Harnessing quantum dots to study, visualize, and promote immune tolerance
10898583 ยท 2021-01-26
Assignee
- University Of Maryland, College Park (College Park, MD)
- The Government Of The United States Of America, As Represented By The Secretary Of The Navy (Arlington, VA)
Inventors
- Christopher M. Jewell (Silver Spring, MD)
- Krystina Hess (Rockville, MD, US)
- Igor Medintz (Springfield, VA, US)
- Kimihiro Susumu (Alexandria, VA, US)
- Eunkeu Oh (Alexandria, VA, US)
Cpc classification
B82Y10/00
PERFORMING OPERATIONS; TRANSPORTING
A61P25/28
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K9/14
HUMAN NECESSITIES
A61K47/6929
HUMAN NECESSITIES
A61K47/6923
HUMAN NECESSITIES
International classification
A61K47/69
HUMAN NECESSITIES
A61K9/14
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
B82Y10/00
PERFORMING OPERATIONS; TRANSPORTING
Abstract
Provided are compositions and methods for promoting tolerance to auto-immune antigens. In general the compositions include quantum dots (QDs) that are in association with auto-immune peptide antigens. It is shown that QDs can be used to generate immunological tolerance by controlling the density of self-antigen on QDs. Peptide-QDs rapidly concentrate in draining lymph nodes, and co-localize with macrophages expressing scavenger receptors involved intolerance. Treatment with peptide-QDs reduces disease incidence 10-fold. The degree of tolerance and the underlying expansion of regulatory T cells correlates with the density of myelin molecules presented on QDs such that higher numbers of tolerogenic particles displaying lower levels of self-peptide are more effective for inducing tolerance than fewer particles each displaying higher densities of peptide. The disclosure is therefore relevant to promoting tolerance to antigens that are involved in a variety of autoimmune disorders.
Claims
1. A quantum dot (QD) comprising a CdSe/ZnS component, the QD having conjugated thereon a plurality of myelin peptide antigen molecules, the antigen molecules comprising HHHHHSAAAAAG (SEQ ID NO:2), wherein (H).sub.5 of SEQ ID NO:2 participates in Zn-coordination of the peptide antigen on the QD.
2. The QD of claim 1, wherein the size of the quantum dot having the myelin peptide antigen molecules thereon is from 14 to 22 nm.
3. The QD of claim 1, wherein the number of myelin peptide antigen molecules on the QD are from 15 to 65.
4. The QD of claim 1, wherein the number of myelin peptide antigen molecules on the QD are from 13 to 59.
5. The QD of claim 1, wherein the density of myelin peptide antigen molecules on the QD are less than or equal to 0.56 peptide antigen molecules per nm.sup.2 of QD surface area.
6. The QD of claim 1, wherein S in SEQ ID NO:2 acts as a flexible hinge to display the peptide away from the QD surface, and wherein (A).sub.5 is an alpha-helical spacer.
7. A composition comprising a plurality of quantum dots (QDs) of claim 1.
8. The composition of claim 7, wherein the QDs comprise a ratio of myelin peptide antigen to QD of from 1:1 to 150:1.
9. The composition of claim 8, wherein at least 80% of the QDs in the plurality have a diameter of from 10-40 nm.
10. A method for promoting tolerance to a myelin antigen comprising administering to an individual in need thereof a composition of claim 7.
11. The method of claim 10, wherein subsequent to the administration regulatory T cells (T.sub.REGS) in the individual are expanded relative to a control.
12. The method of claim 10, wherein subsequent to the administration regulatory inflammatory T.sub.H1 cells in the individual are not expanded relative to a control.
13. The method of claim 10, wherein the QDs comprise a lowest density of myelin peptide antigens having 174 myelin peptide antigens per QD, and wherein the QDs comprise a highest density of myelin peptide antigens having 527 myelin peptide antigens per QD.
14. The method of claim 10, wherein a composition comprising the plurality of QDs is administered to an individual who has a condition that comprises an autoimmune response to myelin.
15. The method of claim 14, wherein the individual has multiple sclerosis, and wherein one or more symptoms of the MS in the individual are alleviated or inhibited from developing.
16. The method of claim 15, wherein the QDs comprise a ratio of myelin peptide antigen to QD of less than 150:1, and wherein alleviation or inhibition of development of the MS symptoms in the individual is greater than alleviation or inhibition of symptoms of the MS relative to a control value for administration of QDs comprising a ratio of myelin peptide antigen to QD of 150:1 or higher.
17. The method of claim 15, wherein the QDs comprise a ratio of myelin peptide antigen to QD of less than 65:1, and wherein alleviation or inhibition of development of the MS symptoms in the individual is greater than alleviation or inhibition of symptoms of the MS relative to a control value for administration of QDs comprising a ratio of myelin peptide antigen to QD of 65:1 or higher.
18. The method of claim 15, wherein subsequent to the administration T.sub.REGS in the individual are expanded relative to a control, and/or wherein subsequent to the administration regulatory inflammatory T.sub.H1 cells in the individual are not expanded relative to a control.
19. The method of claim 17, wherein subsequent to the administration T.sub.REGS in the individual are expanded relative to a control, and/or wherein subsequent to the administration regulatory inflammatory T.sub.H1 cells in the individual are not expanded relative to a control.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1) For a fuller understanding of the nature and objects of the disclosure, reference should be made to the following detailed description taken in conjunction with the accompanying figures.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
DETAILED DESCRIPTION OF THE DISCLOSURE
(20) Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains.
(21) Unless specified to the contrary, it is intended that every maximum numerical limitation given throughout this description includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.
(22) The present disclosure is related to inducing immune tolerance in individuals who have autoimmune disorders, and is exemplified via compositions and methods that are shown to be surprisingly efficacious in reducing and even reversing symptoms of multiple sclerosis (MS) in a pertinent mouse model. In particular, the present disclosure demonstrates that quantum dots (QDs) can be harnessed to promote tolerance by designing peptide-QD displaying self-antigen at tunable densities. Notably, the extent of efficacy is demonstrated to be directly linked to the density of peptide ligands on the QD, with lower levels of self-antigen displayed on a larger number of QDs driving the most efficient tolerance. Since lymph nodes, spleens, and other immune tissues integrate local signals across the body, it is considered (without intending to be bound by any particular theory) that this finding may reflect a mechanism achieved by providing a large number of therapeutic events, even if each QD only displays a low level of the self-antigen. These outcomes, along with the antigen-specific expansion of myelin-reactive T cells in co-culture studiesand the lack of efficacy using control QDs demonstrated hereinindicate that the tolerance generated by myelin antigen-QDs is myelin-specific, and may extend broadly to other antigens.
(23) In more detail, it is demonstrated in this disclosure that that a higher number of tolerogenic particles displaying lower levels of self-peptide is more effective for inducing tolerance than fewer particles displaying high densities of peptide. Thus, in embodiments the disclosure provides novel approaches to dose sparing.
(24) Certain and non-limiting aspects of this disclosure are demonstrated using the well-known myelin antigen known in the art as MOG. In embodiments the disclosure demonstrates that MOG-QDs offer tunable display of MOG peptide ligands, that dendritic cells can phagocytose MOG-QDs and process and present MOG to T cells, and that MOG-QDs drain to inguinal lymph nodes (iLNs) and induce tolerance in the well-known experimental autoimmune encephalomyelitis (EAE) model. In embodiments the disclosure demonstrates expansion of regulatory T cells (T.sub.REGS) using compositions and methods of the invention, whereas it is also shown that regulatory inflammatory T.sub.H1 cells are not expanded.
(25) With respect to the EAE mouse model, it is known in the art that it has been used to show pre-clinical efficacy for FDA approved multiple sclerosis treatments that include Copaxone, Dimethyl fumarate, Fingolimod, Interferon Beta-1A, Natalizumab, and Teriflunomide. In the current disclosure this model is used to provide evidence of the induction of tolerance to myelin antigen, supporting its use as an approach to managing MS. Furthermore, EAE is an accepted model for acute disseminated encephalomyelitis (ADEM) and acute haemorrhagic leucoencephalitis (AHLE). It is known in the art that ADEM comprises a widespread attack of inflammation in the brain and spinal cord that damages myelin, and AHLE is the severe end of the range of ADEM. Thus, the EAE model is useful for evaluating induction of tolerance to myelin antigens, such as MOG. In connection with this, in non-limiting illustrations, it is demonstrated that providing myelin antigen-QD conjugates at a fixed mass, but displaying the doses on different numbers of QDs (i.e., fixed dose of the representative myelin antigen MOG, but varying number of QDs) results in mice receiving the fewest number of peptides per QD exhibiting the lowest clinical scores in the EAE model, with scores increasing in order for increasing MOG:QD ratios tested. These differences were statistically significant at several points, including the peak of disease. Surprisingly, mice receiving the lowest MOG:QG ratio tested (25:1 MOG:QDs) exhibited a mean score 3-fold lower than mice treated with the highest ratio (65:1 MOG:QDs). Additionally, mice injected with the lowest ligand density of MOG:QDs showed both delayed disease onset and lower incidence compared with all other groups. Moreover, as is known in the art, an additional indicator of EAE severity is body weight loss. For this metric, a similar trend to that measured for clinical score was observed, where mice treated with the lowest tested MOG:QDs maintained the highest percentage of original body weight, and weight loss increased as the number of MOG peptides per QD increased.
(26) In view of these and other results described in the examples and figures below, the disclosure provides compositions and methods for prophylaxis and/or therapy for restraining the immune response in a variety of individuals in need thereof. The disclosure includes all QD and antigen properties and methods of making and using them described herein, including but not limited to all dynamic light scattering values, all antigen and QD sizes and size dispersions, probabilities of having any particular number of antigens per QD, hydrodynamic diameters, functionalization ratios, diffusion coefficients, density of peptide ligands on QDs, ratios of QDs to antigens, antigen mass, loading levels, self-assembly properties, lymph node draining and trafficking properties, QD/antigen uptake and antigen processing values, all effects on T cells and all other components of the immune system, all effects on symptoms or other indicators of a disease condition modeled in non-human animals and which may manifest in humans, and all steps and combinations of steps. In this regard, the steps of the methods described in the various embodiments and examples disclosed herein are sufficient to carry out aspects of the present invention. Thus, in an embodiment, a method consists essentially of a combination of the steps of the methods disclosed herein. In another embodiment, a method consists of such steps. In embodiments the disclosure provides one or more provisos that the methods can exclude certain steps and/or components, such as complicating stabilizers, reactions, and/or purification steps.
(27) The disclosure employs QDs that are in physical association with myelin antigens. It is expected that a variety of QDs can be used in embodiments of the disclosure, although some QD properties may be preferable. QDs used to demonstrate this invention were CdSe/ZnS core/shell QDs. Such QDs are known in the art and can be made using established approaches, and can be combined with peptide antigens by using and/or adapting techniques discussed herein. QDs are also commercially available. In certain examples, QDs can comprise CdS, CdTe Pb Se, PbS, PbTe, or can be silicon QDs, germanium QDs. Combinations of distinct materials and combat ions of QDs made of distinct materials can also be used. Various QD sizes can be used and have properties and myelin antigen types and values ad discussed further below.
(28) It is expected that any myelin antigen can be used in embodiments of this disclosure, provided the myelin antigen is recognized in whole or in part by a component of the immune system of the individual in need of treatment (prior to the administration). Those skilled in the art will recognize that myelin is synthesized by different cell types, and can vary in composition and structure, but is defined as the material that makes up the so-called sheath of myelinated axons in vertebrates. Myelin in its form in myelinated axons comprises about 40% water; its dry mass is approximately 70-85% lipids and 15-30% proteins. In general, and without intending to be limited by any particular theory, it is considered that any of proteins or fragments thereof that are inappropriately recognized by the immune system of an individual in need of treatment can function as a suitable antigen in the compositions and methods of the present disclosure. In embodiments, the myelin antigen comprises a protein or immunogenic fragment thereof, exemplary proteins including but not necessarily limited to myelin basic protein (GenBank accession number NP_002376.1), myelin oligodendrocyte glycoprotein (MOG) (GenBank accession number NP_002535.3, and proteolipid protein (GenBank accession no. AAA60117.1); the amino acid sequence for each GenBank number presented in this disclosure is incorporated herein by reference as of the priority date of this application or patent. Without intending to be constrained by any particular theory, immunogenic fragments are considered to be those that are capable of being recognized by the immune system of an individual who has MS. In embodiments, the present disclosure is considered to result in induction of immune tolerance to such antigens. In embodiments, the antigen comprises or consists of myelin, a peptide fragment thereof, or a combination or peptide fragments. In certain embodiments, the composition does not comprise any surface ligand that specifically targets the composition to any cell or tissue. Based on the results presented herein, it is expected the compositions and methods of this disclosure can be adapted by those skilled in the art to address other autoimmune conditions. Thus, in embodiments, one or more peptide antigens of this disclosure can be segments of or derived from any protein-based autoantigens, including those known to be involved in the etiology of any of celiac disease, Crohn's disease, diabetes mellitus type 1, eosinophilic fasciitis, eosinophilic gastroenteritis, gastritis, Graves' disease, hypogammaglobulinemia, idiopathic inflammatory demyelinating diseases, thrombocytopenic purpura, rheumatoid arthritis, lupus erythematosus, myasthenia gravis, pernicious anemia, psoriasis, Sjgren's syndrome, and ulcerative colitis. In embodiments the peptide antigens can include but are not necessarily limited to one or more pancreatic -cell autoantigens, or insulin B (InsB) chain autoantigens, including but not limited to InsB.sub.10-18, or Islet-Specific Glucose-6-Phosphatase Catalytic Subunit-Related Protein (IGRP), including but not limited to IGRP.sub.206-214, and other autoantigens, such as chromogranin A (CgA), and glutamic acid decarboxylase (GAD), GAD65, or Glial fibrillary acidic protein (GFAP), or IA-2 (islet antigen 2; tyrosine phosphatase). In embodiments the peptide antigens can be any of those described in U.S. Patent Publication No. 20120093934, from which the description and amino acid sequences of peptide antigens is incorporated herein by reference.
(29) The QD/antigens can be provided in pharmaceutical compositions for administration by combining them with any suitable pharmaceutically acceptable carriers, excipients and/or stabilizers. Some suitable examples of pharmaceutically acceptable carriers, excipients and stabilizer can be found in Remington: The Science and Practice of Pharmacy (2005) 21st Edition, Philadelphia, Pa. Lippincott Williams & Wilkins. Further, any suitable delivery vehicle can be used in the invention.
(30) Administration of formulations comprising QD/myelin antigens as described herein can be performed using any suitable route of administration, including but not limited to parenteral, intraperitoneal, intrapulmonary, oral, intra-thecal, trans or intradermal, and intra-lymph node. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, and subcutaneous administration.
(31) In embodiments QDs of the compositions and methods of this disclosure have a diameter of from 8 nm to 40 nm. In embodiments compositions comprising a plurality of QDs and myelin antigens are provided. In embodiments, at least 80% of the QDs in the plurality have a diameter of from 8-40 nm. Thus, in embodiments the disclosure comprises a plurality of QDs or a composition comprising the QDs, wherein at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, and up to 100% of the QDs have a diameter of from about 8-40 nm, inclusive, and including all ranges there between. Some non-limiting examples are provided using QDs with a diameter of 9.20.8 nm. In embodiments the QDs have hydrodynamic diameters (H.sub.D) of from 15.00.24 nm to 21.00.63 nm. In embodiments QDs have a H.sub.D of approximately 20 nm. QD diameters can be determined with or without myelin antigens as described herein. In embodiments the QD diameter is determined when the QDs are dynamic (i.e., tumbling) and solvated. Thus, the disclosure includes QDs wherein diameters may be determined by known techniques, such as Dynamic Light Scattering (DLS). QDs can emit light at any wavelength/color known in the art for QD emissions. In non-limiting embodiments 625 nm emitting QDs are used.
(32) The amount myelin antigen, QDs, ratios thereof, and the number of QDs such that a suitable amount of myelin antigen is administered can be determined by those skilled in the art, given the benefit of the present disclosure. In embodiments dosing takes into account that, as demonstrated herein, mice treated with the lowest ligand density of MOG:QDs showed both delayed disease onset and lower incidence compared higher densities in a model of MS.
(33) In one embodiment, an effective amount of a composition of the invention is administered. An effective amount is an amount of the composition that stimulates an intended immune response, such and induction of tolerance, and/or a particular lymphocyte response, and/or a reduction of symptoms, and/or inhibition of progression of symptoms, and/or prevention of the development of symptoms of a condition associated with an autoimmune response directed at least in part to myelin. For QD and myelin dosing, the present disclosure includes but is not necessarily limited to antigen/QD loading of from 1-550 g peptide/mg QD, inclusive, and including all numbers and ranges of numbers there between. In an embodiment the disclosure includes not more than 550 g peptide/mg QD. In embodiments, the QDs and myelin antigen peptide, illustrated using MOG, can have any of the following attributes: The size of a QD having myelin peptide antigen molecules thereon is from 14 to 22 nm, and wherein the number of the myelin peptide antigen molecules on the QD are from 1 to 150, or are from 15 to 65, or are from 13 to 59. In an embodiment more than 4 myelin antigen peptides are included on a QD. In an embodiment, the density of myelin peptide antigen molecules on the QDs are less than or equal to 0.56 peptide antigen molecules per nm.sup.2 of QD surface area. In embodiments, the myelin antigen comprises an additional amino acid sequence, such as HHHHHSAAAAAG (SEQ ID NO:2), wherein (H).sub.5 participates in Zn-coordination of the peptide antigen on the QD, wherein S acts as a flexible hinge to display the peptide away from the QD surface, and wherein (A).sub.5 is an alpha-helical spacer. Alternatives to the Zn-coordination segment, the flexible hinge and spacer are known in the art and can be used in embodiments of this invention. In one approach, QDs can be made biocompatible by modifying them, such as with the zwitterionic CL4 ligand, which is a small zwitterionic molecule bearing two carboxyl groups and one each secondary and tertiary amine moieties (length=1.8 nm) and is known in the art.
(34) In an embodiment the disclosure includes 550 g peptide/mg QD for any antigen disclosed herein, which is a ratio of 130:1 MOG:QD. The disclosure illustrates effects of MOG:QD compositions having the following values, each of which is encompassed by the invention, as are all values and ranges of values between these non-limiting illustrations: 70 g MOG or control (CTRL) peptide on 0.2 nanomoles QDs (a MOG/QD ratio of 100:1), or 70 g MOG peptide on 0.2 nanomoles QDs (a MOG/QD ratio of 100:1); 14.3 g MOG on 0.4 nanomoles QDs (a MOG/QD ratio of 17:1); 73 g MOG on 0.2 nanomoles QDs (a MOG/QD ratio of 52:1); 70 g MOG on 0.5 nanomoles QDs (a MOG/QD ratio of 25:1), 70 g MOG on 0.4 nanomoles QDs (a MOG/QD ratio of 52:1), and 70 g MOG on 0.3 nanomoles QDs (a MOG/QD ratio of 65:1). Such values can be adapted for dosing human patients, taking into account such variables as the type and stage of disease that is being treated, the overall health and medical history of the individual, the size, weight, age and gender of the individual, and other factors that will be apparent to those skilled in the art. Thus, in embodiments, the disclosure includes methods for promoting tolerance to a myelin antigen comprising administering to an individual in need thereof any of the compositions discussed above. In certain implementations, subsequent to the administration regulatory T cells (T.sub.REGS) in the individual are expanded relative to a control. In one approach, subsequent to the administration regulatory inflammatory T.sub.H1 cells in the individual are not expanded relative to a control. In certain embodiments the QDs comprise a lowest density of myelin peptide antigens having 174 myelin peptide antigens per QD, and wherein the QDs comprise a highest density of myelin peptide antigens having 527 myelin peptide antigens per QD.
(35) In embodiments, a composition of the invention is administered to an individual in need thereof, such as an individual who has, or is at risk of developing and/or a experiencing a reoccurrence of MS, wherein the QDs comprise a ratio of myelin peptide antigen to QD of less than 150:1, and wherein alleviation or inhibition of development of the MS symptoms in the individual is greater than alleviation or inhibition of symptoms of the MS relative to a control value for administration of QDs comprising a ratio of myelin peptide antigen to QD of 150:1 or higher. In an embodiment, the QDs comprise a ratio of myelin peptide antigen to QD of less than 65:1, and alleviation or inhibition of development of the MS symptoms in the individual is greater than alleviation or inhibition of symptoms of the MS relative to a control value for administration of QDs comprising a ratio of myelin peptide antigen to QD of 65:1 or higher. Thus, the disclosure comprises tuning the ratio of myelin antigens per QD, and tuning the amount of myelin antigen as a total dose by controlling the number of QDs over which the total dose is distributed. Accordingly, to produce a desired outcome, the myelin antigen density can be adjusted so as to optimize the dose over a suitable number of QDs. Those skilled in the art will recognize that the disclosure accordingly facilitates determining the existence, severity, stage, immune status, etc. of MS or another myelin-related autoimmune condition for any particular individual and modifying the compositions of the invention to improve the presentation of the myelin antigen to that particular individual's condition, thereby providing personalized treatment approaches. Accordingly, in embodiments, the individual to whom a composition of this disclosure is administered has been diagnosed with or is suspected of having MS, and thus can include individuals who have one or a combination of primary-progressive multiple sclerosis (PPMS), relapsing-remitting MS (RRMS), secondary-progressive MS (SPMS), or progressive-relapsing MS (PRMS). In certain embodiments, the individual has been diagnosed with or is suspected of having PPMS. In this regard, and as is known in the art, PPMS is generally characterized by persistent worsening of neurologic function, but without separate relapses or periods of remission. PPMS thus differs from relapsing forms of MS in that the relapsing forms comprise at least two separate locations of damage in the central nervous system (dissemination in space) that occurred at different time points (dissemination in time). The inflammatory events that result in this damage comprise the relapses (sometimes referred to alternatively as attacks or exacerbations). In contrast, PPMS comprises a gradual change in functional abilities over time. Accordingly, because PPMS and relapsing MS are considered distinct disorders (but are not necessarily mutually exclusive in any particular individual) they have different diagnostic criteria. Specifically, PPMS can be diagnosed based on a combination of criteria that comprises a) at least one year of disease progression, which typically includes worsening of neurological function without remission, and b) at least two of: i) a type of lesion in the brain that is recognized by a medical professional skilled in the art of MS diagnosis; ii) two or more lesions of a similar type in the spinal cord; and iii) evidence in the spinal fluid of a oligoclonal band of immunoglobulins, and/or an elevated IgG index, which are both signs of immune system activity in the central nervous system. In certain embodiments of this disclosure, the individual has been diagnosed with or is suspected of having PPMS. In embodiments, PPMS may be the only type of MS that the individual is suspected of having, or has been diagnosed with.
(36) In certain embodiments, a method of this disclosure results in a slowing of the progression of symptoms of PPMS, and can even include a reversal of PPMS progression. In connection with this and as known in the art, common symptoms of MS, which can be encompassed by PPMS, include but are not necessarily limited to fatigue, walking difficulties, spasticity, dizziness and vertigo, blurred vision and pain upon eye movement, bladder and bowel dysfunction, numbness or tingling, sexual dysfunction, pain, and cognitive changes, such as complications in the ability to learn and remember information, problem solving and the like. Less common symptoms include but are not necessarily limited to difficulties with speech or swallowing, tremors, seizures and breathing problems. In embodiments, the present disclosure comprises a method of inhibiting the progression of the severity of one or more of these or other MS symptoms in an MS patient, such as a PPMS patient. In embodiments, inhibiting or reducing a symptom means the severity of the symptom is lessened, and/or the rate at which the symptom progresses is slowed, and/or the symptom is prevented from manifesting, and/or the symptom is eliminated. To achieve any of the foregoing results, an effective amount of a composition of the invention is administered.
(37) In embodiments, the disclosure comprises kits for prophylaxis and/or therapy for myelin-related autoimmune conditions. The kits can comprise a myelin antigen and QDs as described above, or in separate formulations for mixing together. The kits can comprise a suitable buffer and pharmaceutically acceptable excipients, carriers and the like. The components can be included in separate containers, or a single container with separate compartments. The containers can include sterile components, vials, ampules, tubes, a bolus, etc. The kits can comprise printed material, such as instructions, and/or an indication that the kit is for use in treating, for example, an MS patient.
(38) The following examples are presented to illustrate the present disclosure. They are not intended to limiting in any matter.
Example 1
(39) This example provides a description of peptides functionalized with self-assembling peptides.
(40) We initially analyzed 625 nm emitting CdSe/ZnS core/shell QDs (
(41) To facilitate assembly, MOG was synthesized with an N-terminus sequence of HHHHHSAAAAAG (SEQ ID NO: 2) (where the full peptide is HHHHHSAAAAAGMEVGWYRSPFSRVVHLYRNGK, (SEQ ID NO: 3), where (H).sub.5 (SEQ ID NO: 4) participates in Zn-coordination, S acts as a flexible hinge to display the peptide away from the QD surface, and (A).sub.5 (SEQ ID NO: 5) forms a rigid alpha-helical spacer terminated by the G residue. These interactions were simulated using an energy-minimized approach, revealing the conformation in
Example 2
(42) This Example demonstrates that MOG-QD exhibit uniform diameters suitable for lymphatic trafficking.
(43) We next characterized how different levels of modification of QDs with MOG self-antigens impacted particle size and mobility. Electrophoretic mobility in agarose gels confirmed an inverse relationship between the MOG:QD conjugation ratio and migration (
(44) While recent studies aimed at inducing tolerance have used microparticles or larger nanoparticles (100-500 nm),.sup.[7, 15, 16] the results above highlight unique features of QDs, including 5-50 fold smaller diameters (<20 nm) for efficient concentration in LNs. This size range is noteworthy in the context of lymphatic drainage. It has been previously shown that even particles on the size range of 100 nm drain inefficiently to LNs, while a diameter of 20 nm dramatically improves lymphatic trafficking..sup.[14] Further, MOG-QD particles also self-assemble, allowing facile administration without need for complicating stabilizers, reactions, or purification steps. With respect to loading, in contrast to the typical loading levels of several or tens of micrograms of peptide per milligram of nanoparticle carrier, the MOG-QDs of this disclosure offer loading as high as 550 g peptide/mg QD for 130:1 MOG:QD, as well as direct tuning of surface display density. Using QDs as shuttles for self-peptides also may allow for visualization and tracking of therapeutic conjugates without photobleaching, additional probes, or dissociation of dyes from a carrier.
(45) To evaluate the unique features of QDs for modulating immunity, we first tested uptake and antigen processing of MOG-QDs using conjugates at the highest antigen density we characterized, 150:1 (
(46) We next tested if MOG displayed on QDs is processed and presented in a manner that is accessible to myelin-reactive CD4.sup.+ T cells from 2D2 transgenic mice. When 2D2 T cells encounter MOG presented by DCs with the correct co-stimulatory signals, these cells proliferate. In these approaches, DCs were incubated with a fixed number of QDs, but displaying different densitieseither 17 or 52 peptides per QDof MOG ligand or an irrelevant peptide ligand from ovalbumin (CTRL). To drive co-stimulatory signaling, DCs were also treated with a common molecular adjuvant (CpG). DAPI staining was used to evaluate the effect of MOG-QD treatment on cell viability in co-cultures relative to treatment with free MOG (
Example 3
(47) This Example provides a description of draining Lymph node imaging and analysis. This was begun by administering MOG-QDs to C57BL/6 mice by subcutaneous (s.c.) injection, then by use of fluorescence microscopy to assess lymphatic drainage. After 24 hours the draining and non-draining inguinal LNs (iLNs) were harvested, sectioned, and stained for common lymphocytes (B cells, B220; T cells, CD3). The draining iLN from injected mice exhibited striking levels of MOG-QDs in the medullary sinus (asterisk) and subcapsular sinuses (arrows), as well as less concentrated, widespread distribution in the T cell zone/paracortex (
(48) To determine if MOG-QDs might traffic to marginal zone macrophages and tolerance-inducing scavenger receptors, we stained iLNs for F4/80 and MARCO, respectively. MOG-QDs were frequently co-localized with both macrophages and MARCO throughout the iLN (
Example 4
(49) This Example demonstrates that MOG-QDs improve EAE, while QDs or MOG alone, or CTRL-QDs do not. We first induced mice with experimental autoimmune encephalomyelitis (EAE), a myelin-driven model of MS that results in loss of motor function and development of total paralysis over 2-3 weeks..sup.[6, 7, 39] Two days later, mice received a single s.c. injection of MOG-QDs or one of several control treatments: free MOG, CTRL-QDs, or QDs only (
Example 5
(50) This Example demonstrates that MOG-QD control disease in a dose-dependent manner. In particular analyzed the role of MOG dose on the extent of tolerance induced by MOG-QD treatment. Mice were again induced with EAE and received an injection of MOG-QDs on day 2 (
Example 6
(51) This Example demonstrates that MOG-QD expand regulatory T cells without increasing inflammatory T.sub.H1 cells. We analyzed whether efficacy in controlling disease results from MOG-QD driven expansion of T.sub.REGS (CD4.sup.+/CD25.sup.+/Foxp3.sup.+). Thus mice with EAE were treated with MOG-QDs (17:1 or 52:1) on day 2 as in
Example 7
(52) This Example demonstrates that tolerance and efficacy during EAE correlates inversely with peptide display density. To directly investigate the role of ligand density, we prepared MOG-QDs at three ligand densities, then injected groups of mice with EAE using constant masses of MOG, but displaying these doses on different numbers of QDs (i.e., fixed dose of MOG, varying number of QDs) (
(53) Because most therapies for MS and other autoimmune diseases are broadly suppressive, there is intense research to generating more selective therapies. The immune system offers this potential, and the control biomaterials could provide toward this goal has spurred great interest at this interface. This disclosure adds a fundamental discovery to the field: that a higher number of tolerogenic particles displaying lower levels of self-peptide is more effective for inducing tolerance than fewer particles displaying high densities of peptide. This indicates that a large number of low-density/dose events may lead to more effective control of autoimmune or inflammatory reactions then larger doses distributed among fewer particles or carriers.
Example 8
(54) This Example provides a description of the materials and methods used to obtain the results descried above, and as represented in the figures.
(55) Materials:
(56) MOG modified for attachment to QDs (HHHHHSAAAAAGMEVGWYRSPFSRVVHLYRNGK (SEQ ID NO: 3), denoted MOG in the text) and a similarly-modified control peptide from ovalbumin (HHHHHSAAAAAGISQAVHAAHAEINEAGR; denoted CTRL in text (SEQ ID NO: 6)) were synthesized by Genscript (Piscataway, N.J.). Molecular Biology Grade Water and RPMI-1640 media were purchased from Lonza (Allendale, N.J.). Fetal bovine serum (FBS) was supplied by Corning (Tewksbury, Mass.). 2-Mercaptoethanol and Amicon Ultra Centrifugal Filters were purchased from Sigma Aldrich (St. Louis, Mo.). HEPES, non-essential amino acids, and 40 m cell strainers were purchased from VWR (Radnor, Pa.). OPC oligonucleotide purification cartridges, L-Glutamine, Penicillin-Streptomycin, and 4,6-diamidino-2-phenylindole (DAPI) were purchased from Thermo Fisher Scientific (Grand Island, N.Y.). Spleen Dissociation Medium and CD4 negative selection kits were from STEMCELL Technologies (Vancouver, British Columbia, Canada). CD11c microbeads were purchased from Miltenyi Biotec (Cambridge, Mass.). CpG adjuvant (5-TCC ATG ACG TTC CTG ACG TT-3, (SEQ ID NO: 7)) was synthesized by IDT (Coralville, Iowa). Fluorescent antibody conjugates for flow cytometry were purchased from BD (San Jose, Calif.). eFlour 670 proliferation dye was supplied by affymetrix eBioscience (San Diego, Calif.). FITC CD45R/B220 (BD), CD3e (abcam, Cambridge, Mass.), DL405 IgG (Jackson Immunoresearch, West Grove, Pa.), F4/80 (BD), Biotinylated MARCO (R&D Systems, Minneapolis, Minn.), and Streptavadin Alexa 488 (Jackson Immunoresearch) were used for immunohistochemical staining of iLN sections. EAE induction kits were supplied by Hooke Laboratories (Lawrence, Mass.).
(57) Cells and Animals:
(58) All primary cells were harvested from female C57BL/6 mice (4-12 weeks, stock #000664) and male C57BL/6-Tg(Tcra2D2,Tcrb2D2)1Kuch/J (2D2) mice (10-16 weeks, stock #006912) purchased from Jackson Laboratories (Bar Harbor, Me.). 2D2 mice display transgenic CD4.sup.+ T cell receptors specific for MOG residues 35-55. Mice induced with EAE were female C57BL/6 mice (10-12 weeks, stock #000664). All animals were cared for in compliance with Federal, State, and local guidelines, and using protocols reviewed and approved by the University of Maryland's Institutional Animal Care and Use Committee (IACUC).
(59) Characterization of Quantum Dots and Peptide-QD Assemblies:
(60) The 625 nm emitting QDs and their cap-exchange with CL4 ligands have been previously described..sup.[41] Peptides were desalted prior to QD conjugation as described..sup.[42] MOG peptide has a net charge of +4 at pH 7. MOG and CTRL were assembled on QDs by mixing solutions of desalted peptide in molecular biology grade water with QDs at defined molar ratios. TEM, gel electrophoresis, and DLS analysis were performed as described..sup.[41]
(61) Quantification of Peptide Loading on QDs:
(62) We utilized an established fluorescence method to verify peptide binding to QDs by the same mechanism..sup.[43] A Cy3-labeled peptide terminating in a (His).sub.6 (SEQ ID NO: 8) motif was self-assembled to the QDs across a range of ratios including 0, 10, 25, 50, 75, 100, 125, and 150 peptides/QD in 100 L of PBS. Equal amounts of free dye-labeled peptide without QD were added to the same volume of PBS as controls. Following self-assembly, all samples were loaded into 0.5 mL Amicon Ultra Centrifugal Filters with a 50,000 NMWL and centrifuged at 14,000g for 10 min. The amount of free dye-labeled peptide from the QD samples was then compared to that from the unbound dye-labeled peptide only control samples using UV absorbance.
(63) Simulation of MOG-QD Peptide Assembly:
(64) The MOG-QD peptide assembly was simulated in silico in a manner similar to that we described previously for other peptides..sup.[31, 32, 44-46] These structures and calculations were prepared using Chimera and Chem-3D Ultra 11.0. Energy was minimized using the MM2 module and the most probable conformation when attached to the QD were selected. A hard sphere was used to represent the quantum dot (QD) core/shell structure, which was covered with the surface-functionalizing ligand at an extension estimated from dynamic light scattering (DLS) measurements and energy minimization. The core MOG peptide structure was taken directly from the crystallographic structure 1PKO in the Protein Data Bank..sup.[47] The remaining (His).sub.5S(Ala).sub.5G (SEQ ID NO: 2) N-terminal portion was docked to the QD surface via the (His).sub.5 (SEQ ID NO: 3) sequence with the (Ala).sub.5G (SEQ ID NO: 9) portion in an energy-minimized alpha helical conformation. Probabilities for peptide ligand density distributions were calculated using a Poisson distribution as previously described and confirmed experimentally..sup.[48]
(65) Dendritic Cell Isolation and Flow Cytometry:
(66) CD11c.sup.+ dendritic cells (DCs) were isolated from the spleens of female C57BL/6 mice through positive selection with Spleen Dissociation Media (STEMCELL) and CD11c Microbeads (Miltenyi). DC purities after isolation varied slightly across experiments, but were 90% or greater. DCs were plated in a 96 well plate at 100,000 cells per well and cultured in RPMI 1640 media supplemented with 10% FBS, 2 mM L-glutamine, 1 non-essential amino acids, 10 mM HEPES buffer, 1 penicillin and streptomycin, and 55 M -mercaptoethanol at 37 C. and 5% CO.sub.2. For uptake studies, DCs were incubated with 150:1 MOG-QDs for 2 hours, stained with DAPI, and examined by flow cytometry (BD Cantoll, San Jose, Calif.) for presence of MOG-QDs and viability. Viability was determined by cells staining negative for DAPI. Data were analyzed with FlowJo v.10 (TreeStar, Ashland, Oreg.).
(67) DC Activation, T Cell Co-Culture, and Flow Cytometry:
(68) Isolated DCs were treated with CpG to induce the expression of costimulatory factors and either MOG or CTRL in soluble or QD-conjugated form and cultured for 24 hours. DC activation was then analyzed by staining for CD40, CD80, and CD85 markers. Stained cells were analyzed by flow cytometry. CD4.sup.+ T cells were then isolated from the spleens of 2D2 mice via a negative selection kit (STEMCELL) and labelled with eFlour 670 proliferation dye. 300,000 T cells were then added to the wells containing treated DCs. After 72 hours, cell viability was assessed by DAPI staining and T cell proliferation was analyzed by a decrease in fluorescent signal as dye is diluted in daughter cells during successive generations. Cells in all in vitro studies were treated with a dose of QDs ranging from 0.44 to 40 picomoles and a dose of MOG ranging from 0.25 to 10 g.
(69) Analysis of QD Drainage in Mice:
(70) Mice were injected with MOG-QDs and 24 hours later, the draining and non-draining iLNs were harvested for analysis. LNs were passed through a 40 m strainer to create a single cell suspension. Cells were then stained with DAPI and analyzed by flow cytometry for viability (i.e., DAPI.sup.) and presence of fluorescent MOG-QDs. Additional iLNs were frozen, sectioned, and fixed for staining. In one analysis, sections were stained for T cells (CD3e) and B cells (B220). In an additional study, sections were stained with antibodies for macrophages (F4/80) and the scavenger receptor MARCO. iLN sections were visualized by fluorescent microscopy (Olympus IX-83) for presence of MOG-QDs, T cells, B cells, macrophages, and MARCO. ImageJ was used for image processing and analysis. All images in a particular study were analyzed in an identical manner that was applied to the entire image area.
(71) EAE Induction and Monitoring:
(72) C57BL/6 mice (female, 10-12 weeks) were induced with EAE following a defined protocol from Hooke Labs. Briefly, mice were injected s.c. with an emulsion of MOG and complete Freund's adjuvant (CFA) at the upper and lower back on day 0. Pertussis toxin was also administered intraperitoneally 2 and 24 hours after MOG/CFA injection. Beginning at day 7, mice were weighed to detect changes from day 0 body weight (a symptom of disease) and scored for disease severity with respect to paralysis. A standard clinical scoring rubric was used: 0no symptoms, 1limp tail, 2weakness of hind legs, 3hind limb paralysis, 4hind limb paralysis and partial front limb paralysis, 5moribund..sup.[6, 7, 15] Disease incidence was defined as the first day a mouse displayed symptoms of paralysis.
(73) MOG-QD Treatment:
(74) Mice induced with EAE were randomly divided into groups of 8-10 mice each. A control group was left untreated in each experiment. In one experiment, additional groups were treated by s.c. injection at the tailbase with 0.2 nanomoles QDs, 70 g MOG, 70 g CTRL peptide on 0.2 nanomoles QDs (100:1), or 70 g MOG peptide on 0.2 nanomoles QDs (100:1). Similar experiments contained two treatment groups: 14.3 g MOG on 0.4 nanomoles QDs (17:1) or 73 g MOG on 0.2 nanomoles QDs (52:1). The final experiment design contained three treatment groups: 70 g MOG on 0.5 nanomoles QDs (25:1), 70 g MOG on 0.4 nanomoles QDs (52:1), or 70 g MOG on 0.3 nanomoles QDs (65:1).
(75) EAE T Cell Readout:
(76) Mice were induced with EAE and treated with MOG-QDs as described above. On day 9, the iLNs were removed for analysis by flow cytometry. iLNs were mashed through a 40 m strainer to create a single cell suspension and stained for T cell surface markers (CD4.sup.+, CD25.sup.+) and transcription factors (Tbet.sup.+, Foxp3.sup.+). Tbet and Foxp3 are common transcription factors used to identify T.sub.H1 and T.sub.REG, respectively. Cells were examined with flow cytometry and data were again analyzed with FlowJo v.10.
(77) Statistics:
(78) One-way ANOVA with a Tukey post-test was used to compare three or more groups for in vitro studies and overall disease metrics from in vivo studies. For in vivo studies, two-way ANOVA was used to compare three groups monitored over time, with post-test corrections for multiple comparisons. Log-rank tests were used in analysis of disease incidence. For all tests, p values 0.05 were considered significant. For all figures, *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001, .sup.#p<0.05.
(79) It will be recognized from the foregoing that QDs modified with myelin or control peptides exhibited tunable, uniform featurespeptide display density and size, for example. These materials were non-toxic to primary immune cells and did not trigger any intrinsic inflammatory responses. In mice, the peptide-QDs rapidly drained to lymph nodes following injection, and were co-localized with macrophages expressing scavenger receptors involved in tolerance. MOG-QD treatment in mice induced with a mouse model of MS drastically reduced disease severity and incidence, while QDs modified with control peptide sequences did not. These therapeutic effects were tunable and directly correlated with not just the dose, but with the density of MOG ligands assembled on the QD surfaces.
REFERENCES
(80) [1] H. F. McFarland, R. Martin, Nat. Immunol. 2007, 8, 913. [2] M. Comabella, S. J. Khoury, Clin. Immunol. 2012, 142, 2. [3] J. A. Bluestone, H. Bour-Jordan, M. Cheng, M. Anderson, J. Clin. Invest. 2015, 125, 2250. [4] F. Piehl, J. Intern. Med. 2014, 275, 364. [5] A. Lutterotti, R. Martin, Expert Opin. Investig. Drugs 2014, 23, 9. [6] J. M. Gammon, L. H. Tostanoski, A. R. Adapa, Y.-C. Chiu, C. M. Jewell, J. Controlled Release 2015, 210, 169. [7] X. Clemente-Casares, J. Blanco, P. Ambalavanan, J. Yamanouchi, S. Singha, C. Fandos, S. Tsai, J. Wang, N. Garabatos, C. Izquierdo, S. Agrawal, M. B. Keough, V. W. Yong, E. James, A. Moore, Y. Yang, T. Stratmann, P. Serra, P. Santamaria, Nature 2016, 530, 434. [8] L. H. Tostanoski, E. A. Gosselin, C. M. Jewell, Discov. Med. 2016, 21, 403. [9] I. K. Gratz, M. D. Rosenblum, M. M. Maurano, J. S. Paw, H. A. Truong, A. Marshak-Rothstein, A. K. Abbas, J. Immunol. 2014, 192, 1351. [10] L. H. Tostanoski, Y. C. Chiu, J. I. Andorko, M. Guo, X. Zeng, P. Zhang, W. Royal, 3rd, C. M. Jewell, ACS Nano 2016, [11] K. L. Hess, J. I. Andorko, L. H. Tostanoski, C. M. Jewell, Biomaterials 2016, 118, 51. [12] P. Zhang, Y. C. Chiu, L. H. Tostanoski, C. M. Jewell, ACS Nano 2015, 9, 6465. [13] M. A. Swartz, J. A. Hubbell, S. T. Reddy, Semin. Immunol. 2008, 20, 147. [14] S. T. Reddy, A. J. van der Vlies, E. Simeoni, V. Angeli, G. J. Randolph, C. P. O'Neil, L. K. Lee, M. A. Swartz, J. A. Hubbell, Nat. Biotechnol. 2007, 25, 1159. [15] D. R. Getts, A. J. Martin, D. P. McCarthy, R. L. Terry, Z. N. Hunter, W. T. Yap, M. T. Getts, M. Pleiss, X. Luo, N. J. King, L. D. Shea, S. D. Miller, Nat. Biotechnol. 2012, 30, 1217. [16] D. R. Getts, R. L. Terry, M. T. Getts, C. Deffrasnes, M. Muller, C. van Vreden, T. M. Ashhurst, B. Chami, D. McCarthy, H. Wu, J. Ma, A. Martin, L. D. Shae, P. Witting, G. S. Kansas, J. Kuhn, W. Hafezi, I. L. Campbell, D. Reilly, J. Say, L. Brown, M. Y. White, S. J. Cordwell, S. J. Chadban, E. B. Thorp, S. Bao, S. D. Miller, N. J. King, Sci. Transl. Med. 2014, 6, 219ra7. [17] S. Kontos, I. C. Kourtis, K. Y. Dane, J. A. Hubbell, Proc. Natl. Acad. Sci. U.S.A. 2013, 110, E60. [18] L. H. Tostanoski, Y. C. Chiu, J. M. Gammon, T. Simon, J. I. Andorko, J. S. Bromberg, C. M. Jewell, Cell Rep. 2016, 16, 2940. [19] A. Louveau, I. Smirnov, T. J. Keyes, J. D. Eccles, S. J. Rouhani, J. D. Peske, N. C. Derecki, D. Castle, J. W. Mandell, K. S. Lee, T. H. Harris, J. Kipnis, Nature 2015, 523, 337. [20] A. Aspelund, S. Antila, S. T. Proulx, T. V. Karlsen, S. Karaman, M. Detmar, H. Wiig, K. Alitalo, J. Exp. Med. 2015, 212, 991. [21] C. E. Probst, P. Zrazhevskiy, V. Bagalkot, X. Gao, Adv. Drug. Deliv. Rev. 2013, 65, 703. [22] W. R. Algar, K. Susumu, J. B. Delehanty, I. L. Medintz, Anal. Chem. 2011, 83, 8826. [23] S. J. Rosenthal, J. C. Chang, O. Kovtun, J. R. McBride, I. D. Tomlinson, Chem. Biol. 2011, 18, 10. [24] B. K. Andrasfalvy, G. L. Galinanes, D. Huber, M. Barbic, J. J. Macklin, K. Susumu, J. B. Delehanty, A. L. Huston, J. K. Makara, I. L. Medintz, Nat. Methods 2014, 11, 1237. [25] J. B. Blanco-Canosa, M. Wu, K. Susumu, E. Petryayeva, T. L. Jennings, P. E. Dawson, W. R. Algar, I. L. Medintz, Coord. Chem. Rev. 2014, 263-264, 101. [26] K. Boeneman, J. B. Delehanty, J. B. Blanco-Canosa, K. Susumu, M. H. Stewart, E. Oh, A. L. Huston, G. Dawson, S. Ingale, R. Walters, M. Domowicz, J. R. Deschamps, W. R. Algar, S. DiMaggio, J. Manono, C. M. Spillmann, D. Thompson, T. L. Jennings, P. E. Dawson, I. L. Medintz, ACS Nano 2013, 7, 3778. [27] R. Agarwal, M. S. Domowicz, N. B. Schwartz, J. Henry, I. Medintz, J. B. Delehanty, M. H. Stewart, K. Susumu, A. L. Huston, J. R. Deschamps, P. E. Dawson, V. Palomo, G. Dawson, ACS Chem. Neurosci. 2015, 6, 494. [28] T. S. Hauck, R. E. Anderson, H. C. Fischer, S. Newbigging, W. C. Chan, Small 2010, 6, 138. [29] L. Ye, K. T. Yong, L. Liu, I. Roy, R. Hu, J. Zhu, H. Cai, W. C. Law, J. Liu, K. Wang, J. Liu, Y. Liu, Y. Hu, X. Zhang, M. T. Swihart, P. N. Prasad, Nat. Nanotechnol. 2012, 7, 453. [30] S. Kim, Y. T. Lim, E. G. Soltesz, A. M. De Grand, J. Lee, A. Nakayama, J. A. Parker, T. Mihaljevic, R. G. Laurence, D. M. Dor, L. H. Cohn, M. G. Bawendi, J. V. Frangioni, Nat. Biotechnol. 2004, 22, 93. [31] D. E. Prasuhn, J. R. Deschamps, K. Susumu, M. H. Stewart, K. Boeneman, J. B. Blanco-Canosa, P. E. Dawson, I. L. Medintz, Small 2010, 6, 555. [32] I. L. Medintz, A. R. Clapp, F. M. Brunel, T. Tiefenbrunn, H. Tetsuo Uyeda, E. L. Chang, J. R. Deschamps, P. E. Dawson, H. Mattoussi, Nat. Mater. 2006, 5, 581. [33] I. L. Medintz, J. H. Konnert, A. R. Clapp, I. Stanish, M. E. Twigg, H. Mattoussi, J. M. Mauro, J. R. Deschamps, Proc. Natl. Acad. Sci. U.S.A. 2004, 101, 9612. [34] W. R. Algar, A. Malonoski, J. R. Deschamps, J. B. Blanco-Canosa, K. Susumu, M. H. Stewart, B. J. Johnson, P. E. Dawson, I. L. Medintz, Nano Lett. 2012, 12, 3793. [35] W. R. Algar, M. G. Ancona, A. P. Malanoski, K. Susumu, I. L. Medintz, ACS Nano 2012, 6, 11044. [36] J. I. Andorko, K. L. Hess, C. M. Jewell, AAPSI 2015, 17, 323. [37] K. J. Warren, D. Iwami, D. G. Harris, J. S. Bromberg, B. E. Burrell, J. Clin. Invest. 2014, 124, 2204. [38] M. S. Arredouani, F. Franco, A. Imrich, A. Fedulov, X. Lu, D. Perkins, R. Soininen, K. Tryggvason, S. D. Shapiro, L. Kobzik, J. Immunol. 2007, 178, 5912. [39] T. Korn, J. Reddy, W. Gao, E. Bettelli, A. Awasthi, T. R. Petersen, B. T. Backstrom, R. A. Sobel, K. W. Wucherpfennig, T. B. Strom, M. Oukka, V. K. Kuchroo, Nat. Med. 2007, 13, 423. [40] S. L. Bailey, B. Schreiner, E. J. McMahon, S. D. Miller, Nat Immunol 2007, 8, 172. [41] K. Susumu, E. Oh, J. B. Delehanty, J. B. Blanco-Canosa, B. J. Johnson, V. Jain, W. J. Hervey, W. R. Algar, K. Boeneman, P. E. Dawson, I. L. Medintz, J. Am. Chem. Soc. 2011, 133, 9480. [42] K. E. Sapsford, D. Farrell, S. Sun, A. Rasooly, H. Mattoussi, I. L. Medintz, Sensors and Actuators B: Chemical 2009, 139, 13. [43] I. L. Medintz, A. R. Clapp, H. Mattoussi, E. R. Goldman, B. Fisher, J. M. Mauro, Nat. Mater. 2003, 2, 630. [44] K. Boeneman, J. R. Deschamps, S. Buckhout-White, D. E. Prasuhn, J. B. Blanco-Canosa, P. E. Dawson, M. H. Stewart, K. Susumu, E. R. Goldman, M. Ancona, I. L. Medintz, ACS Nano 2010, 4, 7253. [45] I. L. Medintz, T. Pons, K. Susumu, K. Boeneman, A. Dennis, D. Farrell, J. R. Deschamps, J. S. Melinger, G. Bao, H. Mattoussi, J. Phys. Chem. C Nanomater. Interfaces 2009, 113, 18552. [46] I. L. Medintz, K. E. Sapsford, A. R. Clapp, T. Pons, S. Higashiya, J. T. Welch, H. Mattoussi, J. Phys. Chem. B 2006, 110, 10683. [47] C. Breithaupt, A. Schubart, H. Zander, A. Skerra, R. Huber, C. Linington, U. Jacob, Proc. Natl. Acad. Sci. U.S.A. 2003, 100, 9446. [48] T. Pons, I. L. Medintz, X. Wang, D. S. English, H. Mattoussi, J. Am. Chem. Soc. 2006, 128, 15324.
(81) Although the present disclosure has been described with respect to one or more particular embodiments and/or examples, it will be understood that other embodiments and/or examples of the present disclosure may be made without departing from the scope of the present disclosure.