTFSSYA LCDR1 QSISTY SEQIDNO:16 SEQIDNO:19 HCDR2 ISGSGGST LCDR2 AVS SEQIDNO:17 SEQIDNO:20 HCDR3 AKGVGPVHALDV LCDR3 QQSYSTPMWT SEQIDNO:18 SEQIDNO:21

(95) The antibody variable region was then homologously recombined with the constant region gene (CH1-FC/CL) fragment to construct the complete antibody VH-CH1-FC/VK-CL/VL-CL.

(96) The constructed complete antibodies h1702-IgG1, h1703-IgG1 sequences are as follows:

(97) TABLE-US-00008 h1702-IgG1: h1702-IgG1heavychainaminoacidsequence: (SEQIDNO:22) QVQLVQSGGGVVQPGTSLRLSCAASGFIFSSSAMHWVRQAPGKGLEWVAV ISYDGSNKYYVDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSA RLYASFDYWGQGALVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK h1702lightchainaminoacidsequence:Lamda (SEQIDNO:23) QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSHYPSWYQQTPGQAPRMLI YNTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCAIHVDRDIWV FGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT HEGSTVEKTVAPTECS h1703-IgG1: h1703-IgG1heavychainaminoacidsequence: (SEQIDNO:24) QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRYTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGV GPVHALDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK h1703lightchainaminoacidsequence:Kappa (SEQIDNO:25) DIRLTQSPSSLSASVGDRVTITCRASQSISTYLNWYQQKPGKAPILLINA VSGLQSGVPSRFSGSGSGTHFTLTITSLQPEDFATYYCQQSYSTPMWTFG QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ GLSSPVTKSFNRGEC

(98) In order to further improve the stability of the antibody, the amino acids of the h1702 light chain sequence were mutated, wherein the specific mutation involves that the first amino acid residue Q at N-terminus of the light chain was replaced by D, the first amino acid residue S at C-terminus was deleted, so as to obtain a more stable and uniform monoclonal antibody.

(99) h1702-1 light chain amino acid sequence with mutation modification: (SEQ ID NO: 26)

(100) TABLE-US-00009 DTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSHYPSWYQQTPGQAPRMLI YNTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCAIHVDRDIWV FGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT HEGSTVEKTVAPTEC

Example 4. Expression and Purification of Fully Human Antibodies

(101) The plasmids expressing the light and heavy chain of the antibody respectively were transfected into HEK293E cells at a ratio of 1.5:1. The cell culture supernatant was collected 6 days later, and the cell debris was removed by high-speed centrifugation, and purification was performed by a Protein A column. The column was washed with PBS until the A280 reading dropped to the baseline. The target protein was eluted with an acidic eluent of pH 3.0-pH 3.5 and neutralized with 1 M Tris-HCl, pH 8.0-9.0. The eluted sample was appropriately concentrated and further purified by gel chromatography Superdex 200 (GE) which was equilibrated by PBS to remove the aggregate. The monomer peak was collected and aliquoted for use.

(102) The performance and beneficial effect of the antibodies of the present invention was tested by the following test methods:

Test Example 1. ELISA Binding Assay

(103) To test the binding ability of the screened B7-H3 antibodies to different forms of human B7-H3 in vitro, human 2Ig-B7-H3 (Cat. #1949-B3-050/CF, R&D) and human 4Ig-B7-H3 (Cat #11188-H08H, Sino Biological) were used for binding assays in vitro.

(104) Human B7-H3 protein (2Ig/4Ig) was diluted to a concentration of 1 g/ml with phosphate-buffered saline (PBS) buffer, pH 7.4 (Sigma, P4417-100TAB), and added to a 96-well Elisa plate at a volume of 100 l/well (Corning, CLS3590-100 EA), and placed at 4 C. overnight, for 16-20 hours. After discarding the liquid, 5% skim milk (GuangMing skim milk powder) blocking solution diluted with PBST buffer (pH 7.4 PBS containing 0.05% Tween-20) was added at 120 l/well, and the mixture was incubated at 37 C. for 2 hours to block. At the end of the blocking, the blocking solution was discarded, and the plate was washed 4 times with PBST buffer. Then, 100 l/well of the corresponding B7-H3 antibodies with series dilution was added. The initial concentration was 1 M, then diluted with PBST buffer to 8 gradients, and incubated at 37 C. for 1 hour in the incubator. After incubation, the reaction solution in the plate was discarded, and the plate was washed 4 times with PB ST. HRP-labeled goat anti-Human IgG Fc fragment specific secondary antibody (Jackson Immuno Research, 109-005-008) diluted with PBST (1:4000) was added at 100 l/well, and incubated for 1 hour at 37 C. After washing the plate 4 times with PBST, TMB chromogenic substrate (KPL, 52-00-03) was added at 100 l/well, incubated for 3-5 minutes (min) at room temperature, and 1 M H.sub.2SO.sub.4 was added at 100 l/well to stop the reaction. The absorbance value was read using NOVOStar microplate reader at 450 nm, and the EC50 value for the binding between the antibody and the antigen was calculated. The results are shown in Table 2, FIG. 1 and FIG. 2.

(105) TABLE-US-00010 TABLE 2 The binding ability of different antibodies to human 2Ig-B7-H3 and 4Ig-B7-H3 antigen EC50 human 2Ig-B7-H3(nM) human 4Ig-B7-H3(nM) h1702 0.11 0.16 h1703 10.28 2.10

(106) The results show that h1702 and h1703 have significant binding ability to both human 2Ig-B7-H3 and 4Ig-B7-H3, and h1702 has stronger binding ability.

Test Example 2. Cross-Binding Assay to B7-H3 Derived from Different Species

(107) To test the binding ability of the screened B7-H3 antibodies to B7-H3 derived from different species in vitro, murine B7-H3 (Cat. #1397-B3-050/CF, R&D) was used for binding assays in vitro.

(108) B7-H3 protein derived from different species (mouse B7-H3) was diluted to a concentration of 1 g/ml with PBS buffer, pH 7.4 (Sigma, P4417-100TAB), added to a 96-well microtiter plate at a volume of 100 l/well (Corning, CLS3590-100 EA), and placed at 4 C. overnight for 16-20 hours. After discarding the liquid, 5% skim milk (GuangMing skim milk powder) blocking solution diluted with PBST buffer (pH 7.4 PBS containing 0.05% Tween-20) was added at 120 l/well, and the mixture was incubated at 37 C. for 2 hours to block. At the end of the blocking, the blocking solution was discarded, and the plate was washed 4 times with PBST buffer. Then, 100 l/well of the corresponding B7-H3 antibodies at an initial concentration of 1 M were added, diluted with PBST buffer to 8 gradients, and incubated at 37 C. for 1 hour in the incubator. After incubation, the reaction solution in the plate was discarded, and the plate was washed 4 times with PBST, and HRP-labeled goat anti-Human IgG Fc fragment specific secondary antibody (Jackson Immuno Research, 109-005-008) diluted with PBST (1:4000) was added at 100 l/well, incubated for 1 hour at 37 C. After washing the plate 4 times with PBST, TMB chromogenic substrate (KPL, 52-00-03) was added at 100 l/well, incubated for 3-5 min at room temperature, and 1 M H.sub.2SO.sub.4 was added at 100 l/well to stop the reaction, the absorbance value was read using NOVOStar microplate reader at 450 nm, the EC50 value for the binding between the antibody and the antigen was calculated (the results are shown in Table 3 and FIG. 3).

(109) TABLE-US-00011 TABLE 3 The binding ability of different antibodies to murine B7-H3 antigen EC50 murine B7-H3 (nM) h1702 18.12 h1703 86.68

(110) The results shown that the binding ability of h1702 and h1703 to murine B7-H3 was weak, indicating that two monoclonal antibodies specifically bind to human B7-H3.

Test Example 3. Biacore Test for Antibody Affinity

(111) The reaction affinity of anti-B7-H3 antibodies to human and murine B7-H3 was determined using a Biacore, GE instrument.

(112) A biosensor chip Protein A (Cat. #29127556, GE) was used to affinity capture a certain amount of antibody to be tested. A series diluted of human 2Ig-B7-H3 antigen (Cat. #1949-B3-050/CF, R&D), human 4Ig-B7-H3 antigen (Cat. #11188-H08H, Sino Biological) or murine B7-H3 antigen (Cat. #1397-B3-050/CF, R&D) was flowed through the surface of the chip. Real-time reaction signal was detected by using Biacore instrument (Biacore T200, GE), in order to obtain association and dissociation curves. After completion of each cycle of dissociation, the biochip was washed and regenerated with glycine-hydrochloric acid regeneration solution (pH 1.5) (Cat. # BR-1003-54, GE). The buffer used in the experiment was HBS-EP buffer solution (pH 7.4) (Cat. # BR-1001-88, GE).

(113) The experimental data was fitted with BIA evaluation version 4.1 GE software in a (1:1) Langmuir model to obtain affinity values. The experimental results are shown in Tables 4-6.

(114) TABLE-US-00012 TABLE 4 The reaction affinity of different antibodies to human 2Ig-B7-H3 antigen Antibody Antigen Affinity (M) h1702 human 2Ig-B7-H3 7.97E7 h1703 4.48E7

(115) TABLE-US-00013 TABLE 5 The reaction affinity of different antibodies to human 4Ig-B7-H3 antigen Antibody Antigen Affinity (M) h1702 human 4Ig-B7-H3 8.55E9 h1703

(116) TABLE-US-00014 TABLE 6 The reaction affinity of different antibodies to murine B7-H3 antigen Antibody Antigen Affinity (M) h1702 murine B7-H3 1.47E6 h1703 5.02E7

(117) The affinity results of Biacore test show that h1702 has strong affinity to human 4Ig-B7-H3, reaching a level at nM, whereas the affinity to human 2Ig-B7-H3 or murine B7-H3 is relatively weaker; h1703 has weaker affinity to human 4Ig-B7-H3, human 2Ig-B7-H3 and murine B7-H3.

Test Example 4. In Vitro Cell Binding Assay

(118) In this experiment, the binding of antibody was evaluated based on the intensity of fluorescence signal of the antibody bond on the cell surface. After incubating 10 g of primary antibody with 210.sup.5 U87MG cells on ice for 30 minutes, excess antibody was removed by washing. The cells were incubated with APC anti-human IgG Fc (Biolegend, 409306) for 30 minutes at room temperature, and after removing excess antibody, the fluorescence signal on the cell surface was read using BD Verse (results were shown in FIG. 4). The results indicate that h1702 specifically binds to U87MG tumor cells which overexpress B7-H3.

Test Example 5. In Vitro Endocytosis Test

(119) In this experiment, the endocytosis effect of the antibody was evaluated based on the intensity of fluorescence signal which was determined of the internalized antibody. The B7-H3 antibody and APC anti-human IgG Fc (Biolegend, 409306) were mixed at a molar ratio of 1:2 and incubated on ice for 15 minutes. After incubating the antibody mixture with 210.sup.5 U87MG cells on ice for 30 minutes, excess antibody was removed by washing, and then the cells were transferred to a 37 C. prewarmed medium, and incubated at 37 C. for 0, 15, 30, 60 and 120 minutes respectively. The cells were centrifuged and resuspended in the antibody elution buffer to get rid of antibodies. After incubating for 7 minutes at room temperature, the antibody elution buffer was removed by washing, and the intracellular fluorescence signal was read using BD Verse (results shown in FIG. 5). The results show that both h1702 and h1703 were efficiently endocytosed into cells after binding to U87MG cells.

Test Example 6. T1/2 Evaluation on SD Rats

(120) 4 SD rats (purchased from JSJ Experimental Animal Co., Ltd.), 2 males and 2 females, were maintained in light/dark cycle adjusted at 12/12 hours, with constant temperature of 243 C., humidity of 50-60%, and free access to food and water. On the day of the experiment, SD rats were injected with the test agent into tail vein at a dose of 3 mg/kg and an injection volume of 5 ml/kg.

(121) The time for blood collection: On the first day of administration, blood was taken from ocular fundus vein at 5 min, 8 h, 24 h, 2 days, 3 days, 5 days, 8 days, and 15 days after administration, 200 L each time (equivalent to 100 L of serum). The collected blood samples were allowed to incubateat room temperature for half an hour until coagulation, and then centrifuged at 10,000g for 10 minutes at 4 C. The supernatant was collected and immediately stored at 80 C. The B7-H3 antibody concentration in the serum was measured by ELISA, and PK analysis was performed. The results are shown in Table 7.

(122) TABLE-US-00015 TABLE 7 T.sub.1/2 of B7-H3 antibody in SD rats Tested agent Route of administration T.sub.1/2 (mean SD, h) h1702 IV (3 mg/kg) 185 17

(123) The results show that the half-life of the antibody of the present invention in rats was approximately 185 h (7.7 days).

Test Example 7. Physical Stability of B7-H3 Antibodies

(124) Differential scanning calorimetry (DSC) was used to detect the thermal stability of different antibodies, and the thermal stability in different buffer systems under different pH conditions was compared. Exemplary buffer systems corresponding to different pHs were 10 mM PB (pH 7) and 10 mM Acetate (pH 5.2). The sample was dissolved in the corresponding buffer, and the sample concentration was controlled at about 1 mg/ml. Detection was performed using MicroCal* VP-Capillary DSC (Malvern). Before detection, each sample and the blank buffer were degassed by a vacuum degasser for 1 to 2 minutes. 400 l of sample or blank buffer were added to each well of the sample plate (the load of instrument is 300 l). The last two pairs of well-plates were respectively added with 14% Decon 90 and ddH.sub.2O for cleaning. After the sample plate was loaded, a plastic soft cover was placed. The scanning temperature started from 25 C. and ended at 100 C. The scanning rate was 60 C./h. The results are shown in Table 8. In several test systems, both h1702 and h1703 showed good thermal stability.

(125) TABLE-US-00016 TABLE 8 DSC results of different antibodies Sample Buffer Tm-onset ( C.) TM ( C.) h1702 pH 7.0 65.82 77.51 pH 5.2 65.59 78.97 h1703 pH 7.0 61.33 73.19 pH 5.2 60.65 75.71

(126) The purity of the sample was monitored by SEC-HPLC to investigate the stability under a certain concentration condition. As an example of condition, the sample concentration was controlled at about 40-50 mg/ml. The stability of different antibodies was compared in PBS (pH 7.4) system and pH 5.2 acetic acid/sucrose system at 4 C., 30 C., 40 C. for one month of storage. The purity of the antibody was examined using Xbridge protein BEH SEC 200A (Waters) HPLC column. After one month of investigation, both h1702 and h1703 showed good stability. The results are shown in Table 9.

(127) TABLE-US-00017 TABLE 9 Stability results for different antibodies 4 C./month/ 30 C./month/ 40 C./month/ Sample purity purity purity h1702/acetic 99.25% 98.68% 97.85% acid h1702/PBS 99.21% 98.07% 96.34% h1703/acetic 99.31% 99.04% 98.38% acid h1703/PBS 99.18% 98.56% 96.99%

(128) The results show that both h1702 and h1703 show excellent stability in both acetic acid and PBS buffers.

Test Example 8. Chemical Stability of B7-H3 Antibodies

(129) Chemical modification after antibody preparation is one of the common reasons leading to the product stability problem, especially the high degree of deamination, oxidation or isomerization modification at some amino acids in the CDR region. Those modifications should be avoided or reduced. 500 g of the antibodies to be tested was dissolved in 500 l of PBS pH 7.4, and subjected to a water bath at 40 C. Samples were taken at day 0, 10, and 20, respectively, for enzymatic hydrolysis experiments. 100 g samples were taken at different time points and dissolved in 100 l solution of 0.2 M His-HCl, 8 M Gua-HCl, pH 6.0; 3 l of 0.1 g/mL DTT was added, and subjected to water bath at 50 C. for 1 hour; Afterward, the samples were ultra-filtered twice with solution of 0.02 M His-HCl, pH 6.0, and 3 L of 0.25 mg/mL trypsin was added. The mixture was hydrolyzed overnight at 37 C. in water bath. Potential modification sites were analyzed by mass spectrometry (the results are shown in Table 10) using Agilent 6530 Q-TOF. The results show that h1702 and h1703 described in the present invention have no significantly increased trend towards deamidation, oxidation or heterogeneity, indicating that the molecules have excellent chemical stability.

(130) TABLE-US-00018 TABLE 10 Chemical stability of different antibodies Sample LC/HC position/modification D 0 D 10 D 20 h1702 LC M48/oxidation 2.82% 2.9% 2.83% HC M34/oxidation 3.52% 3.46% 3.38% M83/oxidation 0.98% 1.01% 0.01% h1703 HC M34/oxidation 1.93% 2.62% 2.16% M83/oxidation 1.96% 2.62% 2.8%

Test Example 9. Stability of h1702-1 Antibody

(131) The lambda type light chain has one more amino acid S at the C-terminus than kappa type light chain, and the steric hindrance of the S may be a factor causing instability of interchain disulfide bond between light and heavy chain. The terminal amino acid S can be knocked out by molecular cloning, and the stability of the antibody under alkaline condition would be remarkably improved.

(132) When the first amino acid at the N-terminus of the light chain of the naked antibody is Q, partial cyclization would also occur in the antibody, which leads to an increase in charge heterogeneity of the sample, affecting the stability of formulation and product. The first amino acid Q at N-terminus was mutated to D by molecular cloning, to eliminate the incomplete cyclization and significantly improve the antibody stability. The above modification did not significantly affect the affinity of the engineered antibody to its antigen.

(133) The stability of h1702 and h1702-1 was tested by size-exclusion chromatography (SEC), non-reducing CE-SDS analysis method (pH 9.0) and IEX analysis method.

(134) SEC detection: Waters e2695 chromatograph and Xbridge BEH 200A SEC column were used. 50 g of antibody was loaded, and the elution was performed using PBS mobile phase in constant gradient.

(135) CE-SDS NR Method:

(136) Samples were processed using the Beckman SDS-MW Analysis Kit. A buffer solution was added to 100 g tested antibody was denatured by heating in sample buffer as described in manned protocol. Data was collected using PA800 capillary electrophoresis apparatus.

(137) IEX Method:

(138) Waters Acquity H-Class chromatograph and Thermo MAbPac SCX-10 column were used. 50 g of tested antibody was loaded, and a linear gradient was applied, using CX-1 pH Gradient Buffer Kit as the mobile phase; ultraviolet signal at a wavelength of 280 nm was collected.

(139) TABLE-US-00019 TABLE 11 Comparison of stability of h1702 and h1702-1 SEC CE-SDS (pH 9.0) IEX h1702 100% 71.21% 40.5% h1702-l 100% 94.67% 86.21%

(140) Although the invention has been described in detail with the figures and specific embodiments for the purpose of a clear understanding, the description and embodiments should not be interpreted as limiting the scope of the present invention. All public contents of literatures and patents cited herein are expressly incorporated by reference in their entirety.