Protein, novel gene, expression vector, transformant, method for producing transformant, and method for screening for novel fluorescent protein
10900045 ยท 2021-01-26
Assignee
Inventors
- Ikuo Shiratori (Koto-ku, JP)
- Akihisa Shimizu (Koto-ku, JP)
- Katsunori Horii (Koto-ku, JP)
- Hiroshi Mishima (Koto-ku, JP)
- Iwao Waga (Koto-ku, JP)
Cpc classification
C12N15/8212
CHEMISTRY; METALLURGY
C12N5/10
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
C12N5/10
CHEMISTRY; METALLURGY
Abstract
The present invention provides a novel fluorescent protein. A novel protein includes the following protein (F1): (F1) a protein consisting of an amino acid sequence of SEQ ID NO: 1, wherein in the amino acid sequence of SEQ ID NO: 1, a 52nd amino acid Xaa.sub.52 is an arbitrary amino acid, a 133rd amino acid Xaa.sub.133 is an arbitrary amino acid, and a 154th amino acid Xaa.sub.154 is an arbitrary amino acid.
Claims
1. A novel protein including the following protein (F1) or (F3): (F1) a protein consisting of an amino acid sequence of SEQ ID NO: 1, wherein in the amino acid sequence of SEQ ID NO: 1, the Xaa.sub.52 is C, F, H, K, M, or T, the Xaa.sub.133 is L, Q, S, or T, and the Xaa.sub.154 is A, H, I, K, L, Q, V, or Y, and (F3) a protein comprising an amino acid sequence having at least 90% identity to the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 are preserved and having a fluorescence activity.
2. The novel protein according to claim 1, wherein the combination of the Xaa.52, the Xaa.sub.133, and the Xaa.sub.154 is one of the following combinations, the Xaa.sub.52 is T, the Xaa.sub.133 is S, and the Xaa.sub.154 is Y, the Xaa.sub.52 is H, the Xaa.sub.133 is T, and the Xaa.sub.154 is K, the Xaa.sub.52 is C, the Xaa.sub.133 is L, and the Xaa.sub.154 is L, the Xaa.sub.52 is C, the Xaa.sub.133 is S, and the Xaa.sub.154 is H, the Xaa.sub.52 is T, the Xaa.sub.133 is S, and the Xaa.sub.154 is H, the Xaa.sub.52 is M, the Xaa.sub.133 is L, and the Xaa.sub.154 is V, the Xaa.sub.52 is F, the Xaa.sub.133 is S, and the Xaa.sub.154 is Q, the Xaa.sub.52 is K, the Xaa.sub.133 is T, and the Xaa.sub.154 is A, the Xaa.sub.52 is C, the Xaa.sub.133 is Q, and the Xaa.sub.154 is L, the Xaa.sub.52 is T, the Xaa.sub.133 is T, and the Xaa.sub.154 is I, the Xaa.sub.52 is K, the Xaa.sub.133 is S, and the Xaa.sub.154 is Q, and the Xaa.sub.52 is M, the Xaa.sub.133 is L, and the Xaa.sub.154 is A.
3. The novel protein according to claim 1, wherein a 205th amino acid Xaa.sub.205 is substituted with I.
4. The novel protein according to claim 1, wherein a 198th amino acid Xaa.sub.198 is substituted with L.
5. The novel protein according to claim 1 wherein the protein (F1) is a protein consisting of at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 13, 34 to 66, and 67.
6. The novel protein according to claim 1, wherein the combination of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is one of the following combinations, the Xaa.sub.52 is T, the Xaa.sub.133 is S, and the Xaa.sub.154 is Y, the Xaa.sub.52 is H, the Xaa.sub.133 is T, and the Xaa.sub.154 is K, the Xaa.sub.52 is C, the Xaa.sub.133 is L, and the Xaa.sub.154 is L, the Xaa.sub.52 is C, the Xaa.sub.133 is S, and the Xaa.sub.154 is H, the Xaa.sub.52 is T, the Xaa.sub.133 is S, and the Xaa.sub.154 is H, the Xaa.sub.52 is M, the Xaa.sub.133 is L, and the Xaa.sub.154 is V, the Xaa.sub.52 is C, the Xaa.sub.133 is Q, and the Xaa.sub.154 is L, the Xaa.sub.52 is T, the Xaa.sub.133 is T, and the Xaa.sub.154 is I, and the Xaa.sub.52 is M, the Xaa.sub.133 is L, and the Xaa.sub.154 is A.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
DESCRIPTION OF EXEMPLARY EMBODIMENT
(12) <Novel Protein>
(13) The novel protein of the present invention is, as described above, at least one selected from the group consisting of the following proteins (F1) to (F3):
(14) (F1) a protein consisting of an amino acid sequence of SEQ ID NO: 1,
(15) in the amino acid sequence of SEQ ID NO: 1,
(16) the 52nd amino acid Xaa.sub.52 is an arbitrary amino acid,
(17) the 133rd amino acid Xaa.sub.133 is an arbitrary amino acid, and
(18) the 154th amino acid Xaa.sub.154 is an arbitrary amino acid;
(19) (F2) a protein having a fluorescence activity and consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in an amino acid sequence excluding the 52nd amino acid Xaa.sub.52, the 133rd amino acid Xaa.sub.133, and the 154th amino acid Xaa.sub.154 of the protein (F1); and
(F3) a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the amino acid sequence of the protein (F1) excluding the 52nd amino acid Xaa.sub.52, the 133rd amino acid Xaa.sub.133, and the 154th amino acid Xaa.sub.154,
(20) The inventors of the present invention conducted earnest studies and found out that, in a protein including the amino acid sequence of SEQ ID NO: 1, the 52nd amino acid, the 133rd amino acid, and the 154th amino acid related to the fluorescence activity of the protein. Specifically, it is estimated that the 52nd amino acid, the 133rd amino acid, and the 154th amino acid in the protein interact with the chromophore of the protein, for example.
(21) Thus, the novel protein of the present invention having the 52nd amino acid, the 133rd amino acid, and the 154th amino acid being arbitrary amino acids can adjust its fluorescence activity. For example, a protein that shows stronger fluorescence even with excitation light (e.g., ultraviolet (hereinafter, the same applies)) having a relatively low wavelength and a protein that shows stronger fluorescence under excitation with excitation light at the same intensity can be obtained. The above-described estimation, however, does not limit the present invention by any means.
(22) Hereinafter, the novel protein may be also called a novel fluorescent protein. The novel fluorescent protein is a protein newly produced by the inventors of the present invention. In the present invention, for example, the novel fluorescent protein may include one type of protein or two or more types of proteins (hereinafter, the same applies).
(23) The amino acid sequence of SEQ ID NO: 1 in the protein (F1) is as follows. In the following amino acid sequence, the first amino acid (X) of three boxed amino acids is an amino acid corresponding to the Xaa.sub.52, the second amino acid (X) of three boxed amino acids is an amino acid corresponding the Xaa.sub.133, and the third amino acid (X) of three boxed amino acids is an amino acid corresponding to the Xaa.sub.154. Moreover, in the following amino acid sequence, the first amino acid of two underlined amino acids is an amino acid corresponding to the Xaa.sub.198 and the second amino acid of two underlined amino acids is an amino acid corresponding to the Xaa.sub.205.
(24) TABLE-US-00001 Aminoacidsequenceof(F1) (SEQIDNO:1) MTTFKIESRIHGNLNGEKFELVGGGVGEEGRLEIEMKTKDKPLAFSPF
(25) In the protein (F1), the Xaa.sub.52 is an arbitrary amino acid. The arbitrary amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, is preferably C, F, H, K, M, or T, and is more preferably C, M, or T as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the protein (F1), the Xaa.sub.52 is more preferably H as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(26) In the protein (F1), the Xaa.sub.133 is an arbitrary amino acid. The arbitrary amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y and is preferably L, Q, S, or T. In the protein (F1), the Xaa.sub.133 is more preferably T as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(27) In the protein (F1), the Xaa.sub.154 is an arbitrary amino acid. The arbitrary amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, is preferably A, H, I, K, L, Q, V, or Y, and more preferably A, I, L, V, or Y as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the protein (F1), the Xaa.sub.154 is more preferably K as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(28) In the protein (F1), the combination of Xaa.sub.52, Xaa.sub.133, and Xaa.sub.154 is not limited to particular combinations, and can be, for example, as follows:
(29) Xaa.sub.52 is, for example, C, F, H, K, M, or T,
(30) Xaa.sub.133 is, for example, L, Q, S, or T, and
(31) Xaa.sub.154 is, for example, A, H, I, K, L, Q, V, or Y.
(32) In the protein (F1), the combination of Xaa.sub.52, Xaa.sub.133, and Xaa.sub.154 is preferably as follows, for example, as it shows stronger fluorescence even with excitation light having a relatively low wavelength:
(33) Xaa.sub.52 is, for example, C, M, or T,
(34) Xaa.sub.133 is, for example, L, Q, S, or T, and
(35) Xaa.sub.154 is, for example, A, I, L, V, or Y.
(36) In the description below, in the case where the protein (F1) includes the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 in such a combination, the protein (F1) is also referred to as protein (B1), and the proteins (F2) and (F3) are also referred to as proteins (B2) and (B3) when the protein (F1) is the protein (B1). Also in the description below, regarding the proteins (B2) and (B3), for example, reference can be made to the description as to the proteins (F2) and (F3) by replacing (F1) with (B1), (F2) with (B2), and (F3) with (B3), respectively.
(37) As a specific example, in the novel protein of the present invention, the combination of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is for example, one of the following combinations (aa1) to (aa12). In the novel protein of the present invention, the combination of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is preferably the combination (aa1), (aa3), (aa6), (aa9), (aa10), or (aa12) and is more preferably the combination (aa1) or (aa9), for example, as it shows stronger fluorescence even with excitation light having a relatively low wavelength. In the novel protein of the present invention, the combination of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is preferably the combination (aa2), for example, as it shows stronger fluorescence under excitation with excitation light at the same intensity. The novel protein of the present invention is a protein except for the protein in which the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 are H, S, and R, respectively, and the protein in which the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 are D, S, and R, respectively, for example.
(38) TABLE-US-00002 TABLE 1 Xaa.sub.52 Xaa.sub.133 Xaa.sub.154 (aa1) T S Y (aa2) H T K (aa3) C L L (aa4) C S H (aa5) T S H (aa6) M L V (aa7) F S Q (aa8) K T A (aa9) C Q L (aa10) T T I (aa11) K S Q (aa12) M L A
(39) In the novel protein of the present invention, the Xaa.sub.205 is preferably substituted with I as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the novel protein of the present invention, the Xaa.sub.198 is preferably substituted with L or H as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the novel protein, it is estimated that the 198th and the 205th amino acids interact with the chromophore of the protein, for example. Thus, it is estimated that, by conducting the above-described substitution of one of the 198th and the 205th amino acids, a protein that shows stronger fluorescence even with excitation light having a relatively low wavelength is obtained. The above-described estimation, however, does not limit the present invention by any means. In the novel protein of the present invention, the Xaa.sub.198 and the Xaa.sub.205 are more preferably L and I, respectively, or H and I, respectively, as it shows further stronger fluorescence even with excitation light having a relatively low wavelength, for example.
(40) The protein (F1) can be, for example, a protein consisting of at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 13, 34 to 67, for example. In the case where the protein (F1) is a protein consisting of at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 13 and 34 to 67, the protein (F1) is also referred to as one of proteins (F1-1) to (F1-46), the protein (F2) is also referred to as one of proteins (F2-1) to (F2-46), and the protein (F3) is also referred to as one of proteins (F3-1) to (F3-46).
(41) The protein (B1) can be a protein consisting of at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 4, 7, 10, 11, 13, and 34 to 67, for example. Regarding the protein (B1) consisting of at least one of the above-described amino acid sequences, reference can be made to the description as to the protein (F1) consisting of at least one of the above-described amino acid sequences.
(42) The amino acid sequences of SEQ ID NOs: 2 to 13 and 34 to 67 of the protein (F1) are as follows. The amino acid sequences of SEQ ID NOs: 2 to 13 respectively correspond to the combinations (aa1) to (aa12) of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 in the amino acid sequence of SEQ ID NO: 1. The amino acid sequences of SEQ ID NOs: 34 to 48 correspond to the combination (aa1) of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 in the amino acid sequence of SEQ ID NO: 1. The amino acid sequences of SEQ ID NOs: 49 to 67 correspond to the combination (aa9) of the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 in the amino acid sequence of SEQ ID NO: 1.
(43) TABLE-US-00003 Aminoacidsequenceof(F1-1) (SEQIDNO:2)
(44) It can be said that the protein (F2) is, for example, a protein having a fluorescence activity and consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 are preserved. In the protein (F2), one to several can be a range in which the protein (F2) has the fluorescence activity, for example. In the amino acid sequence of the protein (F2), one to several is, for example, 1 to 43, 1 to 33, 1 to 22, 1 to 11, 1 to 9, 1 to 7, 1 to 5, 1 to 3, 1, or 2. In the present invention, for example, the numerical range regarding the number of bases discloses all the positive integers falling within that range. That is, for example, the description 1 to 5 bases discloses all of 1, 2, 3, 4, and 5 bases (hereinafter, the same applies). When the Xaa.sub.205 is substituted with I in the protein (F1), the protein (F2) is preferably a protein in which the Xaa.sub.205 of the protein (F1) is preserved. In this case, the protein (F2) can be, for example, a protein having a fluorescence activity and consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, the Xaa.sub.154, and the Xaa.sub.205 are preserved. When the Xaa.sub.198 is substituted with L or H in the protein (F1), the protein (F2) is preferably a protein in which the Xaa.sub.198 of the protein (F1) is preserved. In this case, the protein (F2) can be, for example, a protein having a fluorescence activity and consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, the Xaa.sub.154, and the Xaa.sub.198 are preserved. When the Xaa.sub.198 and the Xaa.sub.205 are substituted with L and I or H and I, respectively in the protein (F1), the protein (F2) is preferably a protein in which the Xaa.sub.198 and the Xaa.sub.205 of the protein (F1) are preserved. In this case, the protein (F2) can be, for example, a protein having a fluorescence activity and consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, the Xaa.sub.154, the Xaa.sub.198, and the Xaa.sub.205 are preserved. Regarding the one to several, reference can be made to the above description.
(45) It can be said that the protein (F3) can be a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 are preserved. In the protein (F3), identity can be a range in which the protein (F3) has the fluorescence activity, for example. In the amino acid sequence of the protein (F3), identity is, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%. The identity can be calculated with analysis software such as BLAST or FASTA using default parameters, for example (hereinafter, the same applies). When the Xaa.sub.205 is substituted with I in the protein (F1), the protein (F3) is preferably a protein in which the Xaa.sub.205 of the protein (F1) is preserved. In this case, the protein (F3) can be, for example, a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, the Xaa.sub.154, and the Xaa.sub.205 are preserved. When the Xaa.sub.198 is substituted with L or H in the protein (F1), the protein (F3) is preferably a protein in which the Xaa.sub.198 of the protein (F1) is preserved. In this case, the protein (F3) can be, for example, a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, the Xaa.sub.154, and the Xaa.sub.198 are preserved. When the Xaa.sub.198 and the Xaa.sub.205 are substituted with L and I or H and I, respectively in the protein (F1), the protein (F3) is preferably a protein in which the Xaa.sub.198 and the Xaa.sub.205 of the protein (F1) are preserved. In this case, the protein (F3) can be, for example, a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the amino acid sequence of the protein (F1) in which the Xaa.sub.52, the Xaa.sub.133, the Xaa.sub.154, the Xaa.sub.198, and the Xaa.sub.205 are preserved. Regarding the identity, reference can be made to the above description.
(46) The novel fluorescent protein of the present invention has, for example, the chemical properties described below. The excitation wavelength, excitation maximum wavelength, fluorescence wavelength, and fluorescence maximum wavelength described below are, for example, chemical properties in the wavelength range from 350 to 650 nm.
(47) Excitation wavelength: 350 to 650 nm
(48) Excitation maximum wavelength: 386 to 514 nm
(49) Fluorescence wavelength: 350 to 650 nm
(50) Fluorescence maximum wavelength: 506 to 524 nm
(51) When the novel fluorescent protein of the present invention is one of the proteins (F1-1) to (F1-46), the proteins (F1-1) to (F1-46) have, for example, the following chemical properties. When there are two or more maximum values for the fluorescence intensity in the excitation wavelength or the fluorescence wavelength in the proteins (F1-1) to (F1-46), two or more numerical ranges of the excitation maximum wavelength and the fluorescence maximum wavelength are described.
(52) (F1-1)
(53) Excitation wavelength: 350 to 560 nm
(54) Excitation maximum wavelength: 396 to 404 nm
(55) Fluorescence wavelength: 350 to 650 nm
(56) Fluorescence maximum wavelength: 511 to 519 nm
(57) (F1-2)
(58) Excitation wavelength: 350 to 600 nm
(59) Excitation maximum wavelength: 501 to 509 nm
(60) Fluorescence wavelength: 350 to 650 nm
(61) Fluorescence maximum wavelength: 511 to 519 nm
(62) (F1-3)
(63) Excitation wavelength: 350 to 620 nm
(64) Excitation maximum wavelength: 396 to 404 nm, 506 to 514 nm
(65) Fluorescence wavelength: 350 to 650 nm
(66) Fluorescence maximum wavelength: 516 to 524 nm
(67) (F1-4)
(68) Excitation wavelength: 350 to 625 nm
(69) Excitation maximum wavelength: 496 to 504 nm
(70) Fluorescence wavelength: 350 to 650 nm
(71) Fluorescence maximum wavelength: 511 to 519 nm
(72) (F1-5)
(73) Excitation wavelength: 350 to 615 nm
(74) Excitation maximum wavelength: 501 to 509 nm
(75) Fluorescence wavelength: 350 to 650 nm
(76) Fluorescence maximum wavelength: 511 to 519 nm
(77) (F1-6)
(78) Excitation wavelength: 350 to 625 nm
(79) Excitation maximum wavelength: 391 to 399 nm, 506 to 514 nm
(80) Fluorescence wavelength: 350 to 650 nm
(81) Fluorescence maximum wavelength: 516 to 524 nm
(82) (F1-7)
(83) Excitation wavelength: 350 to 625 nm
(84) Excitation maximum wavelength: 476 to 484 nm
(85) Fluorescence wavelength: 350 to 650 nm
(86) Fluorescence maximum wavelength: 506 to 514 nm
(87) (F1-8)
(88) Excitation wavelength: 350 to 605 nm
(89) Excitation maximum wavelength: 496 to 504 nm
(90) Fluorescence wavelength: 350 to 650 nm
(91) Fluorescence maximum wavelength: 511 to 519 nm
(92) (F1-9)
(93) Excitation wavelength: 350 to 615 nm
(94) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(95) Fluorescence wavelength: 350 to 650 nm
(96) Fluorescence maximum wavelength: 511 to 519 nm
(97) (F1-10)
(98) Excitation wavelength: 350 to 590 nm
(99) Excitation maximum wavelength: 391 to 399 nm, 506 to 514 nm
(100) Fluorescence wavelength: 350 to 650 nm
(101) Fluorescence maximum wavelength: 516 to 524 nm
(102) (F1-11)
(103) Excitation wavelength: 350 to 575 nm
(104) Excitation maximum wavelength: 476 to 484 nm
(105) Fluorescence wavelength: 350 to 650 nm
(106) Fluorescence maximum wavelength: 506 to 514 nm
(107) (F1-12)
(108) Excitation wavelength: 350 to 595 nm
(109) Excitation maximum wavelength: 386 to 394 nm, 506 to 514 nm
(110) Fluorescence wavelength: 350 to 650 nm
(111) Fluorescence maximum wavelength: 516 to 524 nm
(112) (F1-13)
(113) Excitation wavelength: 350 to 650 nm
(114) Excitation maximum wavelength: 396 to 404 nm
(115) Fluorescence wavelength: 350 to 650 nm
(116) Fluorescence maximum wavelength: 511 to 519 nm
(117) (F1-14)
(118) Excitation wavelength: 350 to 650 nm
(119) Excitation maximum wavelength: 401 to 409 nm
(120) Fluorescence wavelength: 350 to 650 nm
(121) Fluorescence maximum wavelength: 511 to 519 nm
(122) (F1-15)
(123) Excitation wavelength: 350 to 650 nm
(124) Excitation maximum wavelength: 396 to 404 nm
(125) Fluorescence wavelength: 350 to 650 nm
(126) Fluorescence maximum wavelength: 511 to 519 nm
(127) (F1-16)
(128) Excitation wavelength: 350 to 650 nm
(129) Excitation maximum wavelength: 391 to 399 nm
(130) Fluorescence wavelength: 350 to 650 nm
(131) Fluorescence maximum wavelength: 511 to 519 nm
(132) (F1-17)
(133) Excitation wavelength: 350 to 650 nm
(134) Excitation maximum wavelength: 396 to 404 nm
(135) Fluorescence wavelength: 350 to 650 nm
(136) Fluorescence maximum wavelength: 511 to 519 nm
(137) (F1-18)
(138) Excitation wavelength: 350 to 650 nm
(139) Excitation maximum wavelength: 396 to 404 nm
(140) Fluorescence wavelength: 350 to 650 nm
(141) Fluorescence maximum wavelength: 511 to 519 nm
(142) (F1-19)
(143) Excitation wavelength: 350 to 650 nm
(144) Excitation maximum wavelength: 396 to 404 nm
(145) Fluorescence wavelength: 350 to 650 nm
(146) Fluorescence maximum wavelength: 511 to 519 nm
(147) (F1-20)
(148) Excitation wavelength: 350 to 650 nm
(149) Excitation maximum wavelength: 391 to 399 nm
(150) Fluorescence wavelength: 350 to 650 nm
(151) Fluorescence maximum wavelength: 511 to 519 nm
(152) (F1-21)
(153) Excitation wavelength: 350 to 650 nm
(154) Excitation maximum wavelength: 391 to 399 nm
(155) Fluorescence wavelength: 350 to 650 nm
(156) Fluorescence maximum wavelength: 511 to 519 nm
(157) (F1-22)
(158) Excitation wavelength: 350 to 650 nm
(159) Excitation maximum wavelength: 396 to 404 nm
(160) Fluorescence wavelength: 350 to 650 nm
(161) Fluorescence maximum wavelength: 511 to 519 nm
(162) (F1-23)
(163) Excitation wavelength: 350 to 650 nm
(164) Excitation maximum wavelength: 391 to 399 nm
(165) Fluorescence wavelength: 350 to 650 nm
(166) Fluorescence maximum wavelength: 511 to 519 nm
(167) (F1-24)
(168) Excitation wavelength: 350 to 645 nm
(169) Excitation maximum wavelength: 396 to 404 nm
(170) Fluorescence wavelength: 350 to 650 nm
(171) Fluorescence maximum wavelength: 511 to 519 nm
(172) (F1-25)
(173) Excitation wavelength: 350 to 580 nm
(174) Excitation maximum wavelength: 396 to 404 nm
(175) Fluorescence wavelength: 350 to 650 nm
(176) Fluorescence maximum wavelength: 511 to 519 nm
(177) (F1-26)
(178) Excitation wavelength: 350 to 560 nm
(179) Excitation maximum wavelength: 396 to 404 nm
(180) Fluorescence wavelength: 350 to 650 nm
(181) Fluorescence maximum wavelength: 511 to 519 nm
(182) (F1-27)
(183) Excitation wavelength: 350 to 650 nm
(184) Excitation maximum wavelength: 391 to 399 nm
(185) Fluorescence wavelength: 350 to 650 nm
(186) Fluorescence maximum wavelength: 511 to 519 nm
(187) (F1-28)
(188) Excitation wavelength: 350 to 650 nm
(189) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(190) Fluorescence wavelength: 350 to 650 nm
(191) Fluorescence maximum wavelength: 511 to 519 nm
(192) (F1-29)
(193) Excitation wavelength: 350 to 650 nm
(194) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(195) Fluorescence wavelength: 350 to 650 nm
(196) Fluorescence maximum wavelength: 511 to 519 nm
(197) (F1-30)
(198) Excitation wavelength: 350 to 650 nm
(199) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(200) Fluorescence wavelength: 350 to 650 nm
(201) Fluorescence maximum wavelength: 511 to 519 nm
(202) (F1-31)
(203) Excitation wavelength: 350 to 650 nm
(204) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(205) Fluorescence wavelength: 350 to 650 nm
(206) Fluorescence maximum wavelength: 511 to 519 nm
(207) (F1-32)
(208) Excitation wavelength: 350 to 650 nm
(209) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(210) Fluorescence wavelength: 350 to 650 nm
(211) Fluorescence maximum wavelength: 511 to 519 nm
(212) (F1-33)
(213) Excitation wavelength: 350 to 650 nm
(214) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(215) Fluorescence wavelength: 350 to 650 nm
(216) Fluorescence maximum wavelength: 511 to 519 nm
(217) (F1-34)
(218) Excitation wavelength: 350 to 650 nm
(219) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(220) Fluorescence wavelength: 350 to 650 nm
(221) Fluorescence maximum wavelength: 511 to 519 nm
(222) (F1-35)
(223) Excitation wavelength: 350 to 650 nm
(224) Excitation maximum wavelength: 406 to 414 nm, 496 to 504 nm
(225) Fluorescence wavelength: 350 to 650 nm
(226) Fluorescence maximum wavelength: 511 to 519 nm
(227) (F1-36)
(228) Excitation wavelength: 350 to 650 nm
(229) Excitation maximum wavelength: 401 to 409 nm, 501 to 509 nm
(230) Fluorescence wavelength: 350 to 650 nm
(231) Fluorescence maximum wavelength: 511 to 519 nm
(232) (F1-37)
(233) Excitation wavelength: 350 to 650 nm
(234) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(235) Fluorescence wavelength: 350 to 650 nm
(236) Fluorescence maximum wavelength: 511 to 519 nm
(237) (F1-38)
(238) Excitation wavelength: 350 to 650 nm
(239) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(240) Fluorescence wavelength: 350 to 650 nm
(241) Fluorescence maximum wavelength: 511 to 519 nm
(242) (F1-39)
(243) Excitation wavelength: 350 to 650 nm
(244) Excitation maximum wavelength: 416 to 424 nm, 496 to 504 nm
(245) Fluorescence wavelength: 350 to 650 nm
(246) Fluorescence maximum wavelength: 511 to 519 nm
(247) (F1-40)
(248) Excitation wavelength: 350 to 650 nm
(249) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(250) Fluorescence wavelength: 350 to 650 nm
(251) Fluorescence maximum wavelength: 511 to 519 nm
(252) (F1-41)
(253) Excitation wavelength: 350 to 650 nm
(254) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(255) Fluorescence wavelength: 350 to 650 nm
(256) Fluorescence maximum wavelength: 511 to 519 nm
(257) (F1-42)
(258) Excitation wavelength: 350 to 650 nm
(259) Excitation maximum wavelength: 416 to 424 nm, 496 to 504 nm
(260) Fluorescence wavelength: 350 to 650 nm
(261) Fluorescence maximum wavelength: 511 to 519 nm
(262) (F1-43)
(263) Excitation wavelength: 350 to 650 nm
(264) Excitation maximum wavelength: 421 to 429 nm, 501 to 509 nm
(265) Fluorescence wavelength: 350 to 650 nm
(266) Fluorescence maximum wavelength: 511 to 519 nm
(267) (F1-44)
(268) Excitation wavelength: 350 to 650 nm
(269) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(270) Fluorescence wavelength: 350 to 650 nm
(271) Fluorescence maximum wavelength: 511 to 519 nm
(272) (F1-45)
(273) Excitation wavelength: 350 to 650 nm
(274) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(275) Fluorescence wavelength: 350 to 650 nm
(276) Fluorescence maximum wavelength: 511 to 519 nm
(277) (F1-46)
(278) Excitation wavelength: 350 to 650 nm
(279) Excitation maximum wavelength: 401 to 409 nm, 496 to 504 nm
(280) Fluorescence wavelength: 350 to 650 nm
(281) Fluorescence maximum wavelength: 511 to 519 nm
(282) The methods for measuring the excitation wavelength, the excitation maximum wavelength, the fluorescence wavelength, and the fluorescence maximum wavelength are not limited to particular methods, and each wavelength can be measured according to JIS K0120, for example. For example, the excitation wavelength, the excitation maximum wavelength, the fluorescence wavelength, and the fluorescence maximum wavelength may be measured according to the methods described in Example 1.
(283) The novel fluorescent protein only requires a fluorescence activity. For example, the novel fluorescent protein may also have other activities besides the fluorescence activity.
(284) <Novel Gene>
(285) The novel gene of the present invention has at least one polynucleotide selected from the group consisting of the following (f1) to (f7) as described below:
(286) (f1) a polynucleotide consisting of a base sequence of SEQ ID NO: 14, wherein in the base sequence of SEQ ID NO: 14,
(287) a 154th base N.sub.154, a 155th base N.sub.155, and a 156th base N.sub.156 form a codon (hereinafter, also referred to as a N.sub.154N.sub.155N.sub.156 codon) encoding an arbitrary amino acid,
(288) a 397th base N.sub.397, a 398th base N.sub.398, and a 399th base N.sub.399 form a codon (hereinafter, also referred to as a N.sub.397N.sub.398N.sub.399 codon) encoding an arbitrary amino acid, and
(289) a 460th base N.sub.460, a 461st base N.sub.461, and a 462nd base N.sub.462 form a codon (hereinafter, also referred to as a N.sub.460N.sub.461N.sub.462 codon) encoding an arbitrary amino acid;
(290) (f2) a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence obtained by deletion, substitution, insertion, and/or addition of one to several bases in the base sequence of the polynucleotide (f1) excluding the 154th base N.sub.154, the 155th base N.sub.155, the 156th base N.sub.156, the 397th base N.sub.397, the 398th base N.sub.398, the 399th base N.sub.399, the 460th base N.sub.460, the 461st base N.sub.461, and the 462nd base N.sub.462;
(f3) a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence having at least 80% identity to the base sequence of the polynucleotide (f1) excluding the 154th base N.sub.154, the 155th base N.sub.155, the 156th base N.sub.156, the 397th base N.sub.397, the 398th base N.sub.398, the 399th base N.sub.399, the 460th base N.sub.460, the 461st base N.sub.461, and the 462nd base N.sub.462;
(f4) a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence complementary to a polynucleotide that hybridizes to a polynucleotide consisting of the base sequence of the polynucleotide (f1) under a stringent condition, wherein in the complementary sequence, the bases corresponding to the 154th base N.sub.154, the 155th base N.sub.155, the 156th base N.sub.156, the 397th base N.sub.397, the 398th base N.sub.398, the 399th base N.sub.399, the 460th base N.sub.460, the 461st base N.sub.461, and the 462nd base N.sub.462 of the polynucleotide (f1) are preserved;
(f5) a polynucleotide encoding a protein consisting of an amino acid sequence of SEQ ID NO: 1, wherein
in the amino acid sequence of SEQ ID NO: 1,
the 52nd amino acid Xaa.sub.52 is an arbitrary amino acid,
the 133rd amino acid Xaa.sub.133 is an arbitrary amino acid, and
the 154th amino acid Xaa.sub.154 is an arbitrary amino acid;
(f6) a polynucleotide encoding a protein having a fluorescence activity and consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in the amino acid sequence of the polynucleotide (f5) excluding the 52nd amino acid Xaa.sub.52, the 133rd amino acid Xaa.sub.133, and the 154th amino acid Xaa.sub.154; and
(f7) a polynucleotide encoding a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the base sequence of the polynucleotide (f5) excluding the 52nd amino acid Xaa.sub.52, the 133rd amino acid Xaa.sub.133, and the 154th amino acid Xaa.sub.154.
(291) Since the novel gene is a gene encoding the novel fluorescent protein of the present invention, hereinafter, it is also referred to as a novel fluorescent protein gene. The novel fluorescent protein gene may contain, for example, one type of polynucleotide or two or more types of polynucleotides (hereinafter, the same applies).
(292) The base sequence of SEQ ID NO: 14 of the polynucleotide (f1) is described below. In the base sequence described below, the first base sequence (NNN) of three boxed base sequences is a base sequence corresponding to the N.sub.154N.sub.155N.sub.156 codon, the second base sequence of three boxed base sequences is a base sequence corresponding to the N.sub.397N.sub.398N.sub.399 codon, and the third base sequence of three boxed base sequences is a base sequence corresponding to the N.sub.460N.sub.461N.sub.462 codon. In the base sequence described below, the first codon of two underlined codons is a codon corresponding to the 592nd base N.sub.592, the 593rd base N.sub.593, and the 594th base N.sub.594 and the second codon of two underlined codons is a codon corresponding to the 613rd base N.sub.613, the 614th base N.sub.614, and the 615th base N.sub.615.
(293) TABLE-US-00004 Polynucleotide(f1) (SEQIDNO:14) 5-ATGACAACCTTCAAAATCGAGTCCCGGATCCATGGCAACCTCAAC GGGGAGAAGTTCGAGTTGGTTGGAGGTGGAGTAGGTGAGGAGGGTCGC CTCGAGATTGAGATGAAGACTAAAGATAAACCACTGGCATTCTCTCCC
(294) In the polynucleotide (f1), the N.sub.154N.sub.155N.sub.156 codon is a codon encoding an arbitrary amino acid. The codon encoding an arbitrary amino acid is a codon encoding A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, is preferably a codon encoding C, F, H, K, M, or T, and is more preferably a codon encoding C, M, or T as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the polynucleotide (f1), the N.sub.154N.sub.155N.sub.156 codon is more preferably a codon encoding H as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(295) In the polynucleotide (f1), the N.sub.397N.sub.398N.sub.399 codon is a codon encoding an arbitrary amino acid. The codon encoding an arbitrary amino acid is a codon encoding A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y and is preferably a codon encoding L, Q, S, or T. In the polynucleotide (f1), the N.sub.397N.sub.398N.sub.399 codon is more preferably a codon encoding T as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(296) In the polynucleotide (f1), the N.sub.460N.sub.461N.sub.462 codon is a codon encoding an arbitrary amino acid. The codon encoding an arbitrary amino acid is a codon encoding A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, is preferably a codon encoding A, H, I, K, L, Q, V, or Y, and is more preferably a codon encoding A, I, L, V, or Y as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the polynucleotide (f1), the N.sub.460N.sub.461N.sub.462 codon is more preferably a codon encoding K as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(297) In the polynucleotide (f1), the combination of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is not limited to particular combinations, and is for example, as follows:
(298) the N.sub.154N.sub.155N.sub.156 codon is a codon encoding C, F, H, K, M, or T;
(299) the N.sub.397N.sub.398N.sub.399 codon is a codon encoding L, Q, S, or T; and
(300) the N.sub.460N.sub.461N.sub.462 codon is a codon encoding A, H, I, K, L, Q, V, or Y.
(301) In the polynucleotide (f1), the combination of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is preferably as follows, for example, as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence even with excitation light having a relatively low wavelength:
(302) the N.sub.154N.sub.155N.sub.156 codon is a codon encoding C, M, or T;
(303) the N.sub.397N.sub.398N.sub.399 codon is a codon encoding L, Q, S, or T; and
(304) the N.sub.460N.sub.461N.sub.462 codon is a codon encoding A, I, L, V, or Y.
(305) In the description below, in the case where the polynucleotide (f1) includes the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 in such a combination, the polynucleotide (f1) is also referred to as polynucleotide (b1), and the polynucleotides (f2) to (f4) are also referred to as polynucleotides (b2) to (b4) when the polynucleotide (f1) is the polynucleotide (b1). Also in the description below, regarding the polynucleotides (b2) to (b4), for example, reference can be made to the description as to the polynucleotides (f2) to (f4) by replacing (f1) with (b1), (f2) with (b2), (f3) with (b3), and (f4) with (b4), respectively.
(306) As a specific example, in the novel fluorescent protein gene of the present invention, the combination of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is, for example, the combination of codons encoding one of the following amino acid combinations (aa1) to (aa12). In the novel fluorescent protein gene of the present invention, the combination of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is preferably the combination of codons encoding the following amino acid combination (aa1), (aa3), (aa6), (aa9), (aa10), or (aa12) and is more preferably the combination of codons encoding the following amino acid combination (aa1) or (aa9), for example, as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence even with excitation light having a relatively low wavelength. Furthermore, in the novel fluorescent protein gene of the present invention, the combination of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is preferably the combination of codons encoding the following amino acid combination (aa2) as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence under excitation with excitation light at the same intensity, for example. The novel gene of the present invention excludes genes in which the combination of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is the combination of the codons encoding H, S, and R and the combination of the codons encoding D, S, and R, for example.
(307) TABLE-US-00005 TABLE 2 N.sub.154N.sub.155N.sub.156 N.sub.397N.sub.398N.sub.399 N.sub.460N.sub.461N.sub.462 (aa1) T S Y (aa2) H T K (aa3) C L L (aa4) C S H (aa5) T S H (aa6) M L V (aa7) F S Q (aa8) K T A (aa9) C Q L (aa10) T T I (aa11) K S Q (aa12) M L A
(308) In the novel fluorescent protein gene of the present invention, the combination of amino acids of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is, for example, one of the following combinations (n1) to (n18). In the novel fluorescent protein gene of the present invention, for example, the combination of amino acids of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is preferably one of the following combinations (n1), (n2), (n3), (n6), (n10), (n11), (n14), (n15), (n16), and (n18) as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence even with excitation light having a relatively low wavelength and is more preferably one of the following combinations (n1), (n2), (n3), (n14), and (n15) as the novel fluorescent protein encoded by the novel fluorescent protein gene shows further stronger fluorescence even with excitation light having a relatively low wavelength. In the novel fluorescent protein gene of the present invention, the combination of amino acids of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon is preferably the following combination (n4) or (n5) as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(309) TABLE-US-00006 TABLE3 N.sub.154N.sub.155N.sub.156 N.sub.397N.sub.398N.sub.399 N.sub.460N.sub.461N.sub.462 (n1) ACA TCT TAC (n2) ACC AGC TAT (n3) ACT AGT TAC (n4) CAC ACT AAG (n5) CAC ACA AAG (n6) TGC TTA CTT (n7) TGC AGC CAT (n8) TGT AGC CAC (n9) ACG AGC CAC (n10) ATG CTG GTA (n11) ATG CTC GTG (n12) AAA AGC CAA (n13) AAA ACT GCT (n14) TGT CAA CTT (n15) TGC CAA TTG (n16) ACT ACA ATT (n17) AAA AGC CAA (n18) ATG CTC GCC
(310) In the novel fluorescent protein gene of the present invention, the N.sub.613N.sub.614N.sub.615 codon is preferably substituted with a codon encoding I as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In this case, the codon encoding I is preferably ATA. Also in the novel fluorescent protein gene of the present invention, the N.sub.592N.sub.593N.sub.594 codon is preferably substituted with a codon encoding L or H as the novel fluorescent protein encoded by the novel fluorescent protein gene shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In this case, the codon encoding L is preferably CTC and the codon encoding H is preferably CAC. In the novel fluorescent protein gene of the present invention, the N.sub.592N.sub.593N.sub.594 codon and the N.sub.613N.sub.614N.sub.615 codon are preferably substituted with the combination of codons encoding L and I or the combination of codons encoding H and I as the novel fluorescent protein encoded by the novel fluorescent protein gene shows further stronger fluorescence even with excitation light having a relatively low wavelength, for example. In this case, the codons encoding L and I are preferably CTC and ATA, respectively, and the codons encoding H and I are CAC and ATA, respectively.
(311) The polynucleotide (f1) can be, for example, a polynucleotide consisting of at least one base sequence selected from the group consisting of SEQ ID NOs: 15 to 32, 68 to 100, and 101. In the case where the polynucleotide (f1) is a polynucleotide consisting of at least one base sequence selected from the group consisting of SEQ ID NOs: 15 to 32, and 68 to 101, the polynucleotide (f1) is also referred to as one of polynucleotides (f1-1) to (f1-52), the polynucleotide (f2) is also referred to as one of polynucleotides (f2-1) to (f2-52), the polynucleotides (f3) is also referred to as one of polynucleotides (f3-1) to (f3-52), the polynucleotide (f4) is also referred to as one of polynucleotides (f4-1) to (f4-52), the polynucleotide (f5) is also referred to as one of polynucleotides (f5-1) to (f5-52), the polynucleotide (f6) is also referred to as one of polynucleotides (f6-1) to (f6-52), and the polynucleotide (f7) is also referred to as one of polynucleotides (f7-1) to (f7-52).
(312) The polynucleotide (b1) can be a polynucleotide consisting of at least one base sequence selected from the group consisting of SEQ ID NOs: 15 to 17, 20, 24, 25, 28 to 30, 32, and 68 to 101, for example. Regarding the polynucleotide (b1) consisting of at least one of the above-described base sequences, reference can be made to the description as to the polynucleotide (f1) consisting of at least one of the above-described base sequences.
(313) The base sequences of SEQ ID NOs: 15 to 32 and 68 to 101 of the polynucleotide (f1) are as follows. The base sequences of SEQ ID NOs: 15 to 32 correspond to the cases where the combinations of amino acids of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon are the combinations (n1) to (n18), respectively, in the base sequence of SEQ ID NO: 14. Each of the polynucleotides (f1-1) to (f1-3) is a polynucleotide encoding the amino acid sequence of the protein (F1-1), each of the polynucleotides (f1-4) and (f1-5) is a polynucleotide encoding the amino acid sequence of the protein (F1-2), the polynucleotide (f1-6) is a polynucleotide encoding the amino acid sequence of the protein (F1-3), each of the polynucleotides (f1-7) and (f1-8) is a polynucleotide encoding the amino acid sequence of the protein (F1-4), the polynucleotide (f1-9) is a polynucleotide encoding the amino acid sequence of the protein (F1-5), each of the polynucleotides (f1-10) and (f1-11) is a polynucleotide encoding the amino acid sequence of the protein (F1-6), the polynucleotide (f1-12) is a polynucleotide encoding the amino acid sequence of the protein (F1-7), the polynucleotide (f1-13) is a polynucleotide encoding the amino acid sequence of the protein (F1-8), each of the polynucleotides (f1-14) and (f1-15) is a polynucleotide encoding the amino acid sequence of the protein (F1-9), the polynucleotide (f1-16) is a polynucleotide encoding the amino acid sequence of the protein (F1-10), the polynucleotide (f1-17) is a polynucleotide encoding the amino acid sequence of the protein (F1-11), and the polynucleotide (f1-18) is a polynucleotide encoding the amino acid sequence of the protein (F1-12). The base sequences of SEQ ID NOs: 68 to 82 correspond to the case where the combination of amino acids of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon corresponds to the combination (n3) in the base sequence of SEQ ID NO: 14. The polynucleotides (f1-19) to (f1-33) are polynucleotides encoding the amino acid sequences of the proteins (F1-13) to (F1-27), respectively. The base sequences of SEQ ID NOs: 83 to 101 correspond to the case where the combination of amino acids of the N.sub.154N.sub.155N.sub.156 codon, the N.sub.397N.sub.398N.sub.399 codon, and the N.sub.460N.sub.461N.sub.462 codon corresponds to the combination (n15) in the base sequence of SEQ ID NO: 14. The polynucleotides (f1-34) to (f1-52) are polynucleotides encoding the amino acid sequences of the proteins (F1-28) to (F1-46), respectively.
(314) TABLE-US-00007 Polynucleotide(f1-1) (SEQIDNO:15) 5-ATGACAACCTTCAAAATCGAGTCCCGGATCCATGGCAACCTCAACGG GGAGAAGTTCGAGTTGGTTGGAGGTGGAGTAGGTGAGGAGGGTCGCCTCG AGATTGAGATGAAGACTAAAGATAAACCACTGGCATTCTCTCCCTTCCTG
(315) It can be said that the polynucleotide (f2) is, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence obtained by deletion, substitution, insertion, and/or addition of one to several bases in the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, and the N.sub.462 are preserved. In the polynucleotide (f2), one to several can be a range in which a protein encoded by the polynucleotide (f2) has a fluorescence activity, for example. In the polynucleotide (f2), one to several can be, for example, 1 to 132, 1 to 99, 1 to 66, 1 to 33, 1 to 26, 1 to 20, 1 to 13, 1 to 7, 1, 2, 3, or 4. When the N.sub.613N.sub.614N.sub.615 codon is substituted with a codon encoding I in the polynucleotide (f1), the polynucleotide (f2) is preferably a polynucleotide in which the N.sub.613, the N.sub.614, and the N.sub.615 of the polynucleotide (f1) are preserved. In this case, the polynucleotide (f2) is, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence obtained by deletion, substitution, insertion, and/or addition of one to several bases in the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.613, the N.sub.614, and the N.sub.615 are preserved. When the N.sub.592N.sub.593N.sub.594 codon is substituted with a codon encoding L or H in the polynucleotide (f1), the polynucleotide (f2) is preferably a polynucleotide in which the N.sub.592, the N.sub.593, and the N.sub.594 of the polynucleotide (f1) are preserved. In this case, the polynucleotide (f2) can be, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence obtained by deletion, substitution, insertion, and/or addition of one to several bases in the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.592, the N.sub.593, and the N.sub.594 are preserved. When the combination of the N.sub.592N.sub.593N.sub.594 codon and the N.sub.613N.sub.614N.sub.615 codon is substituted with the combination of codons encoding L and I or the combination of codons encoding H and I, respectively, in the polynucleotide (f1), the polynucleotide (f2) is preferably a polynucleotide in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.592, the N.sub.593, the N.sub.594, the N.sub.613, the N.sub.614, and the N.sub.615 of the polynucleotide (f1) are preserved. In this case, the polynucleotide (f2) is, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence obtained by deletion, substitution, insertion, and/or addition of one to several bases in the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.592, the N.sub.593, the N.sub.594, the N.sub.613, the N.sub.614, and the N.sub.615 are preserved. Regarding the one to several, reference can be made to the above description.
(316) It can be said that the polynucleotide (f3) is, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence having at least 80% identity to the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, and the N.sub.462 are preserved. In the polynucleotide (f3), identity can be a range in which a protein encoded by the polynucleotide (f3) has a fluorescence activity, for example. In the polynucleotide (f3), identity is, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%. When the N.sub.613N.sub.614N.sub.615 codon is substituted with a codon encoding I in the polynucleotide (f1), the polynucleotide (f3) is preferably a polynucleotide in which the N.sub.613, the N.sub.614, and the N.sub.615 of the polynucleotide (f1) are preserved. In this case, the polynucleotide (f3) can be, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence having at least 80% identity to the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.613, the N.sub.614, and the N.sub.615 are preserved. When the N.sub.592N.sub.593N.sub.594 codon is substituted with a codon encoding L or H in the polynucleotide (f1), the polynucleotide (f3) is preferably a polynucleotide in which the N.sub.592, the N.sub.593, and the N.sub.594 of the polynucleotide (f1) are preserved. In this case, the polynucleotide (f3) is, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence having at least 80% identity to the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.592, the N.sub.593, and the N.sub.594 are preserved. When the combination of the N.sub.592N.sub.593N.sub.594 codon and the N.sub.613N.sub.614N.sub.615 codon is substituted with the combination of codons encoding L and I or the combination of codons encoding H and I, respectively, in the polynucleotide (f1), the polynucleotide (f3) is preferably a polynucleotide in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.592, the N.sub.593, the N.sub.594, the N.sub.613, the N.sub.614, and the N.sub.615 of the polynucleotide (f1) are preserved. In this case, the polynucleotide (f3) is, for example, a polynucleotide encoding a protein having a fluorescence activity and consisting of a base sequence having at least 80% identity to the base sequence of the polynucleotide (f1) in which the N.sub.154, the N.sub.155, the N.sub.156, the N.sub.397, the N.sub.398, the N.sub.399, the N.sub.460, the N.sub.461, the N.sub.462, the N.sub.592, the N.sub.593, the N.sub.594, the N.sub.613, the N.sub.614, and the N.sub.615 are preserved. Regarding the identity, reference can be made to the above description.
(317) In the polynucleotide (f4), the polynucleotide that hybridizes to a polynucleotide is, for example, a polynucleotide completely or partially complementary to the polynucleotide (f1). The hybridization can be detected, for example, by various hybridization assays. The hybridization assay is not limited to particular assays, and can be, for example, the method described in Sambrook et al. Molecular Cloning: A Laboratory Manual 2nd Ed. [Cold Spring Harbor Laboratory Press (1989)].
(318) In the polynucleotide (f4), the stringent condition can be any of a low stringent condition, a middle stringent condition, and a high stringent condition, for example. The low stringent condition refers to, for example, a condition in which 5SSC, 5Denhardt's solution, 0.5% SDS, and 50% formamide are used at 32 C. The middle stringent condition refers to, for example, a condition in which 5SSC, 5Denhardt's solution, 0.5% SDS, and 50% formamide are used at 42 C. The high stringent condition refers to, for example, a condition in which 5SSC, 5Denhardt's solution, 0.5% SDS, and 50% formamide are used at 50 C. Those skilled in the art can adjust the degree of the stringency, for example, by appropriately selecting the conditions such as a temperature, a salt concentration, the concentration and the length of a probe, an ionic strength, time, and the like. The stringent condition can be, for example, the condition described in Sambrook et al. Molecular Cloning: A Laboratory Manual 2nd Ed. [Cold Spring Harbor Laboratory Press (1989)].
(319) The base sequence of the polynucleotide (f5) can be any base sequence as long as a protein encoded by the polynucleotide (f5) has a fluorescence activity, for example. The base sequence of the polynucleotide (f5) can be designed, for example, by substituting the codon(s) with a corresponding codon(s) based on the amino acid sequence of SEQ ID NO: 1 and the amino acids Xaa.sub.52, Xaa.sub.133, and Xaa.sub.154. It can be said that the protein encoded by the polynucleotide (f5) is, for example, the protein (F1) described in the description as to the novel protein of the present invention, and the reference can be made as to the description.
(320) When the combination of the amino acids Xaa.sub.52, Xaa.sub.133, and Xaa.sub.154 of the protein encoded by the polynucleotide (f5) i.e., the protein (F1) is the combination of the amino acids Xaa.sub.52, Xaa.sub.133, and Xaa.sub.154 of the protein (B1), the polynucleotide (f5) is also referred to as a polynucleotide (b5), and the polynucleotides (f6) and (f7) are also referred to as polynucleotides (b6) and (b7) when the polynucleotide (f5) is the polynucleotide (b5). Also in the description below, regarding the polynucleotides (b6) and (b7), for example, reference can be made to the description as to the polynucleotides (f6) and (f7) by replacing (f6) with (b6), (f7) with (b7), (F2) with (B2), and (F3) with (B3), respectively.
(321) In the polynucleotide (f6), one to several can be a range in which a protein encoded by the polynucleotide (f6) has a fluorescence activity, for example. In the polynucleotide (f6), one to several can be, for example, 1 to 43, 1 to 33, 1 to 22, 1 to 11, 1 to 9, 1 to 7, 1 to 5, 1 to 3, 1, or 2. The protein encoded by the polynucleotide (f6) can be, for example, the protein (F2) described in the description as to the novel protein of the present invention, and the reference can be made as to the description.
(322) In the polynucleotide (f7), identity can be a range in which a protein encoded by the polynucleotide (f7) has a fluorescence activity, for example. In the polynucleotide (f7), identity is, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%. The protein encoded by the polynucleotide (f7) can be, for example, the protein (F3) described in the description as to the novel protein of the present invention, and the reference can be made as to the description.
(323) In the present invention, the above-described polynucleotides can be produced, for example, by a publicly known genetic engineering method or synthesis method.
(324) <Expression Vector of Novel Protein>
(325) The expression vector of the present invention includes the novel gene of the present invention as described above. According to the expression vector of the present invention, for example, by transfecting the expression vector to the host, the novel protein of the present invention can be produced readily. Regarding the expression vector of the present invention, reference can be made to the description as to the novel gene of the present invention, for example.
(326) The expression vector can be any vector as long as it functionally includes the polynucleotide such that a novel protein encoded by the polynucleotide which is the novel gene of the present invention can be expressed, for example, and the other configurations are by no means limited.
(327) The expression vector can be produced by inserting the polynucleotide into a vector serving as a skeleton (hereinafter, also referred to as a basic vector), for example. The type of the vector is not limited to particular types and can be determined appropriately according to the type of the host, for example. The vector can be a viral vector or a non-viral vector. The vector is preferably a binary vector, for example. For the transformation of a plant, the vector is preferably a T-DNA binary vector. For the transformation of a plant by the method using Agrobacterium, the vector can be, for example, a pBI121 vector, a pPZP202 vector, a pBINPLUS vector, a pBIN19 vector, a pBIG2113N vector, a pBIG2113SF vector, a pRI101DNA vector (products of TAKARA BIO INC.), a pRI201DNA vector (product of TAKARA BIO INC.), a pRI909DNA vector (product of TAKARA BIO INC.), and a pRI910DNA vector (product of TAKARA BIO INC.). For the transformation of microorganisms such as Escherichia coli, the vector can be, for example, a pETDuet-1 vector (product of Novagen), a pQE-80L vector (product of QIAGEN), a pBluescript II SK vector, a pET101/D-TOPO vector (product of Invitrogen Corporation), a pGEX-6P-1 vector (product of Amersham Biosciences), a pcDNA3.2/V5-GW/D-TOPO vector (product of Invitrogen Corporation), a pEGFP vector, and a pcDNA3.1-hygro () vector (product of Invitrogen Corporation).
(328) The expression vector preferably includes a regulatory sequence for regulating the expression of the polynucleotide and the expression of the novel protein of the present invention encoded by the polynucleotide, for example. The regulatory sequence can be, for example, a promoter, a terminator, an enhancer, a polyadenylation signal sequence, and an origin of replication sequence (ori). In the expression vector, the position of the regulatory sequence is not particularly limited. The regulatory sequence can be placed at any position in the expression vector as long as it functionally regulates the expression of the polynucleotide and the expression of the novel protein encoded by the polynucleotide. The regulatory sequence can be placed according to the publicly known method, for example. For example, a sequence preliminarily contained in the basic vector may be used as the regulatory sequence, the regulatory sequence may be inserted into the basic vector, or a regulatory sequence contained in the basic vector may be substituted with another regulatory sequence.
(329) The expression vector may further include a coding sequence of a selection marker, for example. The selection marker can be, for example, a pharmaceutical composition-resistant marker, a fluorescent protein marker, an enzyme marker, and a cell surface receptor marker.
(330) <Production Method of Novel Protein>
(331) The production method of the novel protein of the present invention is not limited to particular methods, and can be, for example, a publicly known genetic engineering method, synthesis method, and the like. In the former case, the production method of the present invention includes a step of expressing the novel gene of the present invention. Thereby, the production method of the novel protein of the present invention can produce the novel fluorescent protein of the present invention readily.
(332) The expression of the polynucleotide which is the novel gene of the present invention can be performed using the expression vector of the present invention, for example.
(333) The method for expressing the polynucleotide is not limited to particular methods and can be a publicly known method. For example, a cell-free protein synthesizing system, a host, and the like can be used for the expression.
(334) In the former case, preferably, the polynucleotide is expressed in the cell-free protein synthesizing system. In this case, an expression vector may be used for the expression of the polynucleotide. The cell-free protein synthesizing system can be performed, for example, by a publicly known method using a cell extract, a buffer including various components, and an expression vector to which an intended polynucleotide has been transfected. For example, a commercially available reagent kit can be used.
(335) In the latter case, preferably, a host to which the polynucleotide has been transfected is used and the polynucleotide is expressed in the host by culturing the host, for example. For example, a transformant that synthesizes the novel protein of the present invention can be produced by transfecting the polynucleotide to the host, and the novel protein of the present invention can be synthesized by culturing the transformant.
(336) Examples of the host include nonhuman hosts such as microorganisms, plants, animals, insects, and the cultured cells thereof; isolated human cells; and the cultured cells thereof. Among them, plants are preferable. When the host is a plant, the plant can be, for example, a planta or a part of the planta. Examples of the part of planta include organs, tissues, cells, and propagules. Examples of the organ include petals, corollas, flowers, leaves, seeds, fruits, stems, and roots. The tissue can be, for example, a part of the organ. The cell can be, for example, the planta or a cell collected from the tissue of the planta, a cultured cell of the cell collected from the tissue of the planta, protoplast, and callus. The origin of the plant is not limited to particular origins and can be, for example, Brassicaceae, Solanaceae, Poaceae, Fabaceae, Rosaceae, Caryophyllaceae, Asteraceae, Gentianaceae, Scrophulariaceae, Verbenaceae, Primulaceae, Cactaceae, Orchidaceae, and the like. The Brassicaceae can be, for example, Arabidopsis such as Arabidopsis thaliana and the like. The Solanaceae can be, for example, Nicotiana such as Nicotiana tabacum and the like; Petunia such as Petuniahybrid and the like; Nierembergia such as Nierembergia hippoamanica and the like; Calibrachoa such as Calibrachoa hybrid Cultivar and the like; and the like. The Poaceae can be, for example, Zea such as Zea mays and the like; Oryza such as Oryza sativa and the like; and the like. The Fabaceae can be, for example, Glycine such as Glycine max and the like. The Rosaceae can be, for example, Rosa such as Rosa and the like. The Caryophyllaceae can be, for example, Dianthus such as Dianthus caryophyllus and the like. The Asteraceae can be, for example, Chrysanthemum such as Chrysanthemum morifolium and the like; Gerbera such as Gerbera cvs. and the like; and the like. The Gentianaceae can be, for example, Eustoma such as Eustoma grandiflorum and the like. The Scrophulariaceae can be, for example, Torenia such as Torenia fournieri and the like. The Verbenaceae can be, for example, Verbena such as Garden verbena and the like. The Primulaceae can be, for example, Cyclamen such as Cyclamen persicum and the like. Examples of the Cactaceae include Austrocylindropuntia, Astrophytum, Echinocactus, Echinocereus, Echinopsis, Epiphyllum, Opuntia, Schlumbergera russeliana, Chamaecereus, Cylindropuntia, Gymnocalycium, Schlumbergera truncata, Selenicereus, Tephrocactus, Neobuxbaumia, Neoraimondia, Nopalea, Ferocactus, Mammillaria, Melocactus, Rhipsalis, Roseocactus, and Lophophora. Examples of the Orchidaceae include Phalaenopsis such as Phalaenopsis cvs. and the like; Cymbidium such as Cymbidium cvs. and the like; Dendrobium such as Dendrobium nobile hybrids, D. phalaenopsis hybrids, and the like; Oncidium such as Oncidium cvs. and the like; and Cattleya such as Cattleya cvs. and the like. Examples of the microorganisms include eukaryote and prokaryote. The prokaryote can be, for example, bacteria including Escherichia such as Escherichia coli and the like; Pseudomonas such as Pseudomonas putida and the like. The eukaryote can be, for example, yeast such as Saccharomyces cerevisiae and the like. Examples of the animal cell include a COS cell and a CHO cell. Examples of the insect cell include Sf9 and Sf21.
(337) The method for transfecting the polynucleotide to the host i.e., the method for the transformation of the host is not limited to particular methods, and can be, for example, a method using the expression vector or a publicly known method without using the expression vector. In the latter case, the transfection method can be determined appropriately according to the type of the host, for example. Examples of the transfection method include a heat shock method, a lithium acetate method, a method using a gene gun such as a particle gun, a calcium phosphate method, a polyethylene glycol method, a lipofection method using liposome, an electroporation method, an ultrasonic nucleic acid transfection method, a DEAE-dextran method, a direct transfection method using a microglass tube, a hydrodynamic method, a cationic liposome method, a method using a transfection adjuvant, and a method through Agrobacterium. The liposome cab be, for example, Lipofectamine and cationic liposome, and the transfection adjuvant can be, for example, atelocollagen, nanoparticle, and polymer. When the host is a plant, the transfection method is preferably a method through Agrobacterium. The polynucleotide which is the novel gene of the present invention may be transfected to the host by the expression vector of the present invention, for example.
(338) The method for culturing the host is not limited to particular methods and can be determined appropriately according to the type of the host. The culture medium used for culturing the host is not limited to particular media and can be determined appropriately according to the type of the host.
(339) The form of the culture medium used for culturing the host is not limited to particular forms and can be, for example, a publicly known culture medium such as a solid culture medium, a liquid culture medium, an agar culture medium, or the like. The component contained in the culture medium are not limited to particular components. The culture medium may contain a commercially available culture medium, for example. When the host is a plant, a commercially available culture medium of the plant is not limited to particular media and can be, for example, a Murashige-Skoog (MS) culture medium and the like. When the host is a plant cell, a commercially available culture medium of the plant cell is not limited to particular media and can be, for example, a hyponex culture medium, an MS culture medium, a Gamborg B5 (B5) culture medium, a White culture medium, and the like. When the host is microorganisms, a commercially available culture medium of microorganisms is not limited to particular media and can be, for example, an LB culture medium, a Super Broth culture medium, an M9 culture medium, and the like. One of the culture media can be used alone of two or more of them may be used in combination, for example. The pH of the culture medium is not particularly limited and is, for example, in the range from pH6 to pH 8 or from pH6.5 to pH 7.5.
(340) The method for culturing the host is not limited to particular methods and can be determined appropriately according to the type of the host, for example. When the host is a plant, the method for culturing can be, for example, the soil cultivation of a plant, the hydroponics of a plant, and the like. When the plant is a plant cell, the method for culturing can be, for example, a callus culture, a root culture, an ovule culture, an embryo culture, and the like.
(341) The culture temperature of the host is not particularly limited and can be determined appropriately according to the type of the host, for example. When the host is a plant, the culture temperature can be, for example, a viable temperature of a plant, an optimal growth temperature of a plant, and the like. Specifically, the culture temperature is, for example, in the range from 15 C. to 40 C. or in the range from 30 C. to 37 C. When the host is a plant cell, the culture temperature can be, for example, a viable temperature of a plant cell, an optimal growth temperature of a plant cell, and the like. Specifically, the culture temperature is, for example, in the range from 15 C. to 40 C. or in the range from 30 C. to 37 C.
(342) The host may be cultured under an aerobic condition or an anaerobic condition, for example. The aerobic condition and the anaerobic condition are not limited to particular conditions, and can be determined using a conventionally known method.
(343) <Transformant>
(344) The transformant of the present invention includes the novel gene of the present invention as described above. The transformant of the present invention is characterized in that it includes the novel gene of the present invention, and other configurations and conditions are by no means limited. The transformant of the present invention including the novel gene of the present invention has a fluorescence activity owing to the novel gene, for example. Regarding the transformant of the present invention, for example, reference can be made to the description as to the novel protein of the present invention and the like.
(345) In the present invention, the transformant is not particularly limited and can be an animal, a plant, and the like. Among them, a plant is preferable. When the transformant is an animal, the transformant can be, for example, a cancer cell such as a human colon cancer cell. When the transformant is a plant, the plant and the origin of the plant are not particularly limited, and reference can be made to the above description, for example. Specifically, the plant can be, for example, a planta or a part of the planta. Examples of the part of planta include organs, tissues, cells, and propagules. Examples of the organ include petals, corollas, flowers, leaves, seeds, fruits, stems, and roots. The tissue can be, for example, a part of the organ. The cell can be, for example, the planta or a cell collected from the tissue of the planta, a cultured cell of the cell collected from the tissue of the planta, protoplast, and callus.
(346) In the present invention, when the transformant is a plant, the transformant of the present invention can further be propagated, for example. On this occasion, the transformant of the present invention can be used as a propagation material. The propagation material is not particularly limited and can be, for example, the whole or a part of the transformant. When the transformant is the planta or a part of the planta, the propagation material can be, for example, a seed, a fruit, a shoot, a stem such as a tuber, a root such as a tuberous root, a strain, a protoplast, a callus, and the like.
(347) The method for propagating the transformant of the present invention is not limited to particular methods and can be a publicly known method. The propagation method can be, for example, a sexual reproduction or an asexual reproduction, and the asexual reproduction is preferable. The asexual reproduction can be, for example, a vegetative propagation, which is also called a vegetative reproduction. The vegetative propagation is not limited to particular methods. When the transformant is a planta or a part of the planta, the vegetative propagation can be, for example, propagation by cutting bud or tree, fragmentation from an organ to plant individuals, growth by a callus, and the like. As the organ, for example, the leaves, stems, and roots described above can be used.
(348) The propagule obtained by propagating the transformant vegetatively is referred to as the propagule of the present invention hereinbelow. The propagule of the present invention preferably has the same properties as the transformant of the present invention. As in the transformant, the propagule of the present invention is not particularly limited and can be, for example, a planta or a part of the planta.
(349) When the transformant is sexually reproduced, for example, a seed, a descendant such as a growing material grown from the seed can be obtained. The descendant of the present invention preferably has the same properties as the transformant of the present invention. As in the transformant, the descendant of the present invention can be, for example, a planta or a part of the planta.
(350) The transformant of the present invention may further be processed, for example. The type of the transformant to be processed is not limited to particular types and can be, for example, a flower, a leaf, a branch, and the like. The processed product of the transformant is not limited to particular products and can be, for example, a potpourri made by drying a flower, a leaf, a branch, or the like; a pressed flower; a dried flower; a preserved flower; a resin sealed product; and the like. The processed product of the present invention can be, for example, a processed product of the propagule, organ, tissue, or cell of the transformant.
(351) <Production Method of Transformant>
(352) The method for producing a transformant of the present invention includes a step of transfecting the novel gene according to the present invention to a host as described above. The production method of the transformant of the present invention is characterized in that it includes a step of transfecting the novel gene according to the present invention to a host, and other steps and conditions are by no means limited. According to the production method of the transformant of the present invention, for example, the transformant of the present invention can be produced readily.
(353) The method for producing a transformant of the present invention may further include a step of expressing the novel gene in the host.
(354) In the transfection step, the method for transfecting the novel gene of the present invention to the host is not limited to particular methods, and reference can be made to the description as to the method for transfecting the polynucleotide to host in the production method of the novel protein of the pre sent invention, for example. In the production method of the transformant of the present invention, the host is preferably a plant.
(355) The expression step is a step of expressing the novel protein of the present invention from the novel gene of the present invention in the host, for example. In the expression step, for example, the host is preferably a transformant to which the novel gene or expression vector of the present invention has transfected and the novel protein of the present invention is preferably expressed in the host by culturing the transformant.
(356) When the host is a plant, the method for producing a transformant of the present invention may further include a step of propagating the transformant obtained in the transfection step. Regarding the propagation method in the propagation step, for example, reference can be made to the above description. The method for producing a transformant of the present invention may further include a step of producing a seed from the propagated transformant and a step of growing a growing material from the seed obtained in the seed production step.
(357) <Screening Method of Novel Fluorescent Protein>
(358) The method for screening the novel fluorescent protein of the present invention (hereinafter, also referred to as the screening method of the present invention.) is characterized in that it includes a step of selecting a protein having a fluorescence activity in which each of an amino acid corresponding to the 52nd amino acid Xaa.sub.52, an amino acid corresponding to the 133rd amino acid Xaa.sub.133, and an amino acid corresponding to the 154th amino acid Xaa.sub.154 in the amino acid sequence of SEQ ID NO: 1 is an arbitrary amino acid from a candidate protein obtained by introducing a mutation to the novel protein according to the present invention as described above, and other steps and conditions are by no means limited. According to the screening method of the present invention, for example, a protein having a fluorescence activity can be screened easily. Regarding the screening method of the present invention, for example, reference can be made to the description as to the novel protein, novel gene, expression vector, production method, and the like of the present invention.
(359) The candidate protein is a protein obtained by introducing a mutation to the novel protein of the present invention. The type of the mutation to be introduced to the novel protein is not limited to particular types and can be, for example, deletion, substitution, insertion, and/or addition of an amino acid(s). As a specific example, the candidate protein can be, for example, a protein consisting of an amino acid sequence obtained by deletion, substitution, insertion, and/or addition of one to several amino acids in the amino acid sequence of the novel protein or a protein consisting of an amino acid sequence having at least 80% identity to the amino acid sequence of the novel protein.
(360) In the amino acid sequence of the candidate protein, one to several is, for example, 1 to 43, 1 to 33, 1 to 22, 1 to 11, 1 to 9, 1 to 7, 1 to 5, 1 to 3, 1, or 2.
(361) In the amino acid sequence of the candidate protein, identity is, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%.
(362) The candidate protein can be produced by a publicly known protein synthesis method or genetic engineering method based on the amino acid sequence of the candidate protein. In the latter case, the screening method of the present invention includes, for example, a step of introducing a mutation to a base sequence encoding the novel protein i.e., the novel gene of the present invention to produce a mutation polynucleotide and a step of expressing the candidate protein from the mutation polynucleotide.
(363) In the mutation step, the mutation to be introduced to the novel gene is not limited to particular mutations and can be, for example, deletion, substitution, insertion, and/or addition of a base. The method for introducing a mutation to the novel gene is not limited to particular methods and can be, for example, a publicly known method for introducing a mutation to a polynucleotide. As a specific example, the method for introducing a mutation can be a method of reconstructing a gene (so called DNA shuffling) by the random fragmentation and the recombination using PCR of the polynucleotide of the novel gene of the present invention.
(364) In the expression step, the method for expressing the mutation polynucleotide is not limited to particular methods. Regarding the method for expressing the mutation polynucleotide, for example, reference can be made to the description as to the production method of the novel protein of the present invention, and either a cell-free protein synthesizing system or a host may be used. As the host, for example, prokaryote, especially, Escherichia coli is preferably used.
(365) The screening method of the present invention may include a step of purifying the candidate protein obtained in the expression step, for example. The purification method is not limited to particular methods and examples thereof include salting out and various kinds of column chromatography. The solvent to be used in the purification step is not limited to particular solvents and can be, for example, a buffer solution. In the screening method of the present invention, for example, the candidate protein obtained in the expression step may be used directly in the selection step described below or a partially purified candidate protein or a singly purified candidate protein may be used.
(366) The selection step is a step of selecting a protein having a fluorescence activity in which each of an amino acid corresponding to the 52nd amino acid Xaa.sub.52, an amino acid corresponding to the 133rd amino acid Xaa.sub.133, and an amino acid corresponding to the 154th amino acid Xaa.sub.154 in the amino acid sequence of SEQ ID NO: 1 is an arbitrary amino acid from the candidate protein.
(367) An amino acid corresponding to the Xaa.sub.52 of the candidate protein selected in the selection step is an arbitrary amino acid. The arbitrary amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, is preferably C, F, H, K, M, or T, and is more preferably C, M, or T as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the selected candidate protein, the Xaa.sub.52 is more preferably H as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(368) The Xaa.sub.133 of the selected candidate protein is an arbitrary amino acid. The arbitrary amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, and is preferably L, Q, S, or T. In the selected candidate protein, the Xaa.sub.133 is more preferably T as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(369) In the selected candidate protein, the Xaa.sub.154 is an arbitrary amino acid. The arbitrary amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y, is preferably A, H, I, K, L, Q, V, or Y, and is more preferably A, I, L, V, or Y as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. In the selected candidate protein, the Xaa.sub.154 is more preferably K as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(370) The candidate protein selected in the selection step is a protein having a fluorescence activity in which the amino acid corresponding to the Xaa.sub.52 is C, F, H, K, M, or T, the amino acid corresponding to the Xaa.sub.133 is L, Q, S, or T, and the amino acid corresponding to the Xaa.sub.154 is A, H, I, K, L, Q, V, or Yin the amino acid sequence of SEQ ID NO: 1.
(371) The candidate protein selected in the selection step is a protein having a fluorescence activity in which the combination of amino acids corresponding to the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 in the amino acid sequence of SEQ ID NO: 1 is one of the following combinations (aa1) to (aa12). The candidate protein selected in the selection step is a protein having a fluorescence activity in which the combination of amino acids corresponding to the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is the following combination (aa1), (aa3), (aa6), (aa9), (aa10), or (aa12) or a protein having a fluorescence activity in which the combination of amino acids corresponding to the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is the following combination (aa1) or (aa9) as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. The candidate protein selected in the selection step is a protein having a fluorescence activity in which the combination of amino acids corresponding to the Xaa.sub.52, the Xaa.sub.133, and the Xaa.sub.154 is the following combination (aa2) as it shows stronger fluorescence under excitation with excitation light at the same intensity, for example.
(372) TABLE-US-00008 TABLE 4 Xaa.sub.52 Xaa.sub.133 Xaa.sub.154 (aa1) T S Y (aa2) H T K (aa3) C L L (aa4) C S H (aa5) T S H (aa6) M L V (aa7) F S Q (aa8) K T A (aa9) C Q L (aa10) T T I (aa11) K S Q (aa12) M L A
(373) The candidate protein selected in the selection step is preferably a protein having a fluorescence activity in which the Xaa.sub.205 is substituted with I as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. The candidate protein selected in the selection step is preferably a protein having a fluorescence activity in which the Xaa.sub.198 is substituted with L or H as it shows stronger fluorescence even with excitation light having a relatively low wavelength, for example. The candidate protein selected in the selection step is preferably a protein having a fluorescence activity in which the Xaa.sub.198 and the Xaa.sub.205 are substituted with the combination of L and I or H and I as it shows further stronger fluorescence even with excitation light having a relatively low wavelength, for example.
(374) In the selection step, the method for identifying the amino acid sequence of the candidate protein is not limited to particular methods, and can be, for example, a publicly known amino acid identification method. When the candidate protein is expressed from the mutation polynucleotide, the amino acid sequence of the candidate protein can be identified by substituting the codon of the base sequence of the mutation polynucleotide with a corresponding amino acid sequence, for example.
(375) In the selection step, the method for examining the fluorescence activity of the candidate protein is not limited to particular methods, and can be a publicly known fluorescence activity examination method. For example, the fluorescence activity of the candidate protein can be examined by measuring the spectrum of the fluorescence generated by the excitation light at each excitation wavelength using a publicly known optical measuring instrument. When the candidate protein is expressed in Escherichia coli (Escherichia coli), the method for examining the fluorescence activity is not limited to particular methods. For example, the fluorescence activity can be examined using a light emitting diode ultra violet (LEDUV) light source and an UV transmission filter.
(376) In the selection step in the screening method of the present invention, preferably, a protein having a fluorescence activity and consisting of an amino acid sequence having at least 80% identity to the amino acid sequence of SEQ ID NO: 1 is selected. The identity can be a range in which the selected candidate protein has the fluorescence activity, for example. The identity is, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%.
EXAMPLE
(377) The examples of the present invention are described below. The present invention, however, is not limited by the following examples.
Example 1
(378) The fluorescence activity of the novel protein of the present invention was examined.
(379) (1) Construction of Expression Vector
(380) Twelve kinds of vector insertion sequences (SEQ ID NO: 33) each including one of the novel genes (SEQ ID NOs: 17, 18, 20, 21, 23, 25 to 27, and 29 to 32) which encode the novel fluorescent proteins (SEQ ID NOs: 2 to 13), respectively, were obtained by a chemical synthesis. In the vector insertion sequence, the underlined base sequence within parentheses is a base sequence corresponding to the novel gene encoding the novel fluorescent protein. The relationships between the boxed N.sub.154N.sub.155N.sub.156 codon, N.sub.397N.sub.398N.sub.399 codon, and N.sub.460N.sub.461N.sub.462 codon and the novel fluorescent protein and the novel gene in the vector insertion sequence are shown in the following table 5. The vector insertion sequences in each of which the combination of the N.sub.154N.sub.155N.sub.156 codon, N.sub.397N.sub.398N.sub.399 codon, and N.sub.460N.sub.461N.sub.462 codon was one of (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18) were referred to as the vector insertion sequences (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18), respectively.
(381) TABLE-US-00009 Vectorinsertionsequence (SEQIDNO:33) 5-AAGCTTG[ATGACAACCTTCAAAATCGAGTCCCGGATCCATGGCAAC CTCAACGGGGAGAAGTTCGAGTTGGTTGGAGGTGGAGTAGGTGAGGAGGG TCGCCTCGAGATTGAGATGAAGACTAAAGATAAACCACTGGCATTCTCTC
(382) TABLE-US-00010 TABLE5 N.sub.154N.sub.155N.sub.156 N.sub.397N.sub.398N.sub.399 N.sub.460N.sub.461N.sub.462 Protein Gene (f1-3) ACT AGT TAC SEQIDNO:2 SEQIDNO:17 (f1-4) CAC ACT AAG SEQIDNO:3 SEQIDNO:18 (f1-6) TGC TTA CTT SEQIDNO:4 SEQIDNO:20 (f1-7) TGC AGC CAT SEQIDNO:5 SEQIDNO:21 (f1-9) ACG AGC CAC SEQIDNO:6 SEQIDNO:23 (f1-11) ATG CTC GTG SEQIDNO:7 SEQIDNO:25 (f1-12) AAA AGC CAA SEQIDNO:8 SEQIDNO:26 (f1-13) AAA ACT GCT SEQIDNO:9 SEQIDNO:27 (f1-15) TGC CAA TTG SEQIDNO:10 SEQIDNO:29 (f1-16) ACT ACA ATT SEQIDNO:11 SEQIDNO:30 (f1-17) AAA AGC CAA SEQIDNO:12 SEQIDNO:31 (f1-18) ATG CTC GCC SEQIDNO:13 SEQIDNO:32
(383) The vector insertion sequences (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18) each were cleaved by restriction enzymes HindIII and EcoRI and each of the resultants was linked to the pEGFP vector (product of CLONTEC) cleaved by the restriction enzymes. The vectors into which the vector insertion sequences (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18) were inserted were referred to as the expression vectors (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18), respectively. The expression vector was constructed by Gene Script.
(384) (2) Transfection to Escherichia coli
(385) Each of the expression vectors (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18) alone was transfected to the Escherichia coli DH5a strain by a heat shock method. Each of the obtained transformants was cultured at 37 C. for 10 hours using an LB culture medium containing 100 g/mL antibiotic (ampicillin). Then each of the cultured bacterial cells is collected, and the obtained pellet was washed twice using 40 mL of PBS solution containing one tablet of protease inhibitor (cOmplete, product of EDTA-free, Roche Ltd). Each of the washed pellet was suspended in 800 L of PBS solution containing the protease inhibitor. Subsequently, each of the obtained suspensions was sonicated twice with Amp 25% for 1 minute using an ultrasonic homogenizer (QSONICA, WAKENBTECH CO., LTD). Then, each of the treated suspensions was centrifuged with 1300 rpm at 4 C. for 10 minutes, and the obtained supernatant was recovered. Hereinafter, the supernatants obtained from the transformants to which the expression vectors (f1-3), (f1-4), (f1-6), (f1-7), (f1-9), (f1-11) to (f1-13), and (f1-15) to (f1-18) have transfected were referred to as proteins (F1-1) to (F1-12) protein, respectively. The concentration of the protein in each supernatant was determined by adding Protein Assay (product of Bio Rad) to the supernatant and measuring the absorbance at 595 nm by a microplate reader (Infinite M1000Pro, product of TECAN).
(386) (3) Measurement of Fluorescence Activity
(387) Each supernatant obtained in the transfection (2) was diluted based on the concentration of the protein in each supernatant obtained in the transfection (2) so that the concentration of the protein in the supernatant was 0.2 mg/mL. The fluorescence intensity (FI) of 50 L of each supernatant after dilution was measured with the microplate reader under the measurement conditions described below. As a negative control, the fluorescence intensity (FI) was measured in the same manner as described above except that the pUC vector was transfected instead of the expression vector.
(388) (Measurement Condition)
(389) Excitation wavelength: 350 to 650 nm (band width: 5 nm)
(390) Fluorescence (detection) wavelength: 350 to 650 nm (band width: 5 nm)
(391) laser intensity (Gain): 105
(392) The results obtained in the case where the excitation wavelength (Ex) was 375 nm and the fluorescence wavelength (Em) was 515 nm are shown in the following table 6A, the results obtained in the case where the excitation wavelength was 405 nm and the fluorescence wavelength was 515 nm are shown in the following table 6B, the results obtained in the case where the excitation wavelength was 500 nm and the fluorescence wavelength was 525 nm are shown in the following table 6C, and the results obtained in the case where the excitation wavelength was 510 nm and the fluorescence wavelength was 535 nm are shown in the following table 6D. As shown in the following tables 6A to 6D, the proteins (F1-1) to (F1-12) each showed a fluorescence activity at every wavelength. In contrast, the negative control (pUC) did not show a fluorescence activity. As shown in the table 6A, in the case where the excitation wavelength was 375 nm and the fluorescence wavelength was 515 nm, the proteins (F1-1) to (F1-6), (F1-9), (F1-10), and (F1-12) each showed a strong fluorescence activity, and the protein (F1-9) showed a significantly strong fluorescence activity. As shown in the table 6B, in the case where the excitation wavelength was 405 nm and the fluorescence wavelength was 515 nm, the proteins (F1-1), (F1-2), (F1-4), and (F1-9) each showed a strong fluorescence activity, and the protein (F1-9) showed a significantly strong fluorescence activity. As shown in the table 6C, in the case where the excitation wavelength was 500 nm and the fluorescence wavelength was 525 nm, the protein (F1-2) showed a strong fluorescence activity. As shown in the table 6D, in the case where the excitation wavelength was 510 nm and the fluorescence wavelength was 535 nm, the protein (F1-2) showed a strong fluorescence activity. Although it is not shown in the tables, also in the cases of using expression vectors each including one of the polynucleotides (f1-1) and (f1-2) each encoding the amino acid sequence of (F1-1), the polynucleotide (f1-5) encoding the amino acid sequence of (F1-2), the polynucleotide (f1-8) encoding the amino acid sequence of (F1-4), the polynucleotide (f1-10) encoding the amino acid sequence of (F1-6), and the polynucleotide (f1-14) encoding the amino acid sequence (F1-9) instead of the expression vector, the proteins each showed a fluorescence activity. These results showed that the novel fluorescent protein of the present invention has a fluorescence activity.
(393) TABLE-US-00011 TABLE 6A Excitation wavelength = 375 nm Fluorescence Fluorescence wavelength = 515 nm intensity (FI) F 1-1 784 F 1-2 172 F 1-3 371 F 1-4 409 F 1-5 175 F 1-6 166 F 1-7 33 F 1-8 50 F 1-9 906 F 1-10 266 F 1-11 33 F 1-12 258 pUC 17
(394) TABLE-US-00012 TABLE 6B Excitation wavelength = 405 nm Fluorescence Fluorescence wavelength = 515 nm intensity (FI) F 1-1 1071 F 1-2 1170 F 1-3 464 F 1-4 713 F 1-5 267 F 1-6 182 F 1-7 91 F 1-8 72 F 1-9 1402 F 1-10 304 F 1-11 141 F 1-12 275 pUC 10
(395) TABLE-US-00013 TABLE 6C Excitation wavelength = 500 nm Fluorescence Fluorescence wavelength = 525 nm intensity (FI) F 1-1 170 F 1-2 100401 F 1-3 3034 F 1-4 3022 F 1-5 1572 F 1-6 1407 F 1-7 248 F 1-8 2518 F 1-9 6335 F 1-10 2910 F 1-11 387 F 1-12 2341 pUC 9
(396) TABLE-US-00014 TABLE 6D Excitation wavelength = 510 nm Fluorescence Fluorescence wavelength = 535 nm intensity (FI) F 1-1 108 F 1-2 64915 F 1-3 2417 F 1-4 1219 F 1-5 724 F 1-6 1081 F 1-7 67 F 1-8 1108 F 1-9 2864 F 1-10 2181 F 1-11 104 F 1-12 1876 pUC 10
(397) The measurement results of the overall range of the excitation wavelength and the overall range of the fluorescence wavelength are shown in
(398) As shown by the arrows (A), (C), and (F) of
(399) TABLE-US-00015 TABLE 7 Excitation wavelength Excitation maximum wavelength F1-1 350~435 nm 396~404 nm F1-3 350~435 nm 396~404 nm F1-6 350~435 nm 391~399 nm F1-9 350~435 nm 401~409 nm F1-10 350~435 nm 391~399 nm F1-12 350~435 nm 386~394 nm
(400) These results showed that the novel fluorescent protein of the present invention has a fluorescence activity.
Example 2
(401) It was examined that the novel fluorescent protein can be screened by the screening method of the present invention.
(402) (1) Construction of Expression Vector
(403) A mutation polynucleotide was produced by a DNA shuffling method and the mutation polynucleotide was linked to the vector, thereby constructing the expression vector of the mutation polynucleotide. Specifically, the expression vector was constructed as follows. First, the polynucleotide (f1-3) (SEQ ID NO: 17) and the polynucleotide (f1-15) (SEQ ID NO: 29) were amplified by the 1st polymerase chain reaction (PCR) using the following primer set, thereby obtaining a 1st PCR product. The PCR reaction solution was prepared using the kit TaKaRa EX Taq (product of TAKARA BIO INC.) according to the instruction.
(404) Primer Set
(405) TABLE-US-00016 Primersequence1 (SEQIDNO:102) 5-ATGCTTCCGGCTCGTATGTTG-3 Primersequence2 (SEQIDNO:103) 5-GTACGGCCGACTAGTAGGCC-3
(406) 1.9 g of the 1st PCR product was suspended in a buffer solution containing deoxyribonuclease (DNase) and having the following composition, caused to react at 25 C. for 20 minutes, and then caused to react at 90 C. for 10 minutes, thereby fragmenting DNA.
(407) [Composition of Buffer Solution]
(408) TABLE-US-00017 Total 40 L DNase I (product of TaKaRa) 0.05 U (PCR product of polynucleotide (f1-3)) 0.025 U (PCR product of polynucleotide (f1-15)) Tris-Hcl 50 mmol/L MnCl.sub.2 10 mmol/L pH 7.4
(409) Each of the fragmented DNAs was purified by agarose gel electrophoresis and gel extraction. Then, the obtained purified product was added to the PCR reaction solution so that the concentration of the solution is in the range from 10 to 30 g/L and the resultant was amplified by the 2nd PCR, thereby obtaining a number of 2nd PCR products. In the 2nd PCR, the above-described primer set was not used. Then, one-fiftieth of each of the 2nd PCR products was added to the PCR reaction solution and amplified by the 3rd PCR using the primer set, thereby obtaining a mutation polynucleotide. The mutation polynucleotide was cleaved by the restriction enzymes and each of the resultants was linked to the pEGFP vector cleaved by the restriction enzymes. The vector into which the mutation polynucleotide was inserted was served as a mutation polynucleotide expression vector. In this manner, a number of mutation polynucleotide expression vectors were obtained.
(410) (2) Transfection to Escherichia coli
(411) Each of the mutation polynucleotide expression vectors alone was transfected to the Escherichia coli JM109 strain by a heat shock method. The obtained transformant was cultured at 37 C. overnight (18 hours) until about 1000 colonies are formed using an LB culture medium containing 100 g/mL antibiotic (ampicillin).
(412) (3) Examination of Fluorescence Activity
(413) Then, each of the cultured bacterial cells was collected and the fluorescence activity of the bacterial cell was examined using the LEDUV light source (NS375LIM, product of Nitride Semiconductors Co., Ltd.) as a light source and the UL360 (OMG CO., LTD.) as a filter. As to the bacterial cell whose fluorescence activity was observed, the plasmid was purified, the procedures (1) and (2) of Example 2 were repeated three times, and then the fluorescence activity of the bacterial cell was examined in the same manner as described above.
(414) (4) Sequence of Escherichia coli
(415) The colony of the bacterial cell whose fluorescence activity was observed in the examination (3) was recovered, the plasmid was purified, and the resultant was subjected to a direct sequencing under the following conditions. The results showed that the bacterial cell whose fluorescence activity was observed includes one of the novel genes of the present invention (SEQ ID NOs: 68 to 101). These results showed that the novel fluorescent protein of the present invention can be screened by the screening method of the present invention.
(416) [Conditions of Direct Sequencing]
(417) TABLE-US-00018 Sequencer ABI3130x1(productofAppliedBiosystems) Sequencingreagent BigDyeTerminatorV1-1cyclesequencing kit(productofAppliedBiosystem) Sequencingprimer Primersequence1 (SEQIDNO:102) 5-ATGCTTCCGGCTCGTATGTTG-3 Primersequence2 (SEQIDNO:103) 5-GTACGGCCGACTAGTAGGCC-3
Example 3
(418) The fluorescence activity of the novel protein of the present invention was examined. The experimental conditions, experimental method, and the like were the same as those described in Example 1 unless otherwise noted.
(419) (1) Construction of Expression Vector
(420) Fourteen kinds of vector insertion sequences were obtained by a chemical synthesis by adding the 5 end sequence (5-AAGCTTG-3) to the 5 end of and the 3 end sequence (5-AATTC-3) to the 3 end of each of the base sequences of the novel genes (SEQ ID NOs: 68 to 82, (f1-19) to (f1-33)) encoding the novel fluorescent proteins (SEQ ID NOs: 34 to 48). Also, nineteen kinds of vector insertion sequences were obtained by a chemical synthesis by adding the 5 end sequence (5-AAGCTTG-3) to the 5 end of and the 3 end sequence (5-AATTC-3) to the 3 end of each of the base sequences of the novel genes (SEQ ID NOs: 83 to 101, (f1-34) to (f1-52)) encoding the novel fluorescent proteins (SEQ ID NOs: 49 to 67). The vector insertion sequences including the novel genes (f1-19) to (f1-52) were referred to as the vector insertion sequences (f1-19) to (f1-52), respectively.
(421) The vector insertion sequences (f1-19) to (f1-52) each were cleaved by the restriction enzymes and each of the resultants was linked to the pEGFP vector cleaved by the restriction enzymes. The vectors into which the vector insertion sequences (f1-19) to (f1-52) were inserted were referred to as the expression vectors (f1-19) to (f1-52), respectively.
(422) (2) Transfection to Escherichia coli
(423) Each of the expression vectors (f1-19) to (f1-52) was transfected to the Escherichia coli DH5 strain, the supernatant obtained from each of the transformants to which the expression vectors (f1-19) to (f1-52) have transfected were referred to as proteins (F1-13) to (F1-46), and the concentration of the protein in each supernatant was determined by measuring the absorbance in the same manner as in the transfection (2) of Example 1 except for the following experimental conditions. As to the experimental condition, the culture time of the transformant was 16 to 18 hours and the PBS solution in which the pellet after washing is suspended was 1.5 mL. Each of the obtained suspensions was sonicated four times with Amp 35% at 10 seconds/30 seconds, for 2 minutes using the ultrasonic homogenizer. Each of the sonicated suspension was centrifuged with 3000 rpm at 4 C. for 10 minutes. The concentration of the protein in each supernatant was determined by measuring the absorbance at 562 nm by a microplate reader.
(424) (3) Measurement of Fluorescence Activity
(425) Each supernatant obtained in the transfection (2) was diluted based on the concentration of the protein in each supernatant measured in the transfection (2) so that the concentration of the protein in the supernatant was in the range from 1.5 to 2.0 mg/mL. A to 50 to 70 L of each supernatant after dilution, the fluorescence intensity (FI) was measured with the microplate reader under the same measurement conditions as in the measurement (3) of Example 1. As a control, the fluorescence intensity (FI) was measured in the same manner as described above except that the expression vectors (f1-3) and (f1-15) were transfected instead of the expression vector and the proteins (F1-1) and (F1-9) were obtained.
(426) The results of the proteins (F1-13) to (F1-27), (F1-1), and (F1-9) are shown in the following table 8A, the results of the proteins (F1-28) to (F1-46), (F1-1), and (F1-9) are shown in the following table 8B, and the results of the proteins (F1-28) to (F1-46) and (F1-9) are shown in the following table 8C. The tables 8A to 8C shows the values of the excitation wavelength (Ex), fluorescence wavelength, and fluorescence intensity (FI) of each protein. As shown in the table 8A, the proteins (F1-13) to (F1-27) each showed a stronger fluorescence activity than the proteins (F1-1) and (F1-9). Particularly, the proteins (F1-14) to (F1-27) each showed a significantly strong fluorescence activity. As shown in the table 8B, the proteins (F1-28) to (F1-46) each showed a stronger fluorescence activity than the proteins (F1-1) and (F1-9). As shown in the table 8C, the proteins (F1-28) to (F1-46) each showed a stronger fluorescence activity than the protein (F1-9). These results showed that the novel fluorescent protein of the present invention has a fluorescence activity.
(427) TABLE-US-00019 TABLE 8A Excitation Fluorescence Fluorescence wavelength wavelength intensity (nm) (nm) (FI) F 1-13 400 515 20039 F 1-14 405 515 55699 F 1-15 400 515 67637 F 1-16 395 515 60605 F 1-17 400 515 73516 F 1-18 400 515 76394 F 1-19 400 515 72697 F 1-20 395 515 59493 F 1-21 395 515 67541 F 1-22 400 515 60683 F 1-23 395 515 62924 F 1-24 400 515 76883 F 1-25 400 515 62724 F 1-26 400 515 67142 F 1-27 395 515 71671 F 1-1 400 515 5925 F 1-9 405 515 4362
(428) TABLE-US-00020 TABLE 8B Excitation Fluorescence Fluorescence wavelength wavelength intensity (nm) (nm) (FI) F 1-28 405 515 8554 F 1-29 405 515 16151 F 1-30 405 515 16475 F 1-31 405 515 11240 F 1-32 405 515 7507 F 1-33 405 515 8862 F 1-34 405 515 18209 F 1-35 410 515 8404 F 1-36 405 515 19190 F 1-37 405 515 10031 F 1-38 405 515 18823 F 1-39 420 515 19742 F 1-40 405 515 14866 F 1-41 405 515 10860 F 1-42 420 515 22967 F 1-43 425 515 9600 F 1-44 405 515 13029 F 1-45 405 515 8516 F 1-46 405 515 12651 F 1-1 400 515 3850 F 1-9 405 515 3063
(429) TABLE-US-00021 TABLE 8C Excitation Fluorescence Fluorescence wavelength wavelength intensity (nm) (nm) (FI) F 1-28 500 515 53757 F 1-29 500 515 114174 F 1-30 500 515 106071 F 1-31 500 515 72273 F 1-32 500 515 48253 F 1-33 500 515 55930 F 1-34 500 515 113810 F 1-35 500 515 53349 F 1-36 505 515 118062 F 1-37 500 515 63908 F 1-38 500 515 108094 F 1-39 500 515 122494 F 1-40 500 515 90253 F 1-41 500 515 66769 F 1-42 500 515 136002 F 1-43 505 515 68784 F 1-44 500 515 80642 F 1-45 500 515 50212 F 1-46 500 515 78833 F 1-9 505 515 16702
(430) The measurement results of the overall range of the excitation wavelength and the overall range of the fluorescence wavelength are shown in
Example 4
(431) The fluorescence activity of the novel protein of the present invention was examined. The experimental condition, experimental method, and the like were the same as those described in Example 1 unless otherwise noted.
(432) The supernatants of the proteins (F1-1), (F1-2), (F1-9), (F1-27), and (F1-42) were obtained in the same manner as in Example 1 except that a tag (6His tag) consisting of histidine 6 residues was added to the N end of each protein. The supernatants were subjected to protein purification according to the instruction manual of TALON Superflow Metal Affinity Rsesin (product of TAKARA BIO INC.), and the eluates containing the proteins (F1-1), (F1-2), (F1-9), (F1-27), and (F1-42), respectively, were obtained. Each eluate was diluted so that the concentration of the protein was 0.2 mg/mL. As to 50 L of each supernatant after elution, the fluorescence intensity (FI) was measured with the microplate reader under the following measurement conditions.
(433) (Measurement Conditions)
(434) Excitation wavelength: 505 to 520 nm (band width: 1 nm)
(435) Fluorescence (detection) wavelength: 350 to 525 nm (band width: 1 nm)
(436) Laser intensity (Gain): 105
(437) The results of the proteins (F1-1), (F1-9), (F1-27), and (F1-42) in the case where the excitation wavelength (Ex) was around 400 nm and the fluorescence wavelength (Em) was around 515 nm are shown in the following table 9A and the results of the proteins (F1-2), (F1-9), and (F1-42) in the case where the excitation wavelength (Ex) was 507 nm and the fluorescence wavelength (Em) was around 515 nm are shown in the following table 9B. As shown in the table 9A, the proteins (F1-27) and (F1-42) each showed a stronger fluorescence activity than the proteins (F1-1) and (F1-9). Particularly, the protein (F1-27) showed a significantly strong fluorescence activity. As shown in the table 9B, the proteins (F1-2) and (F1-42) each showed a stronger fluorescence activity than the protein (F1-9). These results showed that the novel fluorescent protein of the present invention has a fluorescence activity.
(438) TABLE-US-00022 TABLE 9A Excitation Fluorescence Fluorescence wavelength wavelength intensity (nm) (nm) (FI) F1-1 400 512 4294 F1-9 409 513 4209 F1-27 400 512 37747 F1-42 403 513 16025
(439) TABLE-US-00023 TABLE 9B Excitation Fluorescence Fluorescence wavelength wavelength intensity (nm) (nm) (FI) F1-2 507 516 287170 F1-9 507 513 34757 F1-42 507 513 107742
(440) The measurement results of the overall range of the excitation wavelength and the overall range of the fluorescence wavelength are shown in
Example 5
(441) The fluorescence activity of the novel protein of the present invention was examined. The experimental condition, experimental method, and the like were the same as those described in Example 1 unless otherwise noted.
(442) (1) Construction of Expression Vector
(443) The vector insertion sequences (SEQ ID NOs: 104, 105, and 106) each having a sequence in which a His tag sequence was added to the N end of each of the novel genes (SEQ ID NOs: 18, 82, and 97) encoding the novel fluorescent proteins (SEQ ID NOs: 3, 48, and 63), respectively, were obtained by a chemical synthesis. In the vector insertion sequence, the underlined base sequence within parentheses is a base sequence corresponding to the novel gene encoding the novel fluorescent protein and the underlined base sequence outside the parentheses corresponds to a His tag sequence. The relationships between the boxed N.sub.592N.sub.593N.sub.594 codon and N.sub.613N.sub.614N.sub.615 codon and the novel fluorescent protein and the novel gene in the vector insertion sequence are shown in the following table 10. The vector insertion sequences in each of which the N.sub.592N.sub.593N.sub.594 codon and the N.sub.613N.sub.614N.sub.615 codon were one of (f1-4), (f1-33), and (f1-48) were referred to as the vector insertion sequences (f1-4), (f1-33), and (f1-48), respectively.
(444) TABLE-US-00024 Vectorinsertionssequence (SEQIDNO:104) 5-TCTAGATGCATCATCATCATCATCATGGCGGCAGC[ATGACAACCTT CAAAATCGAGTCCCGGATCCATGGCAACCTCAACGGGGAGAAGTTCGAGT TGGTTGGAGGTGGAGTAGGTGAGGAGGGTCGCCTCGAGATTGAGATGAAG ACTAAAGATAAACCACTGGCATTCTCTCCCTTCCTGCTGTCCCACTGCAT GGGTTACGGGTTCTACCACTTCGCCAGCTTCCCAAAGGGGACTAAGAACA TCTATCTTCATGCTGCAACAAACGGAGGTTACACCAACACCAGGAAGGAG ATCTATGAAGACGGCGGCATCTTGGAGGTCAACTTCCGTTACACTTACGA GTTCAACAAGATCATCGGTGACGTCGAGTGCATTGGACATGGATTCCCAA GTCAGAGTCCGATCTTCAAGGACACGATCGTGAAGACTTGTCCCACGGTG GACCTGATGTTGCCGATGTCCGGGAACATCATCGCCAGCTCCTACGCTAA GGCCTTCCAACTGAAGGACGGCTCTTTCTACACGGCAGAAGTCAAGAACA ACATAGACTTCAAGAATCCAATCCACGAGTCCTTCTCGAAGTCGGGGCCC
(445) TABLE-US-00025 TABLE10 N.sub.592N.sub.593N.sub.594 N.sub.613N.sub.614N.sub.615 Protein Gene (f1-4) CAC ATG SEQIDNO:3 SEQIDNO:18 (f1-33) CTC ATA SEQIDNO:48 SEQIDNO:82 (f1-48) CAC ATA SEQIDNO:63 SEQIDNO:97
(446) The vector insertion sequences (f1-4), (f1-33), and (f1-48) each were cleaved by restriction enzymes HindIII and XbaI and each of the resultants was linked to the pcDNA3.1-hygro() vector (product of Invitrogen Corporation) cleaved by the restriction enzymes. The vectors into which the vector insertion sequences (f1-4), (f1-33), and (f1-48) were inserted were referred to as the expression vectors (f1-4), (f1-33), and (f1-48), respectively.
(447) (2) Amplification and Purification of Plasmid DNA
(448) Each of the expression vectors (f1-4), (f1-33), and (f1-48) was transfected to the Escherichia coli DH5 strain in the same manner as in the transfection (2) of Example 1 and the Escherichia coli was cultured at 37 C. under 5% CO.sub.2 for 10 hours, thereby amplifying the plasmid DNAs containing the genes (f1-4), (f1-33), and (f1-48). Then, the plasmid DNAs containing the genes (f1-4), (f1-33), and (f1-48) were purified with the Midi Prep Kit (product of QIAGEN) according to the protocol attached to the product.
(449) (3) Transfection of Plasmid DNA to Colon Cancer Cell
(450) First, human colon cancer derived HCT116 cells (DS Pharma Biomedical Co., Ltd.) were disseminated to a 6-hole plate so as to achieve about 70% confluent. The McCoy's 5A modified culture medium (product of Invitrogen Corporation) was used as the culture medium and the cells were cultured at 37 C. under 5% CO.sub.2. The cells in each well were cultured for 24 hours, and then the purified plasmid DNAs containing the genes (f1-4), (f1-33), and (f1-48) were transfected using the transfection reagent Lipofectamine2000 (product name, product of Invitrogen Corporation) according to the protocol attached to the product. The composition in each well was set as follows. The cancer cells containing the plasmid DNAs containing the genes (f1-4), (f1-33), and (f1-48) were referred to as the protein expression cancer cells (F1-2), (F1-27), and (F1-42), respectively.
(451) (Composition Per Well)
(452) TABLE-US-00026 Culture medium 3000 L Lipofectamine2000 10 L Opti-MEM (product of Invitrogen Corporation) 250 L Plasmid DNA 2.5 g
(453) (4) Measurement of Fluorescence Activity by FACS Analysis
(454) After the transfection, the wells in the well were cultured at 37 C. under 5% CO.sub.2 for 24 hours. Then, the hygromycin B solution (product of Wako) was added to the plate so that the concentration in each cell was 500 g/mL, and the resultant was cultured another 14 days. After the culture, about 210.sup.5 to 110.sup.6 fluorescence signal positive cells were sorted from the cells in each well using the FACSaria III (product of BD Biosciences), and the sorted cells were cultured at 37 C. under 5% CO.sub.2 another 5 days. Then, the cultured cells were subjected to a fluorescence activated cell sorting (FACS) analysis under the following conditions. As the control, the analysis was conducted in the same manner as described above except that the expression vectors were not transfected.
(455) (FACS Analysis Conditions)
(456) Measurement apparatus FACSaria III (product of BD Biosciences)
(457) Filter Setting
(458) 488 nm blue laser; 502 nm LP mirror with a 530/30 nm band pass filter
(459) 405 nm violet laser; 502 nm LP mirror with a 530/30 nm band pass filter
(460) The results are shown in
(461) The results obtained by calculating the mean fluorescence intensity (MFI) of the fluorescence intensity of the protein expression cancer cells (F1-27) and (F1-42) analyzed with the V500 filter and the protein expression cancer cells (F1-2) and (F1-42) analyzed with the FITC filter are shown in the following table 11. As shown in table 11, the protein expression cancer cells (F1-27) and (F1-42) analyzed with the V500 filter and the protein expression cancer cells (F1-2) and (F1-42) analyzed with the FITC filter each showed a high MFI. These results showed that the novel fluorescent protein of the present invention has a superior fluorescence activity.
(462) TABLE-US-00027 TABLE 11 MFI(V500) MFI(FITC) (F1-2) 21400 (F1-27) 1538 (F1-42) 1004 10700
(463) The invention of the present application was described above with reference to the embodiments and examples. However, the invention of the present application is not limited to the above-described embodiments and examples. Various changes that can be understood by those skilled in the art can be made in the configurations and details of the invention of the present application within the scope of the invention of the present application.
INDUSTRIAL APPLICABILITY
(464) According to the present invention, a novel fluorescent protein can be provided. Thus, the present invention is a technique which can be significantly useful in a life science field, a medical field, an agricultural field, and the like.
SEQUENCE LISTING
(465) TF15036WO_ST25.txt