DIAGNOSTIC ASSAYS TO DETECT TUMOR ANTIGENS IN CANCER PATIENTS

Abstract

The present invention generally relates to diagnostic assays using cell cultures, in particular to chimeric antigen receptor (CAR) expressing reporter cell assays to analyze samples, in particular patient samples, to diagnose cancer by quantifying the expression of tumor antigens and/or predicting clinical response to cancer immunotherapies. A further aspect of the present invention is to improve safety of e.g., cancer immunotherapies.

Claims

1. A diagnostic assay for determining the presence of a tumor cell in a sample, the diagnostic assay comprising the steps of: a) contacting the sample with an antigen binding molecule comprising an antigen binding domain and a recognition domain, wherein the antigen binding domain comprises a target antigen binding moiety capable of specific binding to the tumor cell; b) contacting the sample with a chimeric antigen receptor (CAR) expressing reporter T (CAR-T) cell wherein the reporter CAR-T cell comprises: i. a CAR capable of specific binding to the recognition domain, wherein the CAR is operationally coupled to a response element; ii. a reporter gene under the control of the response element; and c) determining T cell activation by measuring the expression of the reporter gene to establish the presence of the tumor cell.

2. The diagnostic assay of claim 1, wherein the antigen binding domain is a Fab fragment and the recognition domain is an Fc domain.

3. The diagnostic assay of any one of claim 1 or 2, wherein the antigen binding molecule is an IgG class antibody, particularly an IgG1 or IgG4 isotype antibody.

4. The diagnostic assay of claim 3, wherein the recognition domain is a mutated Fc domain, wherein the mutated Fc domain comprises at least one amino acid substitution compared to the non-mutated parent Fc domain, wherein the CAR is capable of specific binding to the mutated Fc domain but not capable of specific binding to the non-mutated parent Fc domain.

5. The diagnostic assay of claim 4, wherein the mutant Fc domain comprises an amino acid substitution at a position selected from the group consisting of residue 117, 118, 136, 180, 193, 212, 214, and 318 of human IgG1 Fc (SEQ ID NO:132), in particular wherein the mutant human IgG1 Fc comprises the amino acid substitution leucine to alanine at residue 117, leucine to alanine at residue 118, isoleucine to alanine at position 136, asparagine to alanine at residue 180, histidine to alanine at residue 193, proline to glycine at residue 212, proline to glycine at residue 214, and/or or histidine to alanine at residue 318 of human IgG1 Fc (SEQ ID NO:132).

6. The diagnostic assay of any one of claim 4 or 5, wherein the mutant Fc domain comprises an amino acid substitution at the position of residue 212 of human IgG1 Fc (SEQ ID NO:132), in particular wherein the mutant Fc domain comprises the amino acid substitution proline to glycine at residue 212 of human IgG1 Fc (SEQ ID NO:132).

7. The diagnostic assay of claims 1 to 3, wherein the recognition domain comprises a tag, wherein the CAR is capable of specific binding to the recognition domain comprising the tag but not capable of specific binding to the recognition domain not comprising the tag.

8. The diagnostic assay of claim 7, wherein the tag is a hapten molecule, particularly wherein the hapten molecule is selected from the group consisting of Biotin, Digoxigenin (DIG) and Fluorescein (FITC).

9. The diagnostic assay of claim 7, wherein the tag is a polypeptide tag, particularly wherein the polypeptide tag is selected from the group consisting of myc-tag, HA-tag, AviTag, FLAG-tag, His-tag, GCN4-tag, and NE-tag.

10. The diagnostic assay of any one of claims 1 to 9, wherein the CAR comprises at least one intracellular stimulatory signaling and/or co-stimulatory signaling domain.

11. The diagnostic assay of claim 10, wherein activation of the intracellular signaling and/or co-signaling domain leads to activation of the response element.

12. The diagnostic assay of any one of claims 1 to 11, wherein activation of the response element leads to expression of the reporter gene.

13. The diagnostic assay of any one of claims 1 to 12, wherein the sample is a patient sample derived from an individual suffering from a disease, in particular wherein the disease is cancer.

14. A diagnostic kit for determining the presence of a tumor cell in a sample, the diagnostic kit comprising: (a) an antigen binding molecule capable of specific binding to a tumor cell, wherein the antigen binding molecule comprises a mutated Fc domain, wherein the mutated Fc domain comprises at least one amino acid substitution compared to the non-mutated parent Fc domain; and (b) a transduced T cell comprising (i) a CAR capable of specific binding to the antigen binding molecule, wherein the CAR is capable of specific binding to the mutated Fc domain but not capable of specific binding to the non-mutated parent Fc domain and (ii) a reporter gene under the control of the response element, wherein the CAR is operationally coupled to a response element.

15. A diagnostic kit for determining the presence of a tumor cell in a sample, the diagnostic kit comprising: (a) an antigen binding molecule capable of specific binding to a tumor cell, wherein the antigen binding molecule comprises a tag; and (b) a transduced T cell comprising (i) a CAR capable of specific binding to the antigen binding molecule, wherein the CAR is capable of specific binding to the antigen binding molecule comprising the tag but not capable of specific binding to the antigen binding molecule not comprising the tag, and (ii) a reporter gene under the control of the response element, wherein the CAR is operationally coupled to a response element.

Description

SHORT DESCRIPTION OF THE FIGURES

[0033] FIG. 1A to 1B depicts schematic representations of diagnostic Jurkat NFAT reporter CAR-T cell assays. FIG. 1A depicts one embodiment of the diagnostic Jurkat NFAT reporter CAR-T cell assay. The target antigen bound IgG which is digoxigeninylated at the Fc (recognition domain) can be recognized by the anti-Digoxigenin CAR expressing Jurkat NFAT reporter T cell. This recognition leads to the activation of the cell which can be detected by measuring luminescence (cps). FIG. 1B depicts another embodiment of the diagnostic Jurkat NFAT reporter CAR-T cell assay. TAA bound IgG harboring the P329G mutation can be recognized by the anti-P329G CAR expressing Jurkat NFAT reporter T cell. This recognition leads to the activation of the cell which can be detected by measuring luminescence (cps).

[0034] FIG. 2A to 2F depicts the architecture of different CAR formats used in the present invention. FIG. 2A shows the architecture of the Fab format. Depicted is the extracellular domain comprising an antigen binding moiety which consists of an Ig heavy chain fragment and an Ig light chain. Attached to the heavy chain, a linker connects the antigen recognition domain with an anchoring transmembrane domain (ATD) which is fused to an intracellular co-stimulatory signaling domain (CSD) which in turn is fused to a stimulatory signaling domain (SSD). FIG. 2B shows the architecture of the Fab format with heavy and light chain swap. Depicted is the extracellular domain comprising an antigen binding moiety which consists of an Ig heavy chain fragment and an Ig light chain. Attached to the light chain constant domain, a linker connects the antigen recognition domain with an anchoring transmembrane domain (ATD) which is fused to an intracellular co-stimulatory signaling domain (CSD) which in turn is fused to a stimulatory signaling domain (SSD). FIG. 2C shows the architecture of the scFab format. Depicted is the extracellular domain comprising an antigen binding moiety which consists of an Ig heavy chain fragment and an Ig light chain, both connected by a linker. Attached to the heavy chain, a linker connects the antigen recognition domain with an anchoring transmembrane domain (ATD) which is fused to an intracellular co-stimulatory signaling domain (CSD) which in turn is fused to a stimulatory signaling domain (SSD). FIG. 2D shows the architecture of the crossFab format with VH-VL swap. Depicted is the extracellular domain comprising an antigen binding moiety which consists of an Ig heavy chain fragment and an Ig light chain wherein the VH and VL domains are exchanged. Attached to the heavy chain constant domain, a linker connects the antigen recognition domain with an anchoring transmembrane domain (ATD) which is fused to an intracellular co-stimulatory signaling domain (CSD) which in turn is fused to a stimulatory signaling domain (SSD). FIG. 2E shows the architecture of the crossFab format with CH-CL swap. Depicted is the extracellular domain comprising an antigen binding moiety which consists of an Ig heavy chain fragment and an Ig light chain wherein the CH and CL domains are exchanged. Attached to the light chain constant domain, a linker connects the antigen recognition domain with an anchoring transmembrane domain (ATD) which is fused to an intracellular co-stimulatory signaling domain (CSD) which in turn is fused to a stimulatory signaling domain (SSD). FIG. 2F shows the architecture of the classic scFv format with an extracellular antigen recognition domain, consisting of a variable heavy and variable light chain, both connected by a linker. Attached to the variable light chain, a linker connects the antigen recognition domain with an anchoring transmembrane domain (ATD) which is fused to an intracellular co-stimulatory signaling domain (CSD) which in turn is fused to a stimulatory signaling domain (SSD).

[0035] FIG. 3A to 3F depicts a schematic representation illustrating the modular composition of exemplary expression constructs encoding CARs used according to the invention. FIG. 3A and FIG. 3B depict exemplary Fab formats. FIG. 3C depicts an exemplary scFab format. FIG. 3D and FIG. 3E depict exemplary crossFab formats. FIG. 3F depicts a classic scFv format.

[0036] FIG. 4 depicts the structural formula of the Digoxigenin (DIG) molecule.

[0037] FIG. 5 depicts an exemplary digoxigeninylated IgG1 molecule which can be specifically recognized by an anti-Digoxigenin CAR.

[0038] FIG. 6A and FIG. 6B depicts alternative digoxigenylated antigen binding molecules which are recognized by an anti-Digoxigenin CAR. In this embodiment, the target antigen binding domain and the recognition domain are the same domain, i.e., the Digoxigenin hapten tag is coupled to the antigen binding domain wherein the antigen binding domain exerts also the function of the recognition domain. FIG. 6A depicts an digoxigeninylated Fab molecule which can be recognized by an anti-Digoxigenin CAR. FIG. 6B depicts an digoxigenylated scFv molecule which can be recognized by an anti-Digoxigenin CAR.

[0039] FIG. 7 depicts a Western Blot confirming successful digoxigenylation of the anti-CD20 targeting antibody GA101. Digoxigeninylation was detected by anti-Digoxigenin-AP Fab fragments by Western Blot analysis.

[0040] FIG. 8 depicts surface detection of anti-Digoxigenin-ds-scFv on Jurkat NFAT reporter cells.

[0041] FIG. 9 depicts the diagnostic Jurkat NFAT reporter CAR-T cell assay using CD20 expressing SUDHDL4 tumor cells as target cells and an anti-CD20 IgG antibody (GA101) digoxigeninylated with a ten times molar excess of Digoxigenin-3-O-methylcarbonyl-e-aminocaproic acid-N-hydroxysuccinimide ester. The antibody recognizes on the one hand the tumor associated antigen and on the other hand is recognized by Jurkat NFAT reporter CAR-T cells. A sorted pool of anti-Digoxigenin-ds-scFv-CD28ATDCD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as effector cells.

[0042] FIG. 10 depicts an exemplary IgG1 molecule harboring the P329G mutation in the Fc domain which is recognized by an anti-P329G CAR used according to the invention.

[0043] FIG. 11A and FIG. 11B depicts a diagnostic Jurkat NFAT reporter CAR-T cell assay using CD20 expressing SUDHDL4 tumor cells as target cells. An anti-CD20 IgG antibody (GA101) harboring the P329G mutation was used, which on one hand recognizes the tumor associated antigen and on the other hand is recognized by the Jurkat NFAT reporter CAR-T cells. In FIG. 11A a sorted pool of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cell was used as reporter cells. In FIG. 11B a sorted pool of anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells.

[0044] FIG. 12A to 12D depicts a diagnostic Jurkat NFAT reporter CAR-T cell assay using CD20 tumor cells as target cells. An anti-CD20 IgG antibody (GA101) harboring the P329G mutation was used which recognizes the tumor associated antigen and is recognized by the Jurkat NFAT reporter CAR-T cells used according to the invention. In FIG. 12A the single clone 5 of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells and WSUDLCL2 cells as tumor cells. In FIG. 12B the single clone 2 of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells and WSUDLCL2 cells as tumor cells. In FIG. 12C the single clone 5 of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells and SUDHL4 cells as tumor cells. In FIG. 12D the single clone 2 of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells and SUDHL4 as tumor cells.

[0045] FIG. 13A to 13D depicts a diagnostic Jurkat NFAT reporter CAR-T cell assay performed using adherent FAP expressing NIH/3T3-huFAP cl 19 tumor cells as target cells. The anti-FAP IgG antibody clone 4B9 harboring the P329G mutation was used which the tumor associated antigen and is recognized by the Jurkat NFAT reporter CAR-T cells. IgG DP47/vk3 harboring P329G mutation was included as isotype control. In FIG. 13A a sorted pool of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells. In FIG. 13B a sorted pool of anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells. In FIG. 13C a sorted pool of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells. In FIG. 13D a sorted pool of anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells

[0046] FIG. 14A to 14D depicts a diagnostic Jurkat NFAT reporter CAR-T cell assay using adherent CEA expressing MKN45 tumor cells as target cells. Either the anti-CEA IgG clone A5B7 or the anti-CEA IgG clone T84 LCHA both harboring the P329G mutation were used which recognize the tumor associated antigen and are recognized by the Jurkat NFAT reporter CAR-T cells. Further IgG DP47/vk3 harboring the P329G mutation was included as isotype control. In FIG. 14A and in FIG. 14B a sorted pool of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing NFAT T cells was used as reporter cells. In FIG. 14C and in FIG. 14D a sorted pool of anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing NFAT T cells was used as reporter cells.

[0047] FIG. 15A to 15D depicts a diagnostic Jurkat NFAT reporter CAR-T cell assay using adherent TNC expressing CT26TNC cl 19 tumor cells as target cells. The anti-TNC IgG clone A2B10 harboring the P329G mutation was used as IgG antibody which recognizes the tumor associated antigen and is recognized by the Jurkat NFAT reporter CAR-T cells. Further IgG DP47/vk3 harboring P329G mutation was included as isotype control. In FIG. 15A and in FIG. 15B a sorted pool of anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing NFAT T cells was used as reporter cells. In FIG. 15C and in FIG. 15D a sorted pool of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing NFAT T cells was used as reporter cells.

[0048] FIG. 16A and FIG. 16B depict a diagnostic Jurkat NFAT reporter CAR-T cell assay using adherent TNC expressing CT26TNC cl 19 tumor cells as target cells. The anti-TNC IgG clone A2B10 harboring the P329G mutation was used which recognizes the tumor associated antigen and is recognized by the Jurkat NFAT reporter CAR-T cells. Further IgG DP47/vk3 harboring P329G mutation was included as isotype control. A sorted pool of anti-P329G-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was used as reporter cells.

[0049] FIG. 17 depicts a schematic representation of a diagnostic reporter CAR-T cell assay for detection of a MHC presented peptide.

[0050] FIG. 18A to FIG. 18D depict activation of CAR-NFAT-signaling in Jurkat NFAT reporter CAR-T cells by HLA-A2/WT1-peptide-binding IgG (harboring the P329G mutation) variants to RMF- or VLD-peptide-pulsed T2 cells. As reporter cells, a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells were used. Each subfigure represents dilutions of the particular binder (33F05, 11D06, 33H09 and 5E11). Comparison of signals on RMF-peptide (target) vs. VLD-peptide (off-target) helps to assess specificity of activation.

[0051] FIG. 19 depicts activation of CAR-NFAT-signaling in Jurkat NFAT reporter CAR-T cells to assess the specificity of selected WT1/HLA-A2-binders 33F05, 33H09, 11D06 and 5E11 upon incubation with T2 cells pulsed with RMF-peptide or VLD-peptide. Negative controls using Jurkat NFAT reporter CAR-T cells with unpulsed T2 cells, without T2 cells or without IgG are included. Activation (luciferase signal from Jurkat NFAT reporter CAR-T cells) was measured afterwards by adding luciferase substrate and measuring luminescence.

[0052] FIG. 20A and FIG. 20B depict assessment of specificity of WT1/HLA-binders 5E11 and 33H09 by FACS with T2 cells pulsed with RMF-peptide or VLD-peptide.

[0053] FIG. 21 depicts a schematic representation of a diagnostic reporter CAR-T cell assay transduced Jurkat NFAT reporter cells to detect WT1 positive cells in the bone marrow of an AML patient.

[0054] FIG. 22A to FIG. 22C depict activation of diagnostic reporter CAR-T cells upon contact with a CEA and FAP positive human lung metastasis of colon carcinoma and human IgG1 anti-CEA T84 LCHA or anti-FAP (4B9) antibodies with P329G LALA mutation. FIG. 22A depict a FACS plot showing expression levels of CEA and FAP antigens of the lung metastasis of colon carcinoma sample. FIG. 22B depicts activation of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells. FIG. 22C depicts activation of anti-P329G-ds-scFv-CD28ATD-CD28C SD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells.

DETAILED DESCRIPTION

[0055] Affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody or a CAR) and its binding partner (e.g., a ligand). Unless indicated otherwise, as used herein, binding affinity refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., an antigen binding moiety and an antigen and/or a receptor and its ligand). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D), which is the ratio of dissociation and association rate constants (k.sub.off and k.sub.on, respectively). Thus, equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same. Affinity can be measured by well-established methods known in the art, including those described herein. A preferred method for measuring affinity is Surface Plasmon Resonance (SPR) and a preferred temperature for the measurement is 25 C.

[0056] The term amino acid (aa) refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, -carboxyglutamate, and O-phosphoserine. Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid. Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.

[0057] The term amino acid mutation as used herein is meant to encompass amino acid substitutions, deletions, insertions, and modifications. Any combination of substitution, deletion, insertion, and modification can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics. Amino acid sequence deletions and insertions include amino- and/or carboxy-terminal deletions and insertions of amino acids. Particular amino acid mutations are amino acid substitutions. Amino acid substitutions include replacement by non-naturally occurring amino acids or by naturally occurring amino acid derivatives of the twenty standard amino acids (e.g., 4-hydroxyproline, 3-methylhistidine, ornithine, homoserine, 5-hydroxylysine). Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis and the like. It is contemplated that methods of altering the side chain group of an amino acid by methods other than genetic engineering, such as chemical modification, may also be useful.

[0058] The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, and antibody fragments so long as they exhibit the desired antigen-binding activity. Accordingly, in the context of the present invention, the term antibody relates to full immunoglobulin molecules as well as to parts of such immunoglobulin molecules. Furthermore, the term relates, as discussed herein, to modified and/or altered antibody molecules, in particular to modified antibody molecules. The term also relates to recombinantly or synthetically generated/synthesized antibodies. In the context of the present invention the term antibody is used interchangeably with the term immunoglobulin.

[0059] An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, crossover Fab, Fab, Fab-SH, F(ab).sub.2, diabodies, linear antibodies, single-domain antibodies, single-chain antibody molecules (e.g., scFv, scFab), and single-domain antibodies. For a review of certain antibody fragments, see Hudson et al., Nat Med 9, 129-134 (2003). For a review of scFv fragments, see e.g., Plckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994); see also WO 93/16185; and U.S. Pat. Nos. 5,571,894 and 5,587,458. Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat Med 9, 129-134 (2003); and Hollinger et al., Proc Natl Acad Sci USA 90, 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat Med 9, 129-134 (2003). Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody (Domantis, Inc., Waltham, Mass.; see e.g., U.S. Pat. No. 6,248,516 B1). Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.

[0060] As used herein, the term antigen binding molecule refers in its broadest sense to a molecule that specifically binds an antigenic determinant. Examples of antigen binding molecules are antibodies/immunoglobulins and derivatives, e.g., fragments, thereof. Furthermore, the term relates, as discussed herein, to modified and/or altered antigen binding molecules, in particular to modified antibody molecules. The term also relates to recombinantly or synthetically generated/synthesized antibodies. In the context of the present invention the antigen binding molecule is preferably an antibody or fragment thereof.

[0061] As used herein, the term antigen binding moiety refers to a polypeptide molecule that specifically binds to an antigenic determinant. In one embodiment, an antigen binding moiety is able to direct the entity to which it is attached (e.g., an immunoglobulin or a CAR) to a target site, for example to a specific type of tumor cell or tumor stroma bearing the antigenic determinant or to an immunoglobulin binding to the antigenic determinant on a tumor cell. In another embodiment an antigen binding moiety is able to activate signaling through its target antigen, for example signaling is activated upon binding of an antigenic determinant to a CAR on a T cell. In the context of the present invention, antigen binding moieties may be included in antibodies and fragments thereof as well as in antigen binding receptors (e.g., CARs) and fragments thereof as further defined herein. Antigen binding moieties include an antigen binding domain, e.g., comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region.

[0062] In the context of the present invention the term antigen binding receptor relates to a molecule comprising an anchoring transmembrane domain and an extracellular domain comprising at least one antigen binding moiety. An antigen binding receptor (e.g., a CAR) can be made of polypeptide parts from different sources. Accordingly, it may be also understood as a fusion protein and/or a chimeric protein. Usually, fusion proteins are proteins created through the joining of two or more genes (or preferably cDNAs) that originally coded for separate proteins. Translation of this fusion gene (or fusion cDNA) results in a single polypeptide, preferably with functional properties derived from each of the original proteins. Recombinant fusion proteins are created artificially by recombinant DNA technology for use in biological research or therapeutics. In the context of the present invention a CAR (chimeric antigen receptor) is understood to be an antigen binding receptor comprising an extracellular portion comprising an antigen binding moiety fused by a spacer sequence to an anchoring transmembrane domain which is itself fused to the intracellular signaling domains of e.g., CD3z and CD28.

[0063] An antigen binding site refers to the site, i.e., one or more amino acid residues, of an antigen binding molecule which provides interaction with the antigen. A native immunoglobulin molecule typically has two antigen binding sites, a Fab or a scFv molecule typically has a single antigen binding site.

[0064] The term antigen binding domain refers to the part of an antibody or an antigen binding receptor (e.g., a CAR) that comprises the area which specifically binds to and is complementary to part or all of an antigen. An antigen binding domain may be provided by, for example, one or more immunoglobulin variable domains (also called variable regions). Particularly, an antigen binding domain comprises an immunoglobulin light chain variable region (VL) and an immunoglobulin heavy chain variable region (VH).

[0065] The term variable region or variable domain refers to the domain of an immunoglobulin heavy or light chain that is involved in binding the antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al., Kuby Immunology, 6.sup.th ed., W.H. Freeman and Co, page 91 (2007). A single VH or VL domain is usually sufficient to confer antigen-binding specificity.

[0066] The term ATD as used herein refers to anchoring transmembrane domain which defines a polypeptide stretch capable of integrating in (the) cellular membrane(s) of a cell. The ATD can be fused to further extracellular and/or intracellular polypeptide domains wherein these extracellular and/or intracellular polypeptide domains will be confined to the cell membrane as well. In the context of the antigen binding receptors as used in the present invention the ATD confers membrane attachment and confinement of the antigen binding receptor, e.g., a CAR used according to the present invention.

[0067] The term bin ding to as used in the context of the antigen binding receptors (e.g., CARs) and antibodies used according to the present invention defines a binding (interaction) of an antigen-interaction-site and an antigen with each other. The term antigen-interaction-site defines a motif of a polypeptide which shows the capacity of specific interaction with a specific antigen or a specific group of antigens. Said binding/interaction is also understood to define a specific recognition. The term specifically recognizing means in accordance with this invention that the antigen binding receptor is capable of specifically interacting with and/or binding to the recognition domain, i.e., a modified molecule as defined herein whereas the non-modified molecule is not recognized. The antigen binding moiety of an antigen binding receptor (e.g., a CAR) can recognize, interact and/or bind to different epitopes on the same molecule. This term relates to the specificity of the antigen binding receptor, i.e., to its ability to discriminate between the specific regions of a modified molecule, i.e., a modified Fc domain, as defined herein. The specific interaction of the antigen-interaction-site with its specific antigen may result in an initiation of a signal, e.g., due to the induction of a change of the conformation of the polypeptide comprising the antigen, an oligomerization of the polypeptide comprising the antigen, an oligomerization of the antigen binding receptor, etc. Thus, a specific motif in the amino acid sequence of the antigen-interaction-site and the antigen bind to each other as a result of their primary, secondary or tertiary structure as well as the result of secondary modifications of said structure. The term binding to does not only relate to a linear epitope but may also relate to a conformational epitope, a structural epitope or a discontinuous epitope consisting of two regions of the target molecules or parts thereof. In the context of this invention, a conformational epitope is defined by two or more discrete amino acid sequences separated in the primary sequence which comes together on the surface of the molecule when the polypeptide folds to the native protein (Sela, Science 166 (1969), 1365 and Laver, Cell 61 (1990), 553-536). Moreover, the term binding to is interchangeably used in the context of the present invention with the term interacting with. The ability of the antigen binding moiety (e.g., a Fab or scFv domain) of a CAR or an antibody to bind to a specific target antigenic determinant can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g., surface plasmon resonance (SPR) technique (analyzed on a BIAcore instrument) (Liljeblad et al., Glyco J 17, 323-329 (2000)), and traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002)). In one embodiment, the extent of binding of an antigen binding moiety to an unrelated protein is less than about 10% of the binding of the antigen binding moiety to the target antigen as measured, in particular by SPR. In certain embodiments, an antigen binding moiety that binds to the target antigen, has a dissociation constant (K.sub.D) of 1 M, 100 nM, 10 nM, 1 nM, 0.1 nM, 0.01 nM, or 0.001 nM (e.g., 10.sup.8 M or less, e.g., from 10.sup.8 M to 10.sup.13M, e.g., from 10.sup.9M to 10.sup.13 M). An antigen binding moiety is said to specifically bind to a target antigen when the antigen binding moiety has a K.sub.D of 1 M or less and such interaction is herein referred to as specific binding. The antigen binding receptor (e.g., the CAR) used according to the invention specifically binds to/interacts with a recognition domain, e.g., an Fc domain, preferably a modified Fc domain. Cross-reactivity of a panel of constructs under investigation may be tested, for example, by assessing binding of a panel of antigen binding moieties under conventional conditions (see, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, (1988) and Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, (1999)) to the recognition domain of interest, e.g., a modified Fc domain as well as to parent non-modified Fc domain. Only those constructs (i.e., Fab fragments, scFvs and the like) that bind to the domain of interest but do not or do not essentially bind to structurally closely related domain, e.g., a non-modified Fc domain, are considered specific for the recognition domain of interest and selected for further studies in accordance with the method provided herein. These methods may comprise, inter alia, binding studies, blocking and competition studies with structurally and/or functionally closely related domains. The binding studies also comprise FACS analysis, surface plasmon resonance (SPR, e.g., with BIAcore), analytical ultracentrifugation, isothermal titration calorimetry, fluorescence anisotropy, fluorescence spectroscopy or by radiolabeled ligand binding assays.

[0068] The term CDR as employed herein relates to complementary determining region, which is well known in the art. The CDRs are parts of immunoglobulins or antigen binding receptors that determine the specificity of said molecules and make contact with a specific ligand. The CDRs are the most variable part of the molecule and contribute to the antigen binding diversity of these molecules. There are three CDR regions CDR1, CDR2 and CDR3 in each V domain. CDR-H depicts a CDR region of a variable heavy chain and CDR-L relates to a CDR region of a variable light chain. VH means the variable heavy chain and VL means the variable light chain. The CDR regions of an Ig-derived region may be determined as described in Kabat (Sequences of Proteins of Immunological Interest, 5th edit. NIH Publication no. 91-3242 U.S. Department of Health and Human Services (1991); Chothia J. Mol. Biol. 196 (1987), 901-917) or Chothia (Nature 342 (1989), 877-883).

[0069] The term CD3z refers to T-cell surface glycoprotein CD3 zeta chain, also known as T-cell receptor T3 zeta chain and CD247.

[0070] The term chimeric antigen receptor or chimeric receptor or CAR refers to an antigen binding receptor constituted of an extracellular portion of an antigen binding moiety (e.g., a scFv or a Fab) fused by a spacer sequence to intracellular signaling domains (e.g., of CD3z and CD28).

[0071] The class of an antibody or immunoglobulin refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, and IgA.sub.2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called , , , , and , respectively.

[0072] By a crossover Fab molecule (also termed crossFab or crossover Fab fragment) is meant a Fab molecule wherein either the variable regions or the constant regions of the Fab heavy and light chain are exchanged, i.e., the crossFab fragment comprises a peptide chain composed of the light chain variable region and the heavy chain constant region, and a peptide chain composed of the heavy chain variable region and the light chain constant region. For clarity, in a crossFab fragment wherein the variable regions of the Fab light chain and the Fab heavy chain are exchanged, the peptide chain comprising the heavy chain constant region is referred to herein as the heavy chain of the crossover Fab molecule. Conversely, in a crossFab fragment wherein the constant regions of the Fab light chain and the Fab heavy chain are exchanged, the peptide chain comprising the heavy chain variable region is referred to herein as the heavy chain of the crossFab fragment. Accordingly, a crossFab fragment comprises a heavy or light chain composed of the heavy chain variable and the light chain constant regions (VH-CL), and a heavy or light chain composed of the light chain variable and the heavy chain constant regions (VL-CH1). In contrast thereto, by a Fab or conventional Fab molecule is meant a Fab molecule in its natural format, i.e., comprising a heavy chain composed of the heavy chain variable and constant regions (VH-CH1), and a light chain composed of the light chain variable and constant regions (VL-CL).

[0073] The term CSD as used herein refers to co-stimulatory signaling domain.

[0074] The term effector functions refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g., B cell receptor), and B cell activation.

[0075] As used herein, the terms engineer, engineered, engineering, are considered to include any manipulation of the peptide backbone or the post-translational modifications of a naturally occurring or recombinant polypeptide or fragment thereof. Engineering includes modifications of the amino acid sequence, of the glycosylation pattern, or of the side chain group of individual amino acids, as well as combinations of these approaches.

[0076] The term expression cassette refers to a polynucleotide generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell. The recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Typically, the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.

[0077] A Fab molecule refers to a protein consisting of the VH and CH1 domain of the heavy chain (the Fab heavy chain) and the VL and CL domain of the light chain (the Fab light chain) of an antigen binding molecule.

[0078] The term Fc domain or Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an IgG heavy chain might vary slightly, the human IgG heavy chain Fc region is usually defined to extend from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991. A subunit of an Fc domain as used herein refers to one of the two polypeptides forming the dimeric Fc domain, i.e., a polypeptide comprising C-terminal constant regions of an immunoglobulin heavy chain, capable of stable self-association. For example, a subunit of an IgG Fc domain comprises an IgG CH2 and an IgG CH3 constant domain.

[0079] Framework or FR refers to variable domain residues other than hypervariable region (HVR) residues. The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.

[0080] The term full length antibody denotes an antibody consisting of two full length antibody heavy chains and two full length antibody light chains. A full length antibody heavy chain is a polypeptide consisting in N-terminal to C-terminal direction of an antibody heavy chain variable domain (VH), an antibody constant heavy chain domain 1 (CH1), an antibody hinge region (HR), an antibody heavy chain constant domain 2 (CH2), and an antibody heavy chain constant domain 3 (CH3), abbreviated as VH-CH1-HR-CH2-CH3; and optionally an antibody heavy chain constant domain 4 (CH4) in case of an antibody of the subclass IgE. Preferably the full length antibody heavy chain is a polypeptide consisting in N-terminal to C-terminal direction of VH, CH1, HR, CH2 and CH3. A full length antibody light chain is a polypeptide consisting in N-terminal to C-terminal direction of an antibody light chain variable domain (VL), and an antibody light chain constant domain (CL), abbreviated as VL-CL. The antibody light chain constant domain (CL) can be (kappa) or (lambda). The two full length antibody chains are linked together via inter-polypeptide disulfide bonds between the CL domain and the CH1 domain and between the hinge regions of the full length antibody heavy chains. Examples of typical full length antibodies are natural antibodies like IgG (e.g., IgG 1 and IgG2), IgM, IgA, IgD, and IgE.) The full length antibodies used according to the invention can be from a single species e.g., human, or they can be chimerized or humanized antibodies. In some embodiments, the full length antibodies used according to the invention, comprise two antigen binding sites each formed by a pair of VH and VL, which both specifically bind to the same antigen. In further embodiments, the full length antibodies used according to the invention comprise two antigen binding sites each formed by a pair of VH and VL, wherein the two antigen binding sites bind to different antigens, e.g., wherein the antibodies are bispecific. The C-terminus of the heavy or light chain of said full length antibody denotes the last amino acid at the C-terminus of said heavy or light chain.

[0081] By fused is meant that the components (e.g., a Fab and a transmembrane domain) are linked by peptide bonds, either directly or via one or more peptide linkers.

[0082] The terms host cell, host cell line and host cell culture are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include transformants and transformed cells which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein. A host cell is any type of cellular system that can be used to generate an antibody used according to the present invention. Host cells include cultured cells, e.g., mammalian cultured cells, such as CHO cells, BHK cells, NS0 cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.

[0083] The term hypervariable region or HVR, as used herein, refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops (hypervariable loops). Generally, native four-chain antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). HVRs generally comprise amino acid residues from the hypervariable loops and/or from the complementarity determining regions (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition. With the exception of CDR1 in VH, CDRs generally comprise the amino acid residues that form the hypervariable loops. Hypervariable regions (HVRs) are also referred to as complementarity determining regions (CDRs), and these terms are used herein interchangeably in reference to portions of the variable region that form the antigen binding regions. This particular region has been described by Kabat et al., U.S. Dept. of Health and Human Services, Sequences of Proteins of Immunological Interest (1983) and by Chothia et al., J Mol Biol 196:901-917 (1987), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody and/or an antigen binding receptor or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison. The exact residue numbers which encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody.

TABLE-US-00001 TABLE 1 CDR Definitions.sup.1 CDR Kabat Chothia AbM.sup.2 V.sub.H CDR1 31-35 26-32 26-35 V.sub.H CDR2 50-65 52-58 50-58 V.sub.H CDR3 95-102 95-102 95-102 V.sub.L CDR1 24-34 26-32 24-34 V.sub.L CDR2 50-56 50-52 50-56 V.sub.L CDR3 89-97 91-96 89-97 .sup.1Numbering of all CDR definitions in Table 1 is according to the numbering conventions set forth by Kabat et al. (see below). .sup.2AbM with a lowercase b as used in Table 1 refers to the CDRs as defined by Oxford Molecular's AbM antibody modeling software.

[0084] Kabat et al. also defined a numbering system for variable region sequences that is applicable to any antibody. One of ordinary skill in the art can unambiguously assign this system of Kabat numbering to any variable region sequence, without reliance on any experimental data beyond the sequence itself. As used herein, Kabat numbering refers to the numbering system set forth by Kabat et al., U.S. Dept. of Health and Human Services, Sequence of Proteins of Immunological Interest (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an antigen binding moiety variable region are according to the Kabat numbering system. The polypeptide sequences of the sequence listing are not numbered according to the Kabat numbering system. However, it is well within the ordinary skill of one in the art to convert the numbering of the sequences of the Sequence Listing to Kabat numbering.

[0085] An individual or subject is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). Particularly, the individual or subject is a human.

[0086] By isolated nucleic acid molecule or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment. For example, a recombinant polynucleotide encoding a polypeptide contained in a vector is considered isolated for the purposes of the present invention. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution. An isolated polynucleotide includes a polynucleotide molecule contained in cells that ordinarily contain the polynucleotide molecule, but the polynucleotide molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location. Isolated RNA molecules include in vivo or in vitro RNA transcripts of the present invention, as well as positive and negative strand forms, and double-stranded forms. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically. In addition, a polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.

[0087] By a nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% identical to a reference nucleotide sequence of the present invention, it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the 5 or 3 terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence. As a practical matter, whether any particular polynucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs, such as the ones discussed below for polypeptides (e.g., ALIGN-2).

[0088] By an isolated polypeptide or a variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required. For example, an isolated polypeptide can be removed from its native or natural environment. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.

[0089] Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary. In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y; where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.

[0090] The term nucleic acid molecule relates to the sequence of bases comprising purine- and pyrimidine bases which are comprised by polynucleotides, whereby said bases represent the primary structure of a nucleic acid molecule. Herein, the term nucleic acid molecule includes DNA, cDNA, genomic DNA, RNA, synthetic forms of DNA and mixed polymers comprising two or more of these molecules. In addition, the term nucleic acid molecule includes both, sense and antisense strands. Moreover, the herein described nucleic acid molecule may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those skilled in the art.

[0091] As used herein NFAT refers to the nuclear factor of activated T-cells and is a family of transcription factors which is expressed in most immune cells. Activation of transcription factors of the NFAT family is dependent on calcium signaling. As an example, T cell activation through the T cell synapse results in calcium influx. Increased intracellular calcium levels activate the calcium-sensitive phosphatase, calcineurin, which rapidly dephosphorylates the serine-rich region (SRR) and SP-repeats in the amino termini of NFAT proteins. This results in a conformational change that exposes a nuclear localization signal promoting NFAT nuclear import and activation of target genes.

[0092] As used herein NFAT pathway refers to the stimuli that lead to modulation of activity of member of the NFAT family of transcription factors. NFAT DNA elements are known to the art and are herein also referred to as response element of the NFAT pathway. Hence, a receptor of the NFAT pathway refers to a receptor which can trigger the modulation of activity of NFAT. Examples of a receptor of the NFAT pathway are e.g., T cell receptor and B cell receptor.

[0093] As used herein NF-B refers to the nuclear factor kappa-light-chain-enhancer of activated B cells and is a transcription factor which is implicated in the regulation of many genes that code for mediators of apoptosis, viral replication, tumorigenesis, various autoimmune diseases and inflammatory responses. NFB is present in almost all eukaryotic cells. Generally, it is located in the cytosol in an inactive state, since it forms a complex with inhibitory kappa B (IB) proteins. Through the binding of ligands to integral membrane receptors (also referred to as receptors of the NF-B pathway, the IB kinase (IKK) is activated. IKK is an enzyme complex which consists of two kinases and a regulatory subunit. This complex phosphorylates the IB proteins, which leads to ubiquitination and therefore degradation of those proteins by the proteasome. Finally, the free NFB is in an active state, translocates to the nucleus and binds to the B DNA elements and induces transcription of target genes.

[0094] As used herein NF-B pathway refers to the stimuli that lead to modulation of activity of NF-B. For example activation of the Toll-like receptor signaling, TNF receptor signaling, T cell receptor and B cell receptor signaling through either binding of a ligand or an antibody result in activation of NF-B. Subsequently, phosphorylated NF-B dimers bind to B DNA elements and induce transcription of target genes. B DNA elements are known in the art and herein also referred to as response element of the NF-B pathway. Hence, a receptor of the NF-B pathway refers to a receptor which can trigger the modulation of activity of NF-B. Examples of a receptor of the NF-B pathway are Toll-like receptors, TNF receptors, T cell receptor and B cell receptor.

[0095] As used herein AP-1 refers to the activator protein 1 and is a transcription factor which is involved a number of cellular processes including differentiation, proliferation, and apoptosis. AP-1 functions are dependent on the specific Fos and Jun subunits contributing to AP-1 dimers. AP-1 binds to a palindromic DNA motif (5-TGA G/C TCA-3) to regulate gene expression.

[0096] The term pharmaceutical composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. A pharmaceutical composition usually comprises one or more pharmaceutically acceptable carrier(s).

[0097] A pharmaceutically acceptable carrier refers to an ingredient in a pharmaceutical composition, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.

[0098] As used herein, the term polypeptide refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). The term polypeptide refers to any chain of two or more amino acids, and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, protein, amino acid chain, or any other term used to refer to a chain of two or more amino acids, are included within the definition of polypeptide, and the term polypeptide may be used instead of, or interchangeably with any of these terms. The term polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis. A polypeptide of the invention may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids. Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, and are referred to as unfolded.

[0099] The term polynucleotide refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA). A polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA). The term nucleic acid molecule refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide.

[0100] The term protein with intrinsic fluorescence refers to a protein capable of forming a highly fluorescent, intrinsic chromophore either through the cyclization and oxidation of internal amino acids within the protein or via the enzymatic addition of a fluorescent co-factor. The term protein with intrinsic fluorescence includes wild-type fluorescent proteins and mutants that exhibit altered spectral or physical properties. The term does not include proteins that exhibit weak fluorescence by virtue only of the fluorescence contribution of non-modified tyrosine, tryptophan, histidine and phenylalanine groups within the protein. Proteins with intrinsic fluorescence are known in the art, e.g., green fluorescent protein (GFP), red fluorescent protein (RFP), Blue fluorescent protein (BFP, Heim et al. 1994, 1996), a cyan fluorescent variant known as CFP (Heim et al. 1996; Tsien 1998); a yellow fluorescent variant known as YFP (Oruro et al. 1996; Wachter et al. 1998); a violet-excitable green fluorescent variant known as Sapphire (Tsien 1998; Zapata-Hommer et al. 2003); and a cyan-excitable green fluorescing variant known as enhanced green fluorescent protein or EGFP (Yang et al. 1996) and can be measured e.g., by live cell imaging (e.g., Incucyte) or fluorescent spectrophotometry.

[0101] Reduced binding refers to a decrease in affinity for the respective interaction, as measured for example by SPR. For clarity the term includes also reduction of the affinity to zero (or below the detection limit of the analytic method), i.e., complete abolishment of the interaction. Conversely, increased binding refers to an increase in binding affinity for the respective interaction.

[0102] The term regulatory sequence refers to DNA sequences, which are necessary to effect the expression of coding sequences to which they are ligated. The nature of such control sequences differs depending upon the organism. In prokaryotes, control sequences generally include promoter, ribosomal binding site, and terminators. In eukaryotes generally control sequences include promoters, terminators and, in some instances, enhancers, transactivators or transcription factors. The term control sequence is intended to include, at a minimum, all components the presence of which are necessary for expression, and may also include additional advantageous components.

[0103] As used herein, a reporter gene means a gene whose expression can be assayed. In one preferred embodiment a reporter gene is a gene that encodes a protein the production and detection of which is used as a surrogate to detect indirectly the activity of the antibody or ligand to be tested. The reporter protein is the protein encoded by the reporter gene. Preferably, the reporter gene encodes an enzyme whose catalytic activity can be detected by a simple assay method or a protein with a property such as intrinsic fluorescence or luminescence so that expression of the reporter gene can be detected in a simple and rapid assay requiring minimal sample preparation. Non-limiting examples of enzymes whose catalytic activity can be detected are Luciferase, beta Galactosidase, Alkaline Phosphatase. Luciferase is a monomeric enzyme with a molecular weight (MW) of 61 kDa. It acts as a catalysator and is able to convert D-luciferin in the presence of Adenosine triphosphate (ATP) and Mg2+ to luciferyl adenylate. In addition, pyrophosphate (PPi) and adenosine monophosphate (AMP) are generated as byproducts. The intermediate luciferyl adenylate is then oxidized to oxyluciferin, carbon dioxide (CO.sub.2) and light. Oxyluciferin is a bioluminescent product which can be quantitatively measured in a luminometer by the light released from the reaction. Luciferase reporter assays are commercially available and known in the art, e.g., Luciferase 1000 Assay System and ONE-Glo Luciferase Assay System.

[0104] A response element refers to a specific transcription factor binding element, or cis acting element which can be activated or silenced on binding of a certain transcription factor. In one embodiment the response element is a cis-acting enhancer element located upstream of a minimal promotor (e.g., a TATA box promotor) which drives expression of the reporter gene upon transcription factor binding.

[0105] As used herein, the term single-chain refers to a molecule comprising amino acid monomers linearly linked by peptide bonds. In certain embodiments, one of the antigen binding moieties is a scFv fragment, i.e., a VH domain and a VL domain connected by a peptide linker. In certain embodiments, one of the antigen binding moieties is a single-chain Fab molecule, i.e., a Fab molecule wherein the Fab light chain and the Fab heavy chain are connected by a peptide linker to form a single peptide chain. In a particular such embodiment, the C-terminus of the Fab light chain is connected to the N-terminus of the Fab heavy chain in the single-chain Fab molecule.

[0106] The term SSD as used herein refers to stimulatory signaling domain.

[0107] As used herein, treatment (and grammatical variations thereof such as treat or treating) refers to clinical intervention in an attempt to alter the natural course of a disease in the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.

[0108] In the context of the present invention, the term tag refers to a molecule attached or engrafted to or onto a biomolecule such as a protein, particularly an antigen binding molecule. The function of a tag is to mark or label the tagged protein (e.g., an immunoglobulin or fragment thereof) such that it can be recognized by a specific antigen binding moiety capable of binding to the tag but not capable of binding to the untagged protein. The term is synonymous to molecular tag and comprises without being limited to fluorescent tags, protein tags, affinity tags, solubilization tags, chromatography tags, epitope tags and small molecule tags such as hapten tags. Small molecule tags, e.g., haptens, can be chemically coupled covalently or non-covalently to the biomolecule whereas protein tags or polypeptide tags are peptide sequences which can be genetically grafted onto a protein and subsequently be recognized by specific antigen binding moieties capable of binding to the tag but not capable of binding to the untagged protein. Hapten tags are able to elicit an immune response when attached to a carrier protein, and, therefore, are suitable to generate specific antigen binding moieties capable of recognizing the tag on a carrier such as a protein. In preferred embodiments of the present invention, the tag is a hapten tag or a polypeptide tag.

[0109] As used herein, the term target antigenic determinant is synonymous with target antigen, target epitope and target cell antigen and refers to a site (e.g., a contiguous stretch of amino acids or a conformational configuration made up of different regions of non-contiguous amino acids) on a polypeptide macromolecule to which an antibody binds, forming an antigen binding moiety-antigen complex. Useful antigenic determinants can be found, for example, on the surfaces of tumor cells (e.g., tumor target antigens), on the surfaces of virus-infected cells, on the surfaces of other diseased cells, on the surface of immune cells, free in blood serum, and/or in the extracellular matrix (ECM). The proteins referred to as antigens herein (e.g., CD20, CD38, CD138, CEA, EGFR, FolR1, HER2, LeY, MCSP, STEAP1, TYRP1, and WT1) can be any native form of the proteins from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. In a particular embodiment the target antigen is a human protein. Where reference is made to a specific target protein herein, the term encompasses the full-length, unprocessed target protein as well as any form of the target protein that results from processing in the target cell. The term also encompasses naturally occurring variants of the target protein, e.g., splice variants or allelic variants. Exemplary human target proteins useful as antigens include, but are not limited to: CD20, CD38, CD138, CEA, EGFR, FolR1, HER2, LeY, MCSP, STEAP1, TYRP1, and WT1.

[0110] Antibodies may have one, two, three or more binding domains and may be monospecific, bispecific or multispecific. The antibodies can be full length from a single species, or be chimerized or humanized. For an antibody with more than two antigen binding domains, some binding domains may be identical and/or have the same specificity.

[0111] T cell activation as used herein refers to one or more cellular response of a T lymphocyte, particularly a cytotoxic T lymphocyte, selected from: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers. Suitable assays to measure T cell activation are known in the art and described herein.

[0112] In accordance with this invention, the term T cell receptor or TCR is commonly known in the art. In particular, herein the term T cell receptor refers to any T cell receptor, provided that the following three criteria are fulfilled: (i) tumor specificity, (ii) recognition of (most) tumor cells, which means that an antigen or target should be expressed in (most) tumor cells and (iii) that the TCR matches to the HLA-type of the subjected to be treated. In this context, suitable T cell receptors which fulfill the above mentioned three criteria are known in the art such as receptors recognizing NY-ESO-1 (for sequence information(s) see, e.g., PCT/GB2005/001924) and/or HER2neu (for sequence information(s) see WO-A1 2011/0280894). Major histocompatibility complex (MHC) class I molecules present peptides from endogenous antigens to CD8+ cytotoxic T cells, and therefore, MHC-peptide complexes are a suitable target for immunotherapeutic approaches. The MHC-peptide complexes can be targeted by recombinant T-cell receptors (TCRs). However, most TCRs may have affinities which are too low for immunotherapy whereas high affinity binding moieties with TCR specificity would be beneficial. Towards this end, high-affinity soluble antibody molecules with TCR-like specificity can be generated, e.g., by generating phage display libraries (e.g., combinatorial libraries) and screening such libraries as further described herein. These soluble antigen binding moieties e.g., scFv or Fab, with TCR-like specificity as described herein are referred to as T cell receptor like antigen binding moieties or TCRL antigen binding moieties.

[0113] A therapeutically effective amount of an agent, e.g., a pharmaceutical composition, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. A therapeutically effective amount of an agent for example eliminates, decreases, delays, minimizes or prevents adverse effects of a disease.

[0114] The term vector or expression vector is synonymous with expression construct and refers to a DNA molecule that is used to introduce and direct the expression of a specific gene to which it is operably associated in a target cell. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. The expression vector of the present invention comprises an expression cassette. Expression vectors allow transcription of large amounts of stable mRNA. Once the expression vector is inside the target cell, the ribonucleic acid molecule or protein that is encoded by the gene is produced by the cellular transcription and/or translation machinery. In one embodiment, the expression vector of the invention comprises an expression cassette that comprises polynucleotide sequences that encode antigen binding receptors of the invention or fragments thereof.

[0115] In this context, provided herein are diagnostic methods, particularly in vitro methods, for detecting target antigens on cells, in particular tumor cells (i.e. tumor target antigens), in a sample. In a preferred embodiment, the sample is a patient sample, e.g., deriving from a biopsy or a body fluid in which aberrant cells need to be detected. The assays of the present invention combine the high specificity of chimeric antigen receptors (CARs) comprising antigen binding moieties, in particular scFv and/or Fab fragments, with the sensitivity of luminescence detection of a reporter signal. In the herein described diagnostic methods and assays, the target antigen binding molecule as herein described mediates the contact between a target cell, in particular a cancer cell, and a reporter cell, in particular a T cell. In this context, the methods as described herein are useful to detect a cancer cell based on the specificity of binding of an antigen binding molecule and a CAR capable of specific interaction with the antigen binding molecule wherein the CAR is introduced in a suitable reporter cells, preferably a reporter T cell, e.g., a Jurkat cell.

[0116] Accordingly, in one embodiment, provided is a diagnostic assay for determining the presence of a tumor cell in a sample, the diagnostic assay comprising the steps of: [0117] a) contacting the sample with an antigen binding molecule comprising an antigen binding domain and a recognition domain, wherein the antigen binding domain comprises a target antigen binding moiety capable of specific binding to the tumor cell; [0118] b) contacting the sample with a chimeric antigen receptor (CAR) expressing reporter T (CAR-T) cell wherein the reporter CAR-T cell comprises: [0119] i. a CAR capable of specific binding to the recognition domain, wherein the CAR is operationally coupled to a response element; [0120] ii. a reporter gene under the control of the response element; and [0121] c) determining T cell activation by measuring the expression of the reporter gene to establish the presence of the tumor cell.

[0122] Further provided are transduced T cells capable of expression of the herein described CAR molecule(s). The transduced T cells further comprise a reporter gene under the control of a response element, wherein the CAR is operationally coupled to the response element as herein described. Upon binding of the target antigen binding moiety to the target cell, e.g., the tumor cell, and binding of the CAR to the recognition domain, the reporter CAR-T cell becomes activated and the reporter gene is expressed. Expression of the reporter gene is therefore indicative for (specific) binding of the antigen binding molecule comprising the target antigen binding moiety in the context of T cell activation induced by interaction of a T cell to a target antigen, e.g., on a tumor cell.

[0123] Binding of the reporter CAR-T cell to the target cell is mediated by an antigen binding molecule capable of specific binding to the target cell, wherein the antigen binding molecules can be specifically detected by the reporter CAR-T cells. In this context further described and used for the diagnostic assay of the present invention are CARs capable of specific binding to an antigen binding molecule. In one embodiment, the antigen binding molecule comprises an antigen binding domain and a recognition domain, wherein the antigen binding domain comprises the target antigen binding moiety, and wherein the CAR is capable of specific binding to the recognition domain. In this context further described and used for the diagnostic assay of the present invention are CARs capable of specific binding to the recognition domain of the antigen binding molecule comprising the target antigen binding moiety. The recognition domain can be any polypeptide domain capable of stable folding into a protein domain which can be tagged by a molecular tag, e.g., a hapten tag or a polypeptide tag. Alternatively, the recognition domain can comprise a mutation which is specifically detected by an antigen binding moiety. Tagging, e.g., with a hapten tag or polypeptide tag, and mutating the recognition domain renders the recognition domain distinct from a non-modified domain, therefore providing an identifiable epitope for detection by an antigen binding moiety. The identifiable epitope does not naturally occur in the sample wherein target cells need to be specifically recognized.

[0124] In certain embodiments, the recognition domain is an immunoglobulin domain. Immunoglobulins typically comprise variable and constant domains capable of stable folding wherein the variable domains confer the specificity of the immunoglobulin molecule towards a target antigen. Accordingly, the variable domains are the parts of an immunoglobulin with the highest degree of sequence variance. On the other hand, the constant domains are parts of minimal variance among immunoglobulins of the same class and, therefore, are particularly suited in the context of this invention as recognition domain for methods of the present invention. However, it may also be favorable to reduce the size of the antigen binding molecule as far as possible, in such embodiments, the variable domain of an immunoglobulin, which confer the specificity to a target antigen, can also exert the function of the recognition domain, i.e., the antigen binding domain and the recognition domain can be the same domain, e.g., the variable domain can be coupled with, e.g., a hapten tag or a polypeptide tag, or alternatively, the hapten tag is coupled to the constant region of a Fab fragment. In one embodiment, the antigen binding molecule comprises a Fab domain, particularly an IgG Fab domain, most particularly an IgG1 Fab domain. In one embodiment, the antigen binding molecule comprises a modified Fab domain, particularly a Fab domain comprising a tag (e.g., a hapten tag or a polypeptide tag) for specific recognition by the CAR.

[0125] In another embodiment, the antigen binding molecule comprises a modified Fc region, e.g., a mutated Fc region or an Fc region comprising a tag (e.g., a hapten tag or a polypeptide tag) for specific recognition by the CAR. In such embodiments, the CAR used according to the present invention is capable of specific binding to the modified Fc region.

[0126] In one embodiment, the modified Fc region is a mutated Fc. In a particular embodiment, the mutated Fc domain comprises at least one amino acid mutation at a position selected from the group consisting of L234, L235, 1253, H310, P331, P329 and H435 according to EU numbering, in particular wherein the amino acid mutation is L234A, L235A, I253A, N297A, H310A, P329G, P331G and/or H435A. Further provided herein is the use of antigen binding moieties capable of specific binding to the mutated Fc domain but not capable of specific binding to the non-mutated parent Fc domain. The antigen binding molecule preferably is an IgG class antibody, particularly an IgG1 or IgG4 isotype antibody, or a fragment thereof. In one particular embodiment, the antigen binding molecule is an IgG1 class antibody comprising an IgG1 Fc domain. In one embodiment, the IgG1 Fc domain is a human IgG1 Fc domain.

[0127] Accordingly, in one embodiment, the human IgG1 Fc domain is mutated. In one embodiment, the mutant human IgG1 Fc domain comprises an amino acid substitution at a position selected from the group consisting of residue 117, 118, 136, 180, 193, 212, 214, and 318 of human IgG1 Fc (SEQ ID NO:132). In one embodiment, the mutant human IgG1 Fc comprises the amino acid substitution leucine to alanine at residue 117, leucine to alanine at residue 118, isoleucine to alanine at position 136, asparagine to alanine at residue 180, histidine to alanine at residue 193, proline to glycine at residue 212, proline to glycine at residue 214, and/or or histidine to alanine at residue 318 of human IgG1 Fc (SEQ ID NO:132). In one embodiment, the mutant human IgG1 Fc domain comprises an amino acid substitution at the position of residue 212 of human IgG1 Fc (SEQ ID NO:132). In one embodiment, the mutant human IgG1 Fc domain comprises the amino acid substitution proline to glycine at residue 212 of human IgG1 Fc (SEQ ID NO:132).

[0128] In another embodiment, the modified Fc domain comprises a hapten tag. In particular embodiments, the hapten tag is selected from the group consisting of Biotin, Digoxigenin (DIG) and Fluorescein (FITC).

[0129] In another embodiment, modified Fc domain comprises a polypeptide tag. In one embodiment, the polypeptide tag has a length of from 1 to 30 amino acids, from 1 to 25 amino acids, from 1 to 20 amino acids, from 1 to 15 amino acids or from 1 to 10 amino acids. In particular embodiments, the polypeptide tag is selected from the group consisting of myc-tag, HA-tag, AviTag, FLAG-tag, His-tag, GCN4-tag, and NE-tag.

[0130] The present invention further describes the transduction and use of T cells, such as CD8+ T cells, CD4+ T cells, CD3+ T cells, T cells or natural killer (NK) T cells and immortalized cell lines, e.g., Jurkat cells, to introduce a reporter system as described herein and (a) CAR(s) as described herein and their targeted recruitment through an antigen binding molecule, comprising the target antigen binding moiety and the recognition domain, preferably an Fc domain or a Fab domain, e.g., a modified Fc domain or Fab fragment as herein described. In one embodiment, the antigen binding molecule, e.g., the modified IgG1 antibody or tagged Fab fragment, is capable of specific binding to a tumor-specific antigen that is naturally occurring on the surface of a target cell, e.g., a cancer cell. In an alternative embodiment, the herein described CAR is capable of direct binding to a target antigen on the surface of the target cell, e.g., on the surface of a tumor cell.

[0131] Accordingly, the invention provides a versatile diagnostic platform wherein CARs may be used as a guidance for immune cells (e.g., T cells), in particular wherein T cells are specifically targeted toward the tumor cells by the CARs and antigen binding molecules as described herein. After engagement of the CAR to the target antigen on the surface of a tumor cell (mediated by the antigen binding molecule), the reporter T cell becomes activated wherein the activation can be measured, e.g., by read-out of a fluorescent or luminescent signal. The platform is flexible and specific by allowing the use of diverse existing or newly developed target antigen binding moieties or co-application of multiple antibodies with different antigen specificity but comprising the same recognition domain.

[0132] Antigen binding moieties capable of specific binding to a target antigen, e.g., a tumor antigen or a recognition domain, e.g., a modified Fc domain, may be generated by immunization of e.g., a mammalian immune system. Such methods are known in the art and e.g., are described in Burns in Methods in Molecular Biology 295:1-12 (2005). Alternatively, antigen binding moieties of desired activity may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. Methods for screening combinatorial libraries are reviewed, e.g., in Lerner et al. in Nature Reviews 16:498-508 (2016). For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antigen binding moieties possessing the desired binding characteristics. Such methods are reviewed, e.g., in Frenzel et al. in mAbs 8:1177-1194 (2016); Bazan et al. in Human Vaccines and Immunotherapeutics 8:1817-1828 (2012) and Zhao et al. in Critical Reviews in Biotechnology 36:276-289 (2016) as well as in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992) and in Marks and Bradbury in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N.J., 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132 (2004). In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. in Annual Review of Immunology 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antigen binding moieties to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antigen binding moieties to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al. in EMBO Journal 12: 725-734 (1993). Naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter in Journal of Molecular Biology 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. Nos. 5,750,373; 7,985,840; 7,785,903 and 8,679,490 as well as US Patent Publication Nos. 2005/0079574, 2007/0117126, 2007/0237764, 2007/0292936 and 2009/0002360. Further examples of methods known in the art for screening combinatorial libraries for antigen binding moieties with a desired activity or activities include ribosome and mRNA display, as well as methods for antibody display and selection on bacteria, mammalian cells, insect cells or yeast cells. Methods for yeast surface display are reviewed, e.g., in Scholler et al. in Methods in Molecular Biology 503:135-56 (2012) and in Cherf et al. in Methods in Molecular biology 1319:155-175 (2015) as well as in the Zhao et al. in Methods in Molecular Biology 889:73-84 (2012). Methods for ribosome display are described, e.g., in He et al. in Nucleic Acids Research 25:5132-5134 (1997) and in Hanes et al. in PNAS 94:4937-4942 (1997).

[0133] In a first illustrative embodiments of the present invention, as a proof of concept, CARs are provided comprising an extracellular domain comprising at least one antigen binding moiety, wherein the at least one antigen binding moiety is capable of specific binding to a mutated immunoglobulin domain (e.g., a Fc domain or a Fab domain) but not capable of specific binding to the non-mutated immunoglobulin domain, wherein the mutated immunoglobulin domain comprises one or more amino acid substitutions. In one embodiment, the mutated immunoglobulin is an Fc domain, in particular a human IgG1 Fc domain. The mutated Fc domain comprises at least one amino acid substitution compared to the non-mutated parent Fc domain, wherein the CAR is capable of specific binding to the mutated Fc domain but not capable of specific binding to the non-mutated parent Fc domain.

[0134] In a particular embodiment, the mutated Fc domain comprises the P329G mutation. The P329G mutation corresponds to the amino acid substitution proline to glycine at residue 212 of human IgG1 Fc (SEQ ID NO:132). The mutated Fc domain comprising the P329G mutation binds to Fc receptors with reduced or abolished affinity compared to the non-mutated Fc domain.

[0135] In one particular embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises the heavy chain complementarity determining regions (CDRs) of SEQ ID NO:1, SEQ ID NO:2 and SEQ ID NO:3 and the light chain CDRs of SEQ ID NO:4, SEQ ID NO:5 and SEQ ID NO:6.

[0136] In one preferred embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a heavy chain variable region comprising: [0137] (a) a heavy chain complementarity determining region (CDR H) 1 amino acid sequence of RYWMN (SEQ ID NO:1); [0138] (b) a CDR H2 amino acid sequence of EITPDSSTINYTPSLKD (SEQ ID NO:2); [0139] (c) a CDR H3 amino acid sequence of PYDYGAWFAS (SEQ ID NO:3);
and a light chain variable region comprising: [0140] (d) a light chain (CDR L)1 amino acid sequence of RSSTGAVTTSNYAN (SEQ ID NO:4); [0141] (e) a CDR L2 amino acid sequence of GTNKRAP (SEQ ID NO:5); and [0142] (f) a CDR L3 amino acid sequence of ALWYSNHWV (SEQ ID NO:6).

[0143] In one embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a heavy chain variable region (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:8 and a light chain variable region (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:9.

[0144] In one embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9.

[0145] In one embodiment, the at least one antigen binding moiety is a scFv, a Fab, a crossFab or a scFab fragment. In one embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a Fab fragment.

[0146] In one embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a Fab fragment. In a preferred embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a Fab fragment comprising a heavy chain of SEQ ID NO:31 and a light chain of SEQ ID NO:33

[0147] In one embodiment the antigen binding moiety capable of specific binding to an Fc domain comprising the P329G mutation is a Fab fragment comprising a heavy chain comprising or consisting of an amino acid sequence of SEQ ID NO:31 and a light chain comprising or consisting of the amino acid sequence of SEQ ID NO:33.

[0148] In a particular embodiment, the antigen binding moiety is a Fab fragment capable of specific binding to an Fc domain comprising the P329G mutation, wherein the antigen binding receptor comprises a heavy chain fusion polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:30 and a light chain polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:33.

[0149] In a preferred embodiment, the antigen binding moiety is a Fab capable of specific binding to an Fc domain comprising the P329G mutation, wherein the antigen binding receptor comprises a heavy chain fusion polypeptide comprising the amino acid sequence of SEQ ID NO:30 and a light chain polypeptide comprising the amino acid sequence of SEQ ID NO:33.

[0150] In one embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises a scFv fragment. A scFv fragment is a polypeptide consisting of an heavy chain variable domain (VH), an light chain variable domain (VL) and a linker, wherein said variable domains and said linker have one of the following configurations in N-terminal to C-terminal direction: a) VH-linker-VL or b) VL-linker-VH. In a preferred embodiment, the scFv fragment has the configuration VH-linker-VL.

[0151] In a preferred embodiment the CAR capable of specific binding to an Fc domain comprising the P329G mutation comprises an scFv fragment comprising the amino acid sequence of SEQ ID NO:10.

[0152] In a particular embodiment, the antigen binding moiety is a scFv fragment capable of specific binding to an Fc domain comprising the P329G mutation, wherein the antigen binding receptor comprises a polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:7. In a preferred embodiment, the antigen binding moiety is a scFv capable of specific binding to an Fc domain comprising the P329G mutation, wherein the antigen binding receptor comprises a polypeptide comprising the amino acid sequence of SEQ ID NO:7 (as encoded by the nucleotide sequence of SEQ ID NO:19).

[0153] In further embodiments according to the invention the antigen binding moiety comprised in the extracellular domain is a single chain Fab fragment or scFab.

[0154] In another particular embodiment, the mutated Fc domain comprises the I253A, H310A and H435A (AAA) mutations. The AAA mutation corresponds to the amino acid substitutions isoleucine to alanine at position 136, histidine to alanine at residue 193 and histidine to alanine at residue 318 of human IgG1 Fc (SEQ ID NO:132). The AAA mutations reduce binding to the neonatal Fc receptor (FcRn). Accordingly, the mutated Fc domain comprising the AAA mutations binds to FcRn with reduced or abolished affinity compared to the non-mutated Fc domain.

[0155] In one embodiment the CAR capable of specific binding to an Fc domain comprising the AAA mutation comprises the heavy chain complementarity determining regions (CDRs) of SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46 and at least one light chain CDR selected from the group of SEQ ID NO:47, SEQ ID NO:48 and SEQ ID NO:49.

[0156] In a preferred embodiment the CAR capable of specific binding to an Fc domain comprising the I253A, H310A and H435A mutations comprises a heavy chain variable region comprising: [0157] (a) a heavy chain complementarity determining region (CDR H) 1 amino acid sequence of SYGMS (SEQ ID NO:44); [0158] (b) a CDR H2 amino acid sequence of SSGGSY (SEQ ID NO:45); [0159] (c) a CDR H3 amino acid sequence of LGMITTGYAMDY (SEQ ID NO:46); and a light chain variable region comprising: [0160] (d) a light chain (CDR L)1 amino acid sequence of RSSQTIVHSTGHTYLE (SEQ ID NO:47); [0161] (e) a CDR L2 amino acid sequence of KVSNRFS (SEQ ID NO:48); and [0162] (f) a CDR L3 amino acid sequence of FQGSHVPYT (SEQ ID NO:49).

[0163] In one embodiment the CAR capable of specific binding to an Fc domain comprising the I253A, H310A and H435A mutations comprises a heavy chain variable region (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:52 and a light chain variable region (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence selected of SEQ ID NO:53.

[0164] In one embodiment the CAR capable of specific binding to an Fc domain comprising the I253A, H310A and H435A mutations comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:52, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:53.

[0165] In one embodiment, the at least one antigen binding moiety is a scFv, a Fab, a crossFab or a scFab fragment. In one embodiment the CAR capable of specific binding to an Fc domain comprising the I253A, H310A and H435A mutations comprises a Fab fragment. In a particular embodiment the extracellular domain of the antigen binding receptor comprises an antigen binding moiety capable of specific binding to an Fc domain comprising the I253A, H310A and H435A mutations, wherein the Fab fragment comprises a heavy chain of SEQ ID NO:55 and a light chain of SEQ ID NO:56.

[0166] In a particular embodiment, the antigen binding moiety is a Fab fragment capable of specific binding to an Fc domain comprising the AAA mutation, wherein the antigen binding receptor comprises a heavy chain fusion polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:54 and a light chain polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:56.

[0167] In a preferred embodiment, the antigen binding moiety is a Fab capable of specific binding to an Fc domain comprising the AAA mutation, wherein the antigen binding receptor comprises a heavy chain fusion polypeptide comprising the amino acid sequence of SEQ ID NO:54 and a light chain polypeptide comprising the amino acid sequence of SEQ ID NO:56.

[0168] In one embodiment the CAR capable of specific binding to an Fc domain comprising the I253A, H310A and H435A mutations comprises a scFv fragment. In a preferred embodiment the CAR capable of specific binding to an Fc domain comprising the AAA mutation comprises an scFv fragment comprising the amino acid sequence of SEQ ID NO:51.

[0169] In a particular embodiment, the antigen binding moiety is a scFv fragment capable of specific binding to an Fc domain comprising the AAA mutation, wherein the antigen binding receptor comprises a polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:50. In a preferred embodiment, the antigen binding moiety is a scFv capable of specific binding to an Fc domain comprising the AAA mutation, wherein the antigen binding receptor comprises a polypeptide comprising the amino acid sequence of SEQ ID NO:50.

[0170] In further embodiments according to the invention the antigen binding moiety comprised in the extracellular domain is a single chain Fab fragment or scFab.

[0171] In further illustrative embodiments of the present invention, as a proof of concept, CARs are provided comprising an extracellular domain comprising at least one antigen binding moiety, wherein the at least one antigen binding moiety is capable of specific binding to a modified immunoglobulin domain (e.g., a Fc domain or a Fab domain) but not capable of specific binding to the non-modified immunoglobulin domain, wherein the modified immunoglobulin domain comprises a hapten tag.

[0172] In an illustrative embodiment of the present invention, as a proof of concept, provided are CARs capable of specific binding to a modified immunoglobulin domain comprising the hapten tag Digoxigenin (DIG). The structure of the DIG molecule is depicted in FIG. 4.

[0173] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises the heavy chain complementarity determining regions (CDRs) of SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59 and the light chain CDRs of SEQ ID NO:60, SEQ ID NO:61 and SEQ ID NO:62.

[0174] In one preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises a heavy chain variable region comprising: [0175] (a) a heavy chain complementarity determining region (CDR H) 1 amino acid sequence of RYWMN (SEQ ID NO:57); [0176] (b) a CDR H2 amino acid sequence of EITPDSSTINYTPSLKD (SEQ ID NO:58); [0177] (c) a CDR H3 amino acid sequence of PYDYGAWFAS (SEQ ID NO:59);
and a light chain variable region comprising: [0178] (d) a light chain (CDR L)1 amino acid sequence of RSSTGAVTTSNYAN (SEQ ID NO:60); [0179] (e) a CDR L2 amino acid sequence of GTNKRAP (SEQ ID NO:61); and [0180] (f) a CDR L3 amino acid sequence of ALWYSNHWV (SEQ ID NO:62).

[0181] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises a heavy chain variable region (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:64 and a light chain variable region (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:65.

[0182] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:64 and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:65.

[0183] In one embodiment, the at least one antigen binding moiety is a scFv, a Fab, a crossFab or a scFab fragment. In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises a Fab fragment. In a preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises a Fab fragment comprising a heavy chain of SEQ ID NO:68 and a light chain of SEQ ID NO:69.

[0184] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises a scFv fragment which is a polypeptide consisting of an heavy chain variable domain (VH), an light chain variable domain (VL) and a linker, wherein said variable domains and said linker have one of the following configurations in N-terminal to C-terminal direction: a) VH-linker-VL or b) VL-linker-VH. In a preferred embodiment, the scFv fragment has the configuration VH-linker-VL.

[0185] In a preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag DIG comprises an scFv fragment comprising the amino acid sequence of SEQ ID NO:66.

[0186] In another illustrative embodiment of the present invention, as a proof of concept, provided are CARs capable of specific binding to a modified immunoglobulin domain comprising the hapten tag Fluorescein isothiocyanate (FITC).

[0187] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag FITC comprises the heavy chain complementarity determining regions (CDRs) of SEQ ID NO:72, SEQ ID NO:73 and SEQ ID NO:74 and the light chain CDRs of SEQ ID NO:75, SEQ ID NO:76 and SEQ ID NO:77.

[0188] In one preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag FITC comprises a heavy chain variable region comprising: [0189] (a) a heavy chain complementarity determining region (CDR H) 1 amino acid sequence of RYWMN (SEQ ID NO:72); [0190] (b) a CDR H2 amino acid sequence of EITPDSSTINYTPSLKD (SEQ ID NO:73); [0191] (c) a CDR H3 amino acid sequence of PYDYGAWFAS (SEQ ID NO:74);
and a light chain variable region comprising: [0192] (d) a light chain (CDR L)1 amino acid sequence of RSSTGAVTTSNYAN (SEQ ID NO:75); [0193] (e) a CDR L2 amino acid sequence of GTNKRAP (SEQ ID NO:76); and [0194] (f) a CDR L3 amino acid sequence of ALWYSNHWV (SEQ ID NO:77).

[0195] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag FITC comprises a heavy chain variable region (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:80 and a light chain variable region (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:81.

[0196] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag FITC comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:80, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:81.

[0197] In one embodiment, the at least one antigen binding moiety is a scFv, a Fab, a crossFab or a scFab fragment.

[0198] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag FITC comprises a scFv fragment which is a polypeptide consisting of an heavy chain variable domain (VH), an light chain variable domain (VL) and a linker, wherein said variable domains and said linker have one of the following configurations in N-terminal to C-terminal direction: a) VH-linker-VL or b) VL-linker-VH. In a preferred embodiment, the scFv fragment has the configuration VH-linker-VL.

[0199] In a preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the hapten tag FITC comprises an scFv fragment comprising the amino acid sequence of SEQ ID NO:78.

[0200] In further illustrative embodiments of the present invention, as a proof of concept, CARs are provided comprising an extracellular domain comprising at least one antigen binding moiety, wherein the at least one antigen binding moiety is capable of specific binding to a modified immunoglobulin domain (e.g., a Fc domain or a Fab domain) but not capable of specific binding to the non-modified immunoglobulin domain, wherein the modified immunoglobulin domain comprises a polypeptide tag.

[0201] In one illustrative embodiment of the present invention, as a proof of concept, provided are CARs capable of specific binding to a modified immunoglobulin domain comprising a polypeptide tag from the influenza hemagglutinin (HA) glycoprotein. In one embodiment, the polypeptide tag from the HA protein comprises the amino acid sequence of YPYDVPDYA (SEQ ID NO:103).

[0202] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises the heavy chain complementarity determining regions (CDRs) of SEQ ID NO:82, SEQ ID NO:83 and SEQ ID NO:84 and the light chain CDRs of SEQ ID NO:85, SEQ ID NO:86 and SEQ ID NO:87.

[0203] In one preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises a heavy chain variable region comprising: [0204] (a) a heavy chain complementarity determining region (CDR H) 1 amino acid sequence of RYWMN (SEQ ID NO:82); [0205] (b) a CDR H2 amino acid sequence of EITPDSSTINYTPSLKD (SEQ ID NO:83); [0206] (c) a CDR H3 amino acid sequence of PYDYGAWFAS (SEQ ID NO:84);
and a light chain variable region comprising: [0207] (d) a light chain (CDR L)1 amino acid sequence of RSSTGAVTTSNYAN (SEQ ID NO:85); [0208] (e) a CDR L2 amino acid sequence of GTNKRAP (SEQ ID NO:86); and [0209] (l) a CDR L3 amino acid sequence of ALWYSNHWV (SEQ ID NO:87).

[0210] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises a heavy chain variable region (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:90 and a light chain variable region (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:91.

[0211] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:90, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:91.

[0212] In one embodiment, the at least one antigen binding moiety is a scFv, a Fab, a crossFab or a scFab fragment. In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises a Fab fragment.

[0213] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises a scFv fragment which is a polypeptide consisting of an heavy chain variable domain (VH), an light chain variable domain (VL) and a linker, wherein said variable domains and said linker have one of the following configurations in N-terminal to C-terminal direction: a) VH-linker-VL or b) VL-linker-VH. In a preferred embodiment, the scFv fragment has the configuration VH-linker-VL.

[0214] In a preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the HA tag comprises an scFv fragment comprising the amino acid sequence of SEQ ID NO:89.

[0215] In another illustrative embodiment of the present invention, as a proof of concept, provided are CARs capable of specific binding to a modified immunoglobulin domain comprising a polypeptide tag from the human c-myc protein. In one embodiment, the polypeptide tag from the human c-myc protein comprises the amino acid sequence of EQKLISEEDL (SEQ ID NO:104).

[0216] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises the heavy chain complementarity determining regions (CDRs) of SEQ ID NO:92, SEQ ID NO:93 and SEQ ID NO:94 and the light chain CDRs of SEQ ID NO:95, SEQ ID NO:96 and SEQ ID NO:97.

[0217] In one preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises a heavy chain variable region comprising: [0218] (a) a heavy chain complementarity determining region (CDR H) 1 amino acid sequence of RYWMN (SEQ ID NO:92); [0219] (b) a CDR H2 amino acid sequence of EITPDSSTINYTPSLKD (SEQ ID NO:93); [0220] (c) a CDR H3 amino acid sequence of PYDYGAWFAS (SEQ ID NO:94);
and a light chain variable region comprising: [0221] (d) a light chain (CDR L)1 amino acid sequence of RSSTGAVTTSNYAN (SEQ ID NO:95); [0222] (e) a CDR L2 amino acid sequence of GTNKRAP (SEQ ID NO:96); and [0223] (f) a CDR L3 amino acid sequence of ALWYSNHWV (SEQ ID NO:97).

[0224] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises a heavy chain variable region (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:101 and a light chain variable region (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:102.

[0225] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:101, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:102.

[0226] In one embodiment, the at least one antigen binding moiety is a scFv, a Fab, a crossFab or a scFab fragment. In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises a Fab fragment. In a preferred embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises a Fab fragment comprising a heavy chain of SEQ ID NO:99 and a light chain of SEQ ID NO:100.

[0227] In a particular embodiment, the antigen binding moiety is a Fab fragment capable of specific binding to an immunoglobulin domain comprising the myc tag, wherein the antigen binding receptor comprises a heavy chain fusion polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:98 and a light chain polypeptide comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:100.

[0228] In a preferred embodiment, the antigen binding moiety is a Fab capable of specific binding to an immunoglobulin domain comprising the myc tag, wherein the antigen binding receptor comprises a heavy chain fusion polypeptide comprising the amino acid sequence of SEQ ID NO:98 and a light chain polypeptide comprising the amino acid sequence of SEQ ID NO:100.

[0229] In one embodiment the CAR capable of specific binding to an immunoglobulin domain comprising the myc tag comprises a scFv fragment which is a polypeptide consisting of an heavy chain variable domain (VH), an light chain variable domain (VL) and a linker, wherein said variable domains and said linker have one of the following configurations in N-terminal to C-terminal direction: a) VH-linker-VL or b) VL-linker-VH. In a preferred embodiment, the scFv fragment has the configuration VH-linker-VL.

[0230] Fab and scFab fragments are stabilized via the natural disulfide bond between the CL domain and the CH1 domain. Antigen binding moieties comprising a heavy chain variable domain (VH) and a light chain variable domain (VL), such as the Fab, crossFab, scFv and scFab fragments as described herein might be further stabilized by introducing interchain disulfide bridges between the VH and the VL domain. Accordingly, in one embodiment, the Fab fragment(s), the crossFab fragment(s), the scFv fragment(s) and/or the scFab fragment(s) comprised in the antigen binding receptors according to the invention might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g., position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering). Such stabilized antigen binding moieties are herein referred to by the term ds.

[0231] Haptens can be coupled covalently or non-covalently to the recognition domain according to methods known in the art. For example biotinylation is widely used in the art to couple the hapten Biotin to a polypeptide, e.g., an immunoglobulin. Biotin is typically conjugated to proteins via primary amines (e.g., lysine). For IgG antibodies, usually, between 3 and 6 biotin molecules are conjugated per antibody molecule. Alternatively, carbohydrates can be biotinylated according to methods known in the art.

[0232] In one embodiment, the hapten molecule is coupled to the recognition domain using site-directed coupling. In one embodiment, introduction of a polypeptide tag in the antigen binding molecule is combined with site-directed coupling of a hapten molecule to the polypeptide tag. In such embodiments of the present invention, the number of hapten molecules coupled to the antigen binding molecule can be controlled, e.g., by providing a defined number of coupling sites in the polypeptide tag. An example of a site-directed coupling technology is the AviTag system which is known in the art. The polypeptide tag AviTag of GLNDIFEAQKIEWH (SEQ ID NO:106) comprises a natural biotinylation site which can be selectively biotinylated using the BirA Biotin-protein ligase. In one embodiment, the recognition domain comprises a defined number of hapten molecules. In one embodiment, the recognition domain does not comprise more than 1, 2, 3 or 4 hapten molecules. In a preferred embodiment, the recognition domain comprises two hapten molecules, e.g., the recognition domain is a Fc domain composed of two polypeptide molecules each comprising one hapten molecule. In another preferred embodiment, the recognition domain comprises one hapten molecule, e.g., the recognition domain is a Fab fragment comprising a hapten molecule either coupled to the heavy chain or the light chain fragment.

[0233] The CARs as provided and used herein comprise an extracellular domain comprising an antigen binding moiety capable of specific binding to the recognition domain, an anchoring transmembrane domain and at least one intracellular signaling and/or at least one co-stimulatory signaling domain. The anchoring transmembrane domain mediates confinement of the CAR to the cell membrane of the reporter cell, e.g., the T cell. The intracellular signaling and/or at least one co-stimulatory signaling domain transfer the binding of the CAR to an intracellular signal, e.g., T cell activation, which can be assessed by measuring reporter gene expression. In the context of the present invention, expression of the reporter gene as described herein is indicative for binding of the target antigen binding moiety to the target antigen and resulting T cell activation as described herein.

[0234] The anchoring transmembrane domain of the CAR may be characterized by not having a cleavage site for mammalian proteases. Proteases refer to proteolytic enzymes that are able to hydrolyze the amino acid sequence of a transmembrane domain comprising a cleavage site for the protease. The term proteases include both endopeptidases and exopeptidases. In the context of the present invention any anchoring transmembrane domain of a transmembrane protein as laid down among others by the CD-nomenclature may be used to generate a CAR suitable according to the invention, which activates T cells, upon binding, e.g., target cell or a modified immunoglobulin domain, as defined herein.

[0235] Accordingly, in the context of the present invention, the anchoring transmembrane domain may comprise part of a murine/mouse or preferably of a human transmembrane domain. An example for such an anchoring transmembrane domain is a transmembrane domain of CD28, for example, having the amino acid sequence as shown herein in SEQ ID NO:11 (as encoded by the DNA sequence shown in SEQ ID NO:23). In the context of the present invention, the transmembrane domain of the CAR may comprise/consist of an amino acid sequence as shown in SEQ ID NO:11 (as encoded by the DNA sequence shown in SEQ ID NO:23).

[0236] Alternatively, any protein having a transmembrane domain, as provided among others by the CD nomenclature, may be used as an anchoring transmembrane domain of the CAR provided and used in the invention. As described above, the CAR may comprise the anchoring transmembrane domain of CD28 which is located at amino acids 153 to 179, 154 to 179, 155 to 179, 156 to 179, 157 to 179, 158 to 179, 159 to 179, 160 to 179, 161 to 179, 162 to 179, 163 to 179, 164 to 179, 165 to 179, 166 to 179, 167 to 179, 168 to 179, 169 to 179, 170 to 179, 171 to 179, 172 to 179, 173 to 179, 174 to 179, 175 to 179, 176 to 179, 177 to 179 or 178 to 179 of the human full length CD28 protein as shown in SEQ ID NO:112 (as encoded by the cDNA shown in SEQ ID NO:111). Accordingly, in context of the present invention the anchoring transmembrane domain may comprise or consist of an amino acid sequence as shown in SEQ ID NO:11 (as encoded by the DNA sequence shown in SEQ ID NO:23).

[0237] As described herein, the CAR used according to the invention comprises at least one stimulatory signaling and/or co-stimulatory signaling domain. The stimulatory signaling and/or co-stimulatory signaling domain transduce the binding of the antigen binding molecule comprising the target antigen binding moiety to an intracellular signal in the reporter CAR-T cell. Accordingly, the CAR preferably comprises a stimulatory signaling domain, which provides T cell activation. In a preferred embodiment, binding of the target antigen binding moiety to the target antigen and/or binding of the reporter CAR-T cell to the antigen binding molecule comprising the target antigen binding moiety leads to activation of the intracellular signaling and/or co-signaling domain. In certain embodiments, the herein provided CAR comprises a stimulatory signaling domain which is a fragment/polypeptide part of murine/mouse or human CD3z (the UniProt Entry of the human CD3z is P20963 (version number 177 with sequence number 2; the UniProt Entry of the murine/mouse CD3z is P24161 (primary citable accession number) or Q9D3G3 (secondary citable accession number) with the version number 143 and the sequence number 1)), FCGR3A (the UniProt Entry of the human FCGR3A is P08637 (version number 178 with sequence number 2)), or NKG2D (the UniProt Entry of the human NKG2D is P26718 (version number 151 with sequence number 1); the UniProt Entry of the murine/mouse NKG2D is 054709 (version number 132 with sequence number 2)). Thus, the stimulatory signaling domain which is comprised in the CAR may be a fragment/polypeptide part of the full length of CD3z, FCGR3A or NKG2D. The amino acid sequence of the murine/mouse full length of CD3z is shown herein as SEQ ID NO:109 (murine/mouse as encoded by the DNA sequence shown in SEQ ID NO:110). The amino acid sequence of the human full length CD3z is shown herein as SEQ ID NO:107 (human as encoded by the DNA sequence shown in SEQ ID NO:108). The CAR provided and used according to the present invention may comprise fragments of CD3z, FCGR3A or NKG2D as stimulatory domain, provided that at least one signaling domain is comprised. In particular, any part/fragment of CD3z, FCGR3A, or NKG2D is suitable as stimulatory domain as long as at least one signaling motive is comprised. However, more preferably, the CAR comprises polypeptides which are derived from human origin. Preferably, the CAR comprises the amino acid sequence as shown herein as SEQ ID NO:107 (CD3z) (human as encoded by the DNA sequences shown in SEQ ID NO:108 (CD3z)). For example, the fragment/polypeptide part of the human CD3z which may be comprised in the CAR may comprise or consist of the amino acid sequence shown in SEQ ID NO:13 (as encoded by the DNA sequence shown in SEQ ID NO:25). Accordingly, in one embodiment the CAR comprises the sequence as shown in SEQ ID NO:13 or a sequence which has up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 23, 24, 25, 26, 27, 28, 29 or 30 substitutions, deletions or insertions in comparison to SEQ ID NO:13 and which is characterized by having a stimulatory signaling activity. Specific configurations of CARs comprising a stimulatory signaling domain are provided herein below and in the Examples and Figures. The stimulatory signaling activity can be determined; e.g., by enhanced cytokine release, as measured by ELISA (IL-2, IFN, TNF), enhanced proliferative activity (as measured by enhanced cell numbers), or enhanced lytic activity as measured by LDH release assays.

[0238] The CAR preferably comprises at least one co-stimulatory signaling domain which provides additional activity to the reporter CAR-T cell. The CAR may comprise a co-stimulatory signaling domain which is a fragment/polypeptide part of murine/mouse or human CD28 (the UniProt Entry of the human CD28 is P10747 (version number 173 with sequence number 1); the UniProt Entry of the murine/mouse CD28 is P31041 (version number 134 with sequence number 2)), CD137 (the UniProt Entry of the human CD137 is Q07011 (version number 145 with sequence number 1); the UniProt Entry of murine/mouse CD137 is P20334 (version number 139 with sequence number 1)), OX40 (the UniProt Entry of the human OX40 is P23510 (version number 138 with sequence number 1); the UniProt Entry of murine/mouse OX40 is P43488 (version number 119 with sequence number 1)), ICOS (the UniProt Entry of the human ICOS is Q9Y6W8 (version number 126 with sequence number 1)); the UniProt Entry of the murine/mouse ICOS is Q9WV40 (primary citable accession number) or Q9JL17 (secondary citable accession number) with the version number 102 and sequence version 2)), CD27 (the UniProt Entry of the human CD27 is P26842 (version number 160 with sequence number 2); the Uniprot Entry of the murine/mouse CD27 is P41272 (version number 137 with sequence version 1)), 4-1-BB (the UniProt Entry of the murine/mouse 4-1-BB is P20334 (version number 140 with sequence version 1); the UniProt Entry of the human 4-1-BB is Q07011 (version number 146 with sequence version)), DAP10 (the UniProt Entry of the human DAP10 is Q9UBJ5 (version number 25 with sequence number 1); the UniProt entry of the murine/mouse DAP10 is Q9QUJ0 (primary citable accession number) or Q9R1E7 (secondary citable accession number) with the version number 101 and the sequence number 1)) or DAP12 (the UniProt Entry of the human DAP12 is O43914 (version number 146 and the sequence number 1); the UniProt entry of the murine/mouse DAP12 is O054885 (primary citable accession number) or Q9R1E7 (secondary citable accession number) with the version number 123 and the sequence number 1). In certain embodiments the CAR may comprise one or more, i.e., 1, 2, 3, 4, 5, 6 or 7 of the herein defined co-stimulatory signaling domains. Accordingly, in the context of the present invention, the CAR may comprise a fragment/polypeptide part of a murine/mouse or preferably of a human CD28 as first co-stimulatory signaling domain and the second co-stimulatory signaling domain is selected from the group consisting of the murine/mouse or preferably of the human CD27, CD28, CD137, OX40, ICOS, DAP10 and DAP12, or fragments thereof. Preferably, the CAR comprises a co-stimulatory signaling domain which is derived from a human origin. Thus, more preferably, the co-stimulatory signaling domain(s) which is (are) comprised in the CAR may comprise or consist of the amino acid sequence as shown in SEQ ID NO:12 (as encoded by the DNA sequence shown in SEQ ID NO:24).

[0239] Thus, the co-stimulatory signaling domain which may be optionally comprised in the CAR is a fragment/polypeptide part of the full length CD27, CD28, CD137, OX40, ICOS, DAP10 and DAP12. The amino acid sequence of the murine/mouse full length CD28 is shown herein as SEQ ID NO:114 (murine/mouse as encoded by the DNA sequences shown in SEQ ID NO:113). However, because human sequences are most preferred in the context of the present invention, the co-stimulatory signaling domain which may be optionally comprised in the CAR protein is a fragment/polypeptide part of the human full length CD27, CD28, CD137, OX40, ICOS, DAP10 or DAP12. The amino acid sequence of the human full length CD28 is shown herein as SEQ ID NO:112 (human as encoded by the DNA sequence shown in SEQ ID NO:111).

[0240] In one preferred embodiment, the CAR comprises CD28 or a fragment thereof as co-stimulatory signaling domain. The CAR may comprise a fragment of CD28 as co-stimulatory signaling domain, provided that at least one signaling domain of CD28 is comprised. In particular, any part/fragment of CD28 is suitable for the CAR as long as at least one of the signaling motives of CD28 is comprised. For example, the CD28 polypeptide which is comprised in the CAR may comprise or consist of the amino acid sequence shown in SEQ ID NO:12 (as encoded by the DNA sequence shown in SEQ ID NO:24). In the present invention the intracellular domain of CD28, which functions as a co-stimulatory signaling domain, may comprise a sequence derived from the intracellular domain of the CD28 polypeptide having the sequence(s) YMNM (SEQ ID NO:115) and/or PYAP (SEQ ID NO:116). Preferably, the CAR comprises polypeptides which are derived from human origin. For example, the fragment/polypeptide part of the human CD28 which may be comprised in the CAR may comprise or consist of the amino acid sequence shown in SEQ ID NO:12 (as encoded by the DNA sequence shown in SEQ ID NO:24). Accordingly, in one embodiment, the CAR comprises the sequence as shown in SEQ ID NO:12 or a sequence which has up to 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 substitutions, deletions or insertions in comparison to SEQ ID NO:12 and which is characterized by having a co-stimulatory signaling activity. Specific configurations of CARs comprising a co-stimulatory signaling domain (CSD) are provided herein below and in the Examples and Figures. The co-stimulatory signaling activity can be determined; e.g., by enhanced cytokine release, as measured by ELISA (IL-2, IFN, TNF), enhanced proliferative activity (as measured by enhanced cell numbers), or enhanced lytic activity as measured by LDH release assays.

[0241] As mentioned above, in an embodiment of the present invention, the co-stimulatory signaling domain of the CAR may be derived from the human CD28 gene (Uni Prot Entry No: P10747 (accession number with the entry version: 173 and version 1 of the sequence)) and provides CD28 activity, defined as cytokine production, proliferation and lytic activity of the transduced cell described herein, like a transduced T cell. CD28 activity can be measured by release of cytokines by ELISA or flow cytometry of cytokines such as interferon-gamma (IFN-) or interleukin 2 (IL-2), proliferation of T cells measured e.g., by ki67-measurement, cell quantification by flow cytometry, or lytic activity as assessed by real time impedence measurement of the target cell (by using e.g., an ICELLligence instrument as described e.g., in Thakur et al., Biosens Bioelectron. 35(1) (2012), 503-506; Krutzik et al., Methods Mol Biol. 699 (2011), 179-202; Ekkens et al., Infect Immun. 75(5) (2007), 2291-2296; Ge et al., Proc Natl Acad Sci USA. 99(5) (2002), 2983-2988; Dwell et al., Cell Death Differ. 21(12) (2014), 1825-1837, Erratum in: Cell Death Differ. 21(12) (2014), 161). The co-stimulatory signaling domains PYAP and YMNM are beneficial for the function of the CD28 polypeptide and the functional effects enumerated above. The amino acid sequence of the YMNM domain is shown in SEQ ID NO:115; the amino acid sequence of the PYAP domain is shown in SEQ ID NO:116. Accordingly, in the CAR as provided and used herein, the CD28 polypeptide preferably comprises a sequence derived from intracellular domain of a CD28 polypeptide having the sequences YMNM (SEQ ID NO:115) and/or PYAP (SEQ ID NO:116). These signaling motives may, be present at any site within the intracellular domain of the CARs.

[0242] The extracellular domain comprising at least one antigen binding moiety capable of specific binding to the recognition domain, the anchoring transmembrane domain that does not have a cleavage site for mammalian proteases, the co-stimulatory signaling domain and the stimulatory signaling domain may be comprised in a single-chain multi-functional polypeptide. A single-chain fusion construct e.g., may consist of (a) polypeptide(s) comprising (an) extracellular domain(s) comprising at least one antigen binding moiety, (an) anchoring transmembrane domain(s), (a) co-stimulatory signaling domain(s) and/or (a) stimulatory signaling domain(s). In alternative embodiments, the CAR comprises an antigen binding moiety which is not a single chain fusion construct, i.e., the antigen binding moiety is a Fab or a crossFab fragment. In such embodiments the CAR is not a single chain fusion construct comprising only one polypeptide chain. Preferably such constructs will comprise a single chain heavy chain fusion polypeptide combined with an immunoglobulin light chain, e.g., the heavy chain fusion polypeptide comprises (an) immunoglobulin heavy chain(s), (an) anchoring transmembrane domain(s), (a) co-stimulatory signaling domain(s) and/or (a) stimulatory signaling domain(s) and is combined with (an) immunoglobulin light chain(s). Accordingly, the extracellular domain, the anchoring transmembrane domain, the co-stimulatory signaling domain and the stimulatory signaling domain may be connected by one or more identical or different peptide linker. For example, the linker between the extracellular domain comprising at least one antigen binding moiety capable of specific binding to the recognition domain and the anchoring transmembrane domain may comprise or consist of the amino acid sequence as shown in SEQ ID NO:17. Accordingly, the anchoring transmembrane domain, the co-stimulatory signaling domain and/or the stimulatory domain may be connected to each other by peptide linkers or alternatively, by direct fusion of the domains.

[0243] In some embodiments, the antigen binding moiety comprised in the extracellular domain is a single-chain variable fragment (scFv) which is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an antibody, connected with a short linker peptide of 10 to about 25 amino acids. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. For example, the linker may have the amino and amino acid sequence as shown in SEQ ID NO:16. A scFv antigen binding moiety retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker. scFv antibodies are, e.g., described in Houston, J. S., Methods in Enzymol. 203 (1991) 46-96).

[0244] The CAR or parts thereof may comprise a signal peptide. Such a signal peptide will bring the protein to the surface of the T cell membrane. For example, the signal peptide may have the amino and amino acid sequence as shown in SEQ ID NO:117 (as encoded by the DNA sequence shown in SEQ ID NO:118).

[0245] The components of the CARs can be fused to each other in a variety of configurations to generate T cell activating CARs. In some embodiments, the CAR comprises an extracellular domain composed of a heavy chain variable domain (VH) and a light chain variable domain (VL) connected to an anchoring transmembrane domain. In some embodiments, the VH domain is fused at the C-terminus to the N-terminus of the VL domain, optionally through a peptide linker. In other embodiments, the CAR further comprises a stimulatory signaling domain and/or a co-stimulatory signaling domain. In a specific such embodiment, the CAR essentially consists of a VH domain and a VL domain, an anchoring transmembrane domain, and optionally a stimulatory signaling domain connected by one or more peptide linkers, wherein the VH domain is fused at the C-terminus to the N-terminus of the VL domain, and the VL domain is fused at the C-terminus to the N-terminus of the anchoring transmembrane domain, wherein the anchoring transmembrane domain is fused at the C-terminus to the N-terminus of the stimulatory signaling domain. Optionally, the CAR further comprises a co-stimulatory signaling domain. In one such specific embodiment, the antigen binding receptor essentially consists of a VH domain and a VL domain, an anchoring transmembrane domain, a stimulatory signaling domain and a co-stimulatory signaling domain connected by one or more peptide linkers, wherein the VH domain is fused at the C-terminus to the N-terminus of the VL domain, and the VL domain is fused at the C-terminus to the N-terminus of the anchoring transmembrane domain, wherein the anchoring transmembrane domain is fused at the C-terminus to the N-terminus of the stimulatory signaling domain, wherein the stimulatory signaling domain is fused at the C-terminus to the N-terminus of the co-stimulatory signaling domain. In an alternative embodiment, the co-stimulatory signaling domain is connected to the anchoring transmembrane domain instead of the stimulatory signaling domain. In a preferred embodiment, the CAR essentially consists of a VH domain and a VL domain, an anchoring transmembrane domain, a co-stimulatory signaling domain and a stimulatory signaling domain connected by one or more peptide linkers, wherein the VH domain is fused at the C-terminus to the N-terminus of the VL domain, and the VL domain is fused at the C-terminus to the N-terminus of the anchoring transmembrane domain, wherein the anchoring transmembrane domain is fused at the C-terminus to the N-terminus of the co-stimulatory signaling domain, wherein the co-stimulatory signaling domain is fused at the C-terminus to the N-terminus of the stimulatory signaling domain.

[0246] In preferred embodiments, one of the binding moieties is a Fab fragment or a crossFab fragment. In one preferred embodiment, the antigen binding moiety is fused at the C-terminus of the Fab or crossFab heavy chain to the N-terminus of the anchoring transmembrane domain, optionally through a peptide linker. In an alternative embodiment, the antigen binding moiety is fused at the C-terminus of the Fab or crossFab light chain to the N-terminus of the anchoring transmembrane domain, optionally through a peptide linker. In other embodiments, the CAR further comprises a stimulatory signaling domain and/or a co-stimulatory signaling domain. In a specific such embodiment, the CAR essentially consists of a Fab or crossFab fragment, an anchoring transmembrane domain, and optionally a stimulatory signaling domain connected by one or more peptide linkers, wherein the Fab or crossFab fragment is fused at the C-terminus of the heavy or light chain to the N-terminus of the anchoring transmembrane domain, wherein the anchoring transmembrane domain is fused at the C-terminus to the N-terminus of the stimulatory signaling domain. Preferably, the CAR further comprises a co-stimulatory signaling domain. In one such embodiment, the CAR essentially consists of a Fab or crossFab fragment, an anchoring transmembrane domain, a stimulatory signaling domain and a co-stimulatory signaling domain connected by one or more peptide linkers, wherein the Fab or crossFab fragment is fused at the C-terminus of the heavy or light chain to the N-terminus of the anchoring transmembrane domain, wherein the stimulatory signaling domain is fused at the C-terminus to the N-terminus of the co-stimulatory signaling domain. In a preferred embodiment, the co-stimulatory signaling domain is connected to the anchoring transmembrane domain instead of the stimulatory signaling domain. In a most preferred embodiment, the CAR essentially consists of a Fab or crossFab fragment, an anchoring transmembrane domain, a co-stimulatory signaling domain and a stimulatory signaling domain, wherein the Fab or crossFab fragment is fused at the C-terminus of the heavy chain to the N-terminus of the anchoring transmembrane domain through a peptide linker, wherein the anchoring transmembrane domain is fused at the C-terminus to the N-terminus of the co-stimulatory signaling domain, wherein the co-stimulatory signaling domain is fused at the C-terminus to N-terminus of the stimulatory signaling domain.

[0247] The antigen binding moiety, the anchoring transmembrane domain and the stimulatory signaling and/or co-stimulatory signaling domains may be fused to each other directly or through one or more peptide linker, comprising one or more amino acids, typically about 2-20 amino acids. Peptide linkers are known in the art and are described herein. Suitable, non-immunogenic peptide linkers include, for example, (G.sub.4S).sub.n, (SG.sub.4).sub.n, (G.sub.4S).sub.n or G.sub.4(SG.sub.4).sub.n peptide linkers, wherein n is generally a number between 1 and 10, typically between 2 and 4. A preferred peptide linker for connecting the antigen binding moiety and the anchoring transmembrane moiety is GGGGS (G.sub.4S) according to SEQ ID NO 20. An exemplary peptide linker suitable for connecting variable heavy chain (VH) and the variable light chain (VL) is GGGSGGGSGGGSGGGS (G.sub.4S).sub.4 according to SEQ ID NO 19.

[0248] Additionally, linkers may comprise (a portion of) an immunoglobulin hinge region. Particularly where an antigen binding moiety is fused to the N-terminus of an anchoring transmembrane domain, it may be fused via an immunoglobulin hinge region or a portion thereof, with or without an additional peptide linker.

[0249] As described herein, the CARs provided and used according to the present invention comprise an extracellular domain comprising at least one antigen binding moiety. A CAR with a single antigen binding moiety is useful and preferred, particularly in cases where high expression of the CAR is needed. In such cases, the presence of more than one antigen binding moiety may limit the expression efficiency of the CAR. In other cases, however, it will be advantageous to have a CAR comprising two or more antigen binding moieties, for example to optimize targeting to the target site or to allow crosslinking of target cell antigens.

[0250] In the context of the methods according to the invention, contacting the reporter CAR-T cell with the antigen binding molecule comprising the target antigen binding moiety and binding of the target antigen binding moiety to the target cell (e.g., the tumor cell) comprising the target antigen on the surface leads to expression of the reporter gene as described herein. Accordingly, in one embodiment, activation of the intracellular signaling and/or co-signaling domain as described herein leads to activation of a response element as herein described. In a preferred embodiment, the response element controls the expression of the reporter gene. In a preferred embodiment, activation of the response element leads to expression of the reporter gene. Accordingly, the reporter gene in the reporter cells (e.g., the reporter CAR-T cell) is expressed upon binding of the target antigen binding moiety to the target. In one embodiment, the expression of the reporter gene is indicative for binding of the target antigen binding moiety to the target antigen. In this context, the binding of the CAR to its target elicits a cellular response which results in a modulation of the activity of the response element, either directly or through a cascade of cell signaling. The response element is a DNA element which can be silenced or activated by transcription factors or the like. Response elements are known in the art and are commercially available, e.g., in reporter vectors. Usually the response element comprises DNA repeat elements and is a cis-acting enhancer element located upstream of a minimal promotor which drives expression of a reporter gene upon transcription factor binding.

[0251] Binding of the CAR to the recognition domain, e.g., the modified Fc domain or Fab fragment, activates the response element. In one embodiment the response element is a nuclear response element located in the nucleus of the cell. In another embodiment said response element is located on a plasmid in the reporter cell. In one embodiment the assay comprises the preliminary step of transfection of the reporter cells, e.g., a CAR-T cell, with an expression vector comprising the DNA sequence coding for the reporter gene under the control of the response element. Additionally, the reporter cells can be transfected with an expression vector comprising the DNA sequence coding for the CAR. The reporter cells can be transfected with an expression vector comprising all elements of the signaling cascade or with different vectors individually expressing the different components. In one embodiment, the reporter cells comprise the DNA sequence coding for the reporter gene under the control of the response element, and the DNA sequence coding for the CAR.

[0252] Accordingly, as described herein, the CAR is functionally linked to a response element. In one embodiment, the response element controls the expression of the reporter gene. In one embodiment the response element is part of the NFAT pathway, the NF-B pathway or the AP-1 pathway, preferably, the NFAT pathway.

[0253] In one embodiment the reporter gene is selected from a gene coding for a fluorescent protein or a gene coding for an enzyme whose catalytic activity can be detected. In one embodiment, the reporter gene is coding for a luminescent protein. In further embodiments the fluorescent protein is selected from the group consisting of green fluorescent protein (GFP), yellow fluorescent protein (YFP), red fluorescent protein (RFP), Blue fluorescent protein (BFP, Heim et al. 1994, 1996), a cyan fluorescent variant known as CFP (Heim et al. 1996; Tsien 1998); a yellow fluorescent variant known as YFP (Oruro et al. 1996; Wachter et al. 1998); a violet-excitable green fluorescent variant known as Sapphire (Tsien 1998; Zapata-Hommer et al. 2003); and a cyan-excitable green fluorescing variant known as enhanced green fluorescent protein or EGFP (Yang et al. 1996) enhanced green fluorescent protein (EGFP) and can be measured e.g., by live cell imaging (e.g., Incucyte) or fluorescent spectrophotometry. In one embodiment the enzyme whose catalytic activity can be detected is selected from the group consisting of luciferase, beta Galactosidase and Alkaline Phosphatase. In one embodiment the reporter gene is encoding for GFP. In a preferred embodiment the reporter gene is encoding for luciferase. The activity of luciferase can be detected by commercially available assays, e.g., by the Luciferase 1000 Assay System or the ONE-Glo Luciferase Assay System (both Promega). The Luciferase 1000 Assay System contains coenzyme A (CoA) besides luciferin as a substrate, resulting in a strong light intensity lasting for at least one minute. For assaying the intracellular luciferase, it is necessary to lyse the cells prior to detection. The light which is produced as a by-product of the reaction is collected by the luminometer from the entire visible spectrum. In the examples shown herein the signal was proportional to the amount of produced luciferase and therefore proportional to the strength of the activation of the NFAT promotor. In another embodiment a Luciferase assay is used wherein the luciferase is secreted from the cells. Hence the assay can be performed without lysis of the cells.

[0254] As described herein, the expression of the reporter gene can be directly correlated with the binding of the target antigen binding moiety to the target antigen on the target cell and the resulting activation of the reporter cell, e.g., the Jurkat cell. For example when using a gene encoding for luciferase as a reporter gene, the amount of light detected from the cells correlates directly with the target antigen binding and is indicative for the target antigen binding when compared to appropriate control situations. In one embodiment the antigen binding molecule comprising the target antigen binding moiety is applied in different concentrations and the half maximal effective concentration (EC50) of reporter gene activation is determined. EC50 refers to the concentration of the antigen binding molecule (e.g. the antibody) or ligand at which the antigen binding molecule activates or inhibits the reporter gene halfway between the baseline and maximum after a specified exposure time. The EC50 of the dose response curve therefore represents the concentration of the target antigen binding moiety where 50% of its maximal activating or inhibitory effect on the target antigen is observed.

[0255] In one embodiment, the target antigen binding moiety is capable of specific binding to a tumor target antigen on the surface of the tumor cell. In one embodiment, the tumor target antigen is selected from the group consisting of CD20, CD38, CD138, CEA, EGFR, FolR1, HER2, LeY, MCSP, STEAP1, TYRP1, and WT1, or a fragment thereof. However, the target antigen is not limited to proteins which are primarily or exclusively located on the cell surface but may also derive from polypeptides or proteins which are temporarily or permanently located intracellularly. In such cases, the target antigen deriving from an intracellular polypeptide or protein can be presented on the (tumor) cell surface by one or several molecules of the major histocompatibility complex (MHC). In one embodiment, the tumor target antigen is a peptide bound to a molecule of the MHC. In one embodiment, the MHC is a human MHC. In one embodiment, the peptide bound to a molecule of the MHC has an overall length of between 8 and 100, preferably between 8 and 30, and more preferred between 8 and 16 amino acids. In one embodiment, the tumor target antigen derives from a protein which is exclusively or mainly expressed in tumor tissue. In one embodiment, the protein is an intracellular protein and the peptide is generated by the MHC-I or MHC-II pathway and presented by a MHC class I or MHC class II complex. In one embodiment, the peptide is generated by the MHC-I pathway and presented by a MHC class I complex. In one embodiment, the target antigen binding moiety is a T cell receptor like (TCRL) antigen binding moiety. A TCRL antigen binding moiety is capable of specific binding to a peptide antigen which is exclusively or mainly expressed in tumor tissue, wherein the peptide antigen is bound to a molecule of the MHC located on the surface of a target cell, particularly a cancer cell. In this context, the method of the present invention is particularly suitable to detect the presence of a target cell, e.g., a tumor cell, based on presence of a specific peptide/MHC complex on the surface of the target cell using established or novel TCRL target antigen binding moieties. Indeed, currently available diagnostic assay formats are limited in their ability to specifically detect tumor specific peptide/MHC complex. The present invention provides a specific and sensitive assay format for the detection of peptide/MHC complex with the specific detection of peptide/MHC complex by TCRL antigen binding moieties. In such embodiments of the present invention, at least one TCRL antigen binding moiety is comprised in the antigen binding molecule comprising the recognition domain, e.g., the modified or mutation Fc domain.

[0256] The binding of the antigen binding molecule comprising the target antigen binding moiety to the target antigen can be determined qualitatively or qualitatively, i.e., by the presence or absence of the expression of the reporter gene; with the absence of any fluorescence or luminescence being indicative of no binding. For quantitative measurement of binding and activation the amount of reporter gene activation can be compared to a reference. Accordingly, the diagnostic assay as described herein may additionally comprise the step of comparing the level of expression of the reporter gene to a reference. A suitable reference usually comprises a negative control which is substantially identical to the referenced assay omitting one or several essential component(s) of the assay or method. For the methods of the invention the omitted component may be, e.g., omitting addition of the antigen binding molecule or omitting the target cell. Alternatively, a reporter CAR-T cell not capable of binding to the target cell and/or the recognition domain of the antigen binding molecule can be used. In one embodiment, the reference is expression of the reporter gene in absence of the antigen binding molecule. In another embodiment, the reference is expression of the reporter gene in absence of the target cell, in particular in absence of the tumor cell. In specific embodiments, the expression of the reporter gene is at least 2, 3, 4, 5, 10, 100, 1000, or 10000, higher compared to the expression of the reporter gene in presence of the reference.

[0257] Alternatively, the absence of reporter gene expression can be defined by a certain threshold, i.e., after deduction of a background signal. The background signal is usually determined by performing the assay with all reagents but without the antigen binding molecule or in absence of the target cell. A positive signal from the diagnostic assay according to the invention is given if the level of expression of the reporter gene in the presence of the target cell in relation to the expression of the reporter gene in absence of the target cell is higher than a predefined threshold value. In specific embodiments, the threshold value is 2, 3, 4, 5, 10, 100, 1000, or 10000.

[0258] The novel diagnostic assay as described herein is robust, suitable for use in high-throughput format and efficient in terms of hands-on time needed to accomplish the assay. Furthermore, the diagnostic assay of the present invention tolerates the presence of dead cells in the sample to be analyzed. This is in contrast to cell assays wherein the binding and functionality of an antigen binding molecule is determined by measuring cell viability or cell death.

[0259] One further advantage of the new diagnostic assay described herein is that no washing steps are required. The reporter cells and/or the antigen binding molecule to be tested can be added to the target cells, e.g., tumor cells, in either order or at the same time. In one embodiment, reporter CAR-T cells and the tumor sample is added to the cell culture medium which may contain the diluted antigen binding molecule in a suitable cell culture format, e.g., in a well of a 24 well plate or in a well of a 96 well plate. Preferably the testing medium is a medium that provides conditions for cells to be viable for up to 48 hours. In one embodiment the diagnostic assay is performed in a microtiter plate. In one embodiment the microtiter plate is suitable for high throughput screening. The diagnostic assay of the present invention can be performed in any format that allows for rapid preparation, processing, and analysis of multiple reactions. This can be, for example, in multi-well assay plates (e.g., 24 wells, 96 wells or 384 wells). Stock solutions for various agents can be made manually or robotically, and all subsequent pipetting, diluting, mixing, distribution, washing, incubating, sample readout, data collection and analysis can be done robotically using commercially available analysis software, robotics, and detection instrumentation capable of detecting fluorescent and/or luminescent signals.

[0260] In one embodiment about 100000 to about 1000000 reporter CAR-T cells per well of a 24-well plate are provided in step c). In a preferred embodiment about 300000 to about 700000 cells or about 400000 to about 600000 reporter CAR-T cells per well of a 24-well plate are provided in step c). In one embodiment about 500000 reporter CAR-T cells per well of a 24-well plate are provided in step c). In one embodiment about 10000 to about 100000 reporter CAR-T per well of a 96-well plate are provided in step c). In a preferred embodiment about 30000 to about 70000 reporter CAR-T or about 40000 to about 60000 reporter CAR-T per well of a 96-well plate are provided in step c). In one embodiment about 50000 reporter CAR-T per well of a 96-well plate are provided in step c). In one embodiment about 3000 to about 30000 reporter CAR-T cells per well of a 384-well plate are provided in step c). In a preferred embodiment about 5000 to about 15000 cells or about 8000 to about 12000 reporter CAR-T cells per well of a 384-well plate are provided in step c). In one embodiment about 10000 reporter CAR-T cells per well of a 384-well plate are provided in step c). In one embodiment about 200000 to about 2000000 reporter CAR-T per ml of cell culture medium are provided in step c). In a preferred embodiment about 600000 to about 1400000 reporter CAR-T or about 800000 to about 1200000 reporter CAR-T per ml of cell culture medium are provided in step c). In one embodiment about 1000000 reporter CAR-T per ml of cell culture medium are provided in step c).

[0261] In one embodiment the antigen binding molecule is provided in step b) to achieve a final concentration of about 0.1 fg/ml to 10 g/ml. In further embodiments the antigen binding molecule is provided in step b) to achieve a final concentration of about 1 fg/ml to about 1 g/ml or about 1 pg/ml to about 1 g/ml. In further embodiments the antigen binding molecule is provided in step b) to achieve a final concentration of about 0.1 ng/ml. In one embodiment the antigen binding molecule is provided in step b) to achieve a final concentration of about 1 nM to about 1000 nM. In further embodiments the antigen binding molecule is provided in step b) to achieve a final concentration of about 5 nM to about 200 nM or about 10 nM to about 100 nM. In further embodiments the antigen binding molecule is provided in step b) to achieve a final concentration of about 50 nM. The antigen binding molecule can be diluted in cell culture medium. The antigen binding molecule diluted to the final concentration as described herein is added to the target cells before or after adding the reporter cells. In one embodiment, the antigen binding molecule diluted to the final concentration as described herein is added to the target cells before adding the reporter cells.

[0262] Furthermore provided are transduced T cells, i.e., reporter CAR-T cells (e.g., Jurkat cells), capable of expressing a CAR as described herein and their use in the diagnostic assay according to the invention. The CAR relates to a molecule which is naturally not comprised in and/or on the surface of T cells and which is not (endogenously) expressed in or on normal (non-transduced) T cells. Thus, the CAR as used herein in and/or on T cells is artificially introduced into T cells. The CAR molecule, artificially introduced and subsequently presented in and/or on the surface of said T cells, e.g., reporter CAR-T cells, comprises domains comprising one or more antigen binding moiety accessible (in vitro or in vivo) to antigens and/or (Ig-derived) immunoglobulins, preferably antibodies, e.g., to the Fc domain or Fab fragment of the antigen binding molecules used according to the invention. In this context, these artificially introduced molecules are presented in and/or on the surface of said T cells after transduction as described herein below. Accordingly, after transduction, T cells according to the disclosure can be activated by the target antigen and/or immunoglobulins.

[0263] Herein provided are also transduced T cells expressing a CAR encoded by (a) nucleic acid molecule(s) encoding the CAR as described herein. Accordingly, in the context of the present invention, the transduced cell may comprise a nucleic acid molecule encoding the CAR as provided and used herein.

[0264] In the context of the present invention, the term transduced T cell relates to a genetically modified T cell (i.e., a T cell wherein a nucleic acid molecule has been introduced deliberately). In particular, the nucleic acid molecule encoding the CAR as described herein can be stably integrated into the genome of the T cell by using a retroviral or lentiviral transduction. The extracellular domain of the CAR may comprise the complete extracellular domain of an antigen binding moiety as described herein but also parts thereof. The minimal size required being the antigen binding site of the antigen binding moiety in the CAR. The extracellular portion of the CAR (i.e., the extracellular domain comprising the antigen binding moiety) can be detected on the cell surface, while the intracellular portion (i.e., the co-stimulatory signaling domain(s) and the stimulatory signaling domain) are not detectable on the cell surface. The detection of the extracellular domain of the CAR can be carried out by using an antibody which specifically binds to this extracellular domain or by the recognition domain, e.g., the modified immunoglobulin domain, which the extracellular domain is capable to bind. The extracellular domain can be detected using these antibodies, antigens or recognition domains by flow cytometry or microscopy.

[0265] The transduced cells may be any immune cell. These include but are not limited to B-cells, T cells, Natural Killer (NK) cells, Natural Killer (NK) T cells, T cells, innate lymphoid cells, macrophages, monocytes, dendritic cells, or neutrophils and immortalized cell lines thereof. Preferentially, said immune cell would be a lymphocyte, preferentially a NK or T cells or immortalized cell lines deriving thereof. The said T cells include CD4 T cells and CD8 T cells. Triggering of the CAR on the surface of the leukocyte will render the cell responsive against a target cell irrespective of the lineage the cell originated from. Activation will happen irrespective of the stimulatory signaling domain or co-stimulatory signaling domain chosen for the CAR and is not dependent on the exogenous supply of additional cytokines.

[0266] The transduced cell may be co-transduced with further nucleic acid molecules, e.g., with a nucleic acid molecule encoding a response element as described herein.

[0267] The transduced cell/cells is/are preferably grown under controlled conditions, outside of their natural environment. In particular, the term culturing means that cells (e.g., the transduced cell(s)) are in vitro. Culturing cells is a laboratory technique of keeping cells alive which are separated from their original tissue source. Herein, the transduced cell used according to the present invention is cultured under conditions allowing the expression of the introduced gene in or on said transduced cells. Conditions which allow the expression of a transgene are commonly known in the art.

[0268] Further provided herein are nucleic acids and vectors encoding one or several CARs used according to the present invention. The nucleic acid molecules may be under the control of regulatory sequences. For example, promoters, transcriptional enhancers and/or sequences which allow for induced expression of the CARs may be employed. In the context of the present invention, the nucleic acid molecules are expressed under the control of constitutive or inducible promoter. Suitable promoters are e.g., the CMV promoter (Qin et al., PLoS One 5(5) (2010), e10611), the UBC promoter (Qin et al., PLoS One 5(5) (2010), e10611), PGK (Qin et al., PLoS One 5(5) (2010), e10611), the EF1A promoter (Qin et al., PLoS One 5(5) (2010), e10611), the CAGG promoter (Qin et al., PLoS One 5(5) (2010), e10611), the SV40 promoter (Qin et al., PLoS One 5(5) (2010), e10611), the COPIA promoter (Qin et al., PLoS One 5(5) (2010), e10611), the ACT5C promoter (Qin et al., PLoS One 5(5) (2010), e10611), the TRE promoter (Qin et al., PLoS One. 5(5) (2010), e10611), the Oct3/4 promoter (Chang et al., Molecular Therapy 9 (2004), S367-S367 (doi: 10.1016/j.ymthe.2004.06.904)), or the Nanog promoter (Wu et al., Cell Res. 15(5) (2005), 317-24). Herein the term vector relates to a circular or linear nucleic acid molecule which can autonomously replicate in a cell (i.e., in a transduced cell) into which it has been introduced. Many suitable vectors are known to those skilled in molecular biology, the choice of which would depend on the function desired and include plasmids, cosmids, viruses, bacteriophages and other vectors used conventionally in genetic engineering. Methods which are well known to those skilled in the art can be used to construct various plasmids and vectors; see, for example, the techniques described in Sambrook et al. (loc cit.) and Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N.Y. (1989), (1994). Alternatively, the polynucleotides and vectors can be reconstituted into liposomes for delivery to target cells. Relevant sequences can be transferred into expression vectors where expression of a particular polypeptide is required. Typical cloning vectors include pBluescript SK, pGEM, pUC9, pBR322, pGA18 and pGBT9. Typical expression vectors include pTRE, pCAL-n-EK, pESP-1, pOP13CAT. The vector can be polycistronic. Such regulatory sequences (control elements) are known to the skilled person and may include a promoter, a splice cassette, translation initiation codon, and translation and insertion site for introducing an insert into the vector(s). In the context of the present invention, said nucleic acid molecule(s) is (are) operatively linked to said expression control sequences allowing expression in eukaryotic or prokaryotic cells. It is envisaged that said vector(s) is (are) an expression vector(s) comprising the nucleic acid molecule(s) encoding the CAR as defined herein. Operably linked refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. A control sequence operably linked to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences. In case the control sequence is a promoter, it is obvious for a skilled person that double-stranded nucleic acid is preferably used.

[0269] In the context of the present invention the recited vector(s) is (are) an expression vector(s). An expression vector is a construct that can be used to transform a selected cell and provides for expression of a coding sequence in the selected cell. An expression vector(s) can for instance be cloning (a) vector(s), (a) binary vector(s) or (a) integrating vector(s). Expression comprises transcription of the nucleic acid molecule preferably into a translatable mRNA. Regulatory elements ensuring expression in prokaryotes and/or eukaryotic cells are well known to those skilled in the art. In the case of eukaryotic cells they comprise normally promoters ensuring initiation of transcription and optionally poly-A signals ensuring termination of transcription and stabilization of the transcript. Possible regulatory elements permitting expression in prokaryotic host cells comprise, e.g., the PL, lac, trp or tac promoter in E. coli, and examples of regulatory elements permitting expression in eukaryotic host cells are the AOX1 or GAL1 promoter in yeast or the CMV-, SV40, RSV-promoter (Rous sarcoma virus), CMV-enhancer, SV40-enhancer or a globin intron in mammalian and other animal cells.

[0270] Beside elements which are responsible for the initiation of transcription such regulatory elements may also comprise transcription termination signals, such as the SV40-poly-A site or the tk-poly-A site, downstream of the polynucleotide. Furthermore, depending on the expression system used leader sequences encoding signal peptides capable of directing the polypeptide to a cellular compartment or secreting it into the medium may be added to the coding sequence of the recited nucleic acid sequence and are well known in the art; see also, e.g., appended Examples.

[0271] The leader sequence(s) is (are) assembled in appropriate phase with translation, initiation and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein, or a portion thereof, into the periplasmic space or extracellular medium. Optionally, the heterologous sequence can encode a CAR including an N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product. In this context, suitable expression vectors are known in the art such as Okayama-Berg cDNA expression vector pcDV1 (Pharmacia), pCDM8, pRc/CMV, pcDNA1, pcDNA3 (Invitrogene), pEF-DHFR, pEF-ADA or pEF-neo (Raum et al. Cancer Immunol Immunother 50 (2001), 141-150) or pSPORT1 (GIBCO BRL).

[0272] The described nucleic acid molecule(s) or vector(s) which is (are) introduced in the T cell or its precursor cell may either integrate into the genome of the cell or it may be maintained extrachromosomally.

Exemplary Embodiments

[0273] 1. A diagnostic assay for determining the presence of a tumor cell in a sample, the diagnostic assay comprising the steps of: [0274] a) contacting the sample with an antigen binding molecule comprising an antigen binding domain and a recognition domain, wherein the antigen binding domain comprises a target antigen binding moiety capable of specific binding to the tumor cell; [0275] b) contacting the sample with a chimeric antigen receptor (CAR) expressing reporter T (CAR-T) cell wherein the reporter CAR-T cell comprises: [0276] i. a CAR capable of specific binding to the recognition domain, wherein the CAR is operationally coupled to a response element; [0277] ii. a reporter gene under the control of the response element; and [0278] c) determining T cell activation by measuring the expression of the reporter gene to establish the presence of the tumor cell. [0279] 2. The diagnostic assay of embodiment 1, wherein the CAR comprises an antigen binding moiety capable of specific binding to the recognition domain. [0280] 3. The diagnostic assay of any one of embodiments 1 or 2, wherein the antigen binding molecule comprises an antigen binding domain and a recognition domain, wherein the antigen binding domain comprises the target antigen binding moiety, and wherein the CAR is capable of specific binding to the recognition domain. [0281] 4. The diagnostic assay of any one of embodiments 1 to 3, wherein the antigen binding domain and the recognition domain are immunoglobulin domains, or fragments thereof [0282] 5. The diagnostic assay of any one of embodiments 1 to 4, wherein the antigen binding domain and the recognition domain are individually selected from the group consisting of an antibody, an Fc domain, a Fab fragment, a crossover Fab fragment, a single chain Fab fragment, a Fv fragment, a scFv fragment, a single-domain antibody, an aVH, or fragments thereof. [0283] 6. The diagnostic assay of any one of embodiments 1 to 5, wherein the antigen binding domain is a Fab fragment and the recognition domain is an Fc domain. [0284] 7. The diagnostic assay of any one of embodiments 1 to 6, wherein the antigen binding molecule is an IgG class antibody, particularly an IgG1 or IgG4 isotype antibody. [0285] 8. The diagnostic assay of embodiments 1 to 7, wherein the recognition domain is a mutated Fc domain, wherein the mutated Fc domain comprises at least one amino acid substitution compared to the non-mutated parent Fc domain, wherein the CAR is capable of specific binding to the mutated Fc domain but not capable of specific binding to the non-mutated parent Fc domain. [0286] 9. The diagnostic assay of embodiment 8, wherein the mutated Fc domain comprises at least one amino acid mutation at a position selected from the group consisting of L234, L235, I253, H310, P331, P329 and H435 according to EU numbering, in particular wherein the amino acid mutation is L234A, L235A, I253A, N297A, H310A, P329G, P331G and/or H435A. [0287] 10. The diagnostic assay of any one of embodiments 8 or 9, wherein the mutant Fc domain comprises an amino acid substitution at a position selected from the group consisting of residue 117, 118, 136, 180, 193, 212, 214, and 318 of human IgG1 Fc (SEQ ID NO:132), in particular wherein the mutant human IgG1 Fc comprises the amino acid substitution leucine to alanine at residue 117, leucine to alanine at residue 118, isoleucine to alanine at position 136, asparagine to alanine at residue 180, histidine to alanine at residue 193, proline to glycine at residue 212, proline to glycine at residue 214, and/or or histidine to alanine at residue 318 of human IgG1 Fc (SEQ ID NO:132). [0288] 11. The diagnostic assay of any one of embodiments 8 to 10, wherein mutant Fc domain comprises an amino acid substitution at the position of residue 212 of human IgG1 Fc (SEQ ID NO:138), in particular wherein the mutant Fc domain comprises the amino acid substitution proline to glycine at residue 212 of human IgG1 Fc (SEQ ID NO:132). [0289] 12. The diagnostic assay of any one of embodiment 8 to 11, wherein the mutated Fc domain comprises the amino acid mutation P329G according to EU numbering. [0290] 13. The diagnostic assay of any one of embodiments 1 to 5, wherein the antigen binding domain and the recognition domain are the same domain, in particular a Fab fragment. [0291] 14. The diagnostic assay of embodiments 1 to 13, wherein the recognition domain comprises a tag. [0292] 15. The diagnostic assay of embodiment 14, wherein the CAR is capable of specific binding to the recognition domain comprising the tag but not capable of specific binding to the recognition domain not comprising the tag. [0293] 16. The diagnostic assay of any one of embodiments 14 or 15, wherein the tag is a hapten molecule. [0294] 17. The diagnostic assay of embodiment 16, wherein the hapten molecule is coupled to the recognition domain. [0295] 18. The diagnostic assay of any one of embodiments 16 or 17, wherein the hapten molecule is covalently coupled to the recognition domain. [0296] 19. The diagnostic assay of any one of embodiments 16 to 18, wherein the hapten molecule is non-covalently coupled to the recognition domain. [0297] 20. The diagnostic assay of any one of embodiments 16 to 19, wherein the hapten molecule is selected from the group consisting of Biotin, Digoxigenin (DIG) and Fluorescein (FITC). [0298] 21. The diagnostic assay of any one of embodiments 14 or 15, wherein the tag is a polypeptide tag. [0299] 22. The diagnostic assay of embodiment 21, wherein the polypeptide tag has a length of from 1 to 30 amino acids, from 1 to 25 amino acids, from 1 to 20 amino acids, from 1 to 15 amino acids or from 1 to 10 amino acids. [0300] 23. The diagnostic assay of any one of embodiments 21 or 22, wherein the polypeptide tag is connected at the C-terminus to the N-terminus of the recognition domain, optionally through a peptide linker. [0301] 24. The diagnostic assay of any one of embodiments 21 or 22, wherein the polypeptide tag is connected at the N-terminus to the C-terminus of the recognition domain, optionally through a peptide linker. [0302] 25. The diagnostic assay of any one of embodiments 22 to 24, wherein the polypeptide tag is selected from the group consisting of myc-tag, HA-tag, AviTag, FLAG-tag, His-tag, GCN4-tag, and NE-tag. [0303] 26. The diagnostic assay of any one of embodiments 1 to 25, wherein the CAR comprises at least one intracellular stimulatory signaling and/or co-stimulatory signaling domain. [0304] 27. The diagnostic assay of embodiment 26, wherein binding of the target antigen binding moiety to the target antigen and binding of the antigen binding moiety to the recognition domain leads to activation of the intracellular signaling and/or co-signaling domain. [0305] 28. The diagnostic assay of any one of embodiments 26 or 27, wherein activation of the intracellular signaling and/or co-signaling domain leads to activation of the response element. [0306] 29. The diagnostic assay of any one of embodiments 1 to 28, wherein the response element controls the expression of the reporter gene. [0307] 30. The diagnostic assay of any one of embodiments 1 to 29, wherein activation of the response element leads to expression of the reporter gene. [0308] 31. The diagnostic assay of any one of embodiments 1 to 30, wherein the response element is part of the NFAT pathway, the NF-B pathway or the AP-1 pathway. [0309] 32. The diagnostic assay of any one of embodiments 1 to 31, wherein the reporter gene is coding for a luminescent protein. [0310] 33. The diagnostic assay of any one of embodiments 1 to 32, wherein the reporter gene is coding for green fluorescent protein (GFP) or luciferase. [0311] 34. The diagnostic assay of any one of embodiments 1 to 33, wherein the target antigen binding moiety is capable of specific binding to a tumor target antigen on the surface of the tumor cell. [0312] 35. The diagnostic assay of embodiment 34, wherein the tumor target antigen is a cell surface antigen and/or a cell surface receptor. [0313] 36. The diagnostic assay of any one of embodiments 34 or 35, wherein the tumor target antigen is selected from the group consisting of CD20, CD38, CD138, CEA, EGFR, FolR1, HER2, LeY, MCSP, STEAP1, TYRP1, and WT1, or a fragment thereof [0314] 37. The diagnostic assay of any one of embodiments 34 to 36, wherein the tumor target antigen is a peptide bound to a molecule of the human major histocompatibility complex (MHC). [0315] 38. The diagnostic assay of embodiment 37, wherein the target antigen binding moiety is a T cell receptor like (TCRL) antigen binding moiety. [0316] 39. The diagnostic assay of any one of embodiments 1 to 38, wherein the sample is a patient sample derived from an individual suffering from a disease, in particular wherein the disease is cancer. [0317] 40. The diagnostic assay of any one of embodiments 1 to 39, additionally comprising the step of: [0318] c) comparing the expression of the reporter gene to a reference. [0319] 41. The diagnostic assay of embodiment 40, wherein the reference is expression of the reporter gene in the presence of a reference sample, wherein the reference sample does not comprise the tumor cell. [0320] 42. The diagnostic assay of embodiment 41, wherein expression of the reporter gene in the presence of the patient sample is at least 2, 3, 4, 5, 10, 100, 1000, or 10000, higher compared to the expression of the reporter gene in the presence of the reference sample. [0321] 43. The diagnostic assay of any one of embodiments 1 to 42, wherein the sample is a patient sample. [0322] 44. The diagnostic assay of embodiment 43, additionally comprising the step of: [0323] d) establishing the presence of a tumor cell if the expression of the reporter gene in the presence of the patient sample in relation to the expression of the reporter gene in the presence of a reference is higher than a predefined threshold value. [0324] 45. The diagnostic assay of embodiment 44, wherein the reference is expression of the reporter gene in the presence of a reference sample, wherein the reference sample does not comprise the tumor cell. [0325] 46. The diagnostic assay of embodiment 44 or 45, wherein the threshold value is 2, 3, 4, 5, 10, 100, 1000, or 10000. [0326] 47. The diagnostic assay of any one of embodiment 1 to 46, wherein the patient is a mammal, in particular wherein the patient is a human. [0327] 48. A diagnostic kit comprising [0328] (a) an antigen binding molecule capable of specific binding to a tumor cell; and [0329] (b) a transduced T cell comprising (i) a CAR capable of specific binding to the antigen binding molecule and (ii) a reporter gene under the control of the response element, wherein the CAR is operationally coupled to a response element. [0330] 49. The diagnostic kit of embodiment 48, wherein the antigen binding molecule comprises a target antigen binding moiety capable of specific binding to a tumor target antigen on the surface of the tumor cell. [0331] 50. The diagnostic kit of embodiment 49, wherein the tumor target antigen is a cell surface antigen and/or a cell surface receptor. [0332] 51. The diagnostic kit of any one of embodiments 49 or 50, wherein the tumor target antigen is selected from the group consisting of CD20, CD38, CD138, CEA, EGFR, FolR1, HER2, LeY, MCSP, STEAP1, TYRP1, and WT1, or a fragment thereof [0333] 52. The diagnostic kit of any one of embodiments 49 to 51, wherein the tumor target antigen is a peptide bound to a molecule of the human major histocompatibility complex (MHC). [0334] 53. The diagnostic kit assay of embodiment 52, wherein the target antigen binding moiety is a T cell receptor like (TCRL) antigen binding moiety. [0335] 54. The diagnostic kit of any one of embodiment 48 to 53, wherein the antigen binding molecule is an IgG class antibody, particularly an IgG1 or IgG4 isotype antibody, or a fragment thereof [0336] 55. The diagnostic kit of any one of embodiments 48 or 54, wherein the antigen binding molecule comprises a mutated Fc domain, wherein the mutated Fc domain comprises at least one amino acid substitution compared to the non-mutated parent Fc domain, wherein the CAR is capable of specific binding to the mutated Fc domain but not capable of specific binding to the non-mutated parent Fc domain. [0337] 56. The diagnostic kit of embodiment 55, wherein the mutated Fc domain comprises at least one amino acid mutation at a position selected from the group consisting of L234, L235, I253, H310, P331, P329 and H435 according to EU numbering, in particular wherein the amino acid mutation is L234A, L235A, I253A, N297A, H310A, P329G, P331G and/or H435A. [0338] 57. The diagnostic kit of any one of embodiments 55 or 56, wherein the mutant Fc domain comprises an amino acid substitution at a position selected from the group consisting of residue 117, 118, 136, 180, 193, 212, 214, and 318 of human IgG1 Fc (SEQ ID NO:132), in particular wherein the mutant human IgG1 Fc comprises the amino acid substitution leucine to alanine at residue 117, leucine to alanine at residue 118, isoleucine to alanine at position 136, asparagine to alanine at residue 180, histidine to alanine at residue 193, proline to glycine at residue 212, proline to glycine at residue 214, and/or or histidine to alanine at residue 318 of human IgG1 Fc (SEQ ID NO:132). [0339] 58. The diagnostic kit of any one of embodiments 55 to 57, wherein the mutant Fc domain comprises an amino acid substitution at the position of residue 212 of human IgG1 Fc (SEQ ID NO:132), in particular wherein the mutant Fc domain comprises the amino acid substitution proline to glycine at residue 212 of human IgG1 Fc (SEQ ID NO:132). [0340] 59. The diagnostic kit of any one of embodiment 55 to 58, wherein the mutated Fc domain comprises the amino acid mutation P329G according to EU numbering. [0341] 60. The diagnostic kit of any one embodiments 48 to 54, wherein the antigen binding molecule comprises a tag and wherein the CAR is capable of specific binding to the antigen binding molecule comprising the tag but not capable of specific binding to the antigen binding molecule not comprising the tag. [0342] 61. The diagnostic kit of embodiment 60, wherein the tag is a hapten molecule. [0343] 62. The diagnostic kit of embodiment 61, wherein the hapten molecule is selected from the group consisting of Biotin, Digoxigenin (DIG) and Fluorescein (FITC). [0344] 63. The diagnostic kit of embodiment 62, wherein the tag is a polypeptide tag. [0345] 64. The diagnostic kit of embodiment 63, wherein the polypeptide tag has a length of from 1 to 30 amino acids, from 1 to 25 amino acids, from 1 to 20 amino acids, from 1 to 15 amino acids or from 1 to 10 amino acids. [0346] 65. The diagnostic kit of any one of embodiments 63 or 64, wherein the polypeptide tag is selected from the group consisting of myc-tag, HA-tag, AviTag, FLAG-tag, His-tag, GCN4-tag, and NE-tag. [0347] 66. The diagnostic kit of any one of embodiments 48 to 65 for use in the diagnosis of cancer. [0348] 67. A method for monitoring the efficacy of an antitumor treatment, comprising providing a sample from a subject having received antitumor treatment, and determining the presence of tumor cells using the diagnostic assay of any one of embodiments 1 to 47 or the diagnostic kit of any one of embodiments 48 to 66. [0349] 68. A method for predicting the efficacy of an antitumor treatment by administration of a T cell activating antigen binding molecule to a patient suffering from a tumor, comprising providing a sample from the subject, and determining expression of the reporter gene using the diagnostic assay of any one of embodiments 1 to 47, or the diagnostic kit of any one of embodiments 48 to 66, wherein the T cell activating antigen binding molecule is used as the antigen binding molecule in the assay or kit and wherein expression of the reporter gene is indicative for predicting the efficacy of the antitumor treatment. [0350] 69. The diagnostic assays and methods as herein before described with reference to any of the Examples or to any one of the accompanying drawings.

EXAMPLES

[0351] The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.

Recombinant DNA Techniques

[0352] Standard methods were used to manipulate DNA as described in Sambrook et al., Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. The molecular biological reagents were used according to the manufacturer's instructions. General information regarding the nucleotide sequences of human immunoglobulin light and heavy chains is given in: Kabat, E. A. et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Ed., NIH Publication No 91-3242.

DNA Sequencing

[0353] DNA sequences were determined by double strand sequencing.

Gene Synthesis

[0354] Desired gene segments were either generated by PCR using appropriate templates or were synthesized by Geneart AG (Regensburg, Germany) from synthetic oligonucleotides and PCR products by automated gene synthesis. The gene segments flanked by singular restriction endonuclease cleavage sites were cloned into standard cloning/sequencing vectors. The plasmid DNA was purified from transformed bacteria and concentration determined by UV spectroscopy. The DNA sequence of the subcloned gene fragments was confirmed by DNA sequencing. Gene segments were designed with suitable restriction sites to allow sub-cloning into the respective expression vectors. All constructs were designed with a 5-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells.

Protein Purification

[0355] Proteins were purified from filtered cell culture supernatants referring to standard protocols. In brief, antibodies were applied to a Protein A Sepharose column (GE healthcare) and washed with PBS. Elution of antibodies was achieved at pH 2.8 followed by immediate neutralization of the sample. Aggregated protein was separated from monomeric antibodies by size exclusion chromatography (Superdex 200, GE Healthcare) in PBS or in 20 mM Histidine, 150 mM NaCl pH 6.0. Monomeric antibody fractions were pooled, concentrated (if required) using e.g., a MILLIPORE Amicon Ultra (30 MWCO) centrifugal concentrator, frozen and stored at 20 C. or 80 C. Part of the samples were provided for subsequent protein analytics and analytical characterization e.g., by SDS-PAGE and size exclusion chromatography (SEC).

SDS-PAGE

[0356] The NuPAGE Pre-Cast gel system (Invitrogen) was used according to the manufacturer's instruction. In particular, 10% or 4-12% NuPAGE Novex Bis-TRIS Pre-Cast gels (pH 6.4) and a NuPAGE MES (reduced gels, with NuPAGE Antioxidant running buffer additive) or MOPS (non-reduced gels) running buffer was used.

Analytical Size Exclusion Chromatography

[0357] Size exclusion chromatography (SEC) for the determination of the aggregation and oligomeric state of antibodies was performed by HPLC chromatography. Briefly, Protein A purified antibodies were applied to a Tosoh TSKgel G3000SW column in 300 mM NaCl, 50 mM KH.sub.2PO.sub.4/K.sub.2HPO.sub.4, pH 7.5 on an Agilent HPLC 1100 system or to a Superdex 200 column (GE Healthcare) in 2PBS on a Dionex HPLC-System. The eluted protein was quantified by UV absorbance and integration of peak areas. BioRad Gel Filtration Standard 151-1901 served as a standard.

Antibody Production

[0358] The respective antibodies were produced by co-transfecting HEK293-EBNA cells with the mammalian expression vectors using polyethylenimine. The cells were transfected with the corresponding expression vectors for heavy and light chains in a 1:1 ratio.

Lentiviral Transduction of Jurkat NFAT CAR-T Cells

[0359] To produce lentiviral vectors, respective DNA sequences for the correct assembly of the CAR were cloned in frame in a lentiviral polynucleotide vector under a constitutively active human cytomegalovirus immediate early promoter (CMV). The retroviral vector contained a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), a central polypurine tract (cPPT) element, a pUC origin of replication and a gene encoding for antibiotic resistance facilitating the propagation and selection in bacteria.

[0360] To produce functional virus particles, Lipofectamine LTX based transfection was performed using 60-70% confluent Hek293T cells (ATCC CRL3216) and CAR containing vectors as well as pCMV-VSV-G:pRSV-REV:pCgpV transfer vectors at 3:1:1:1 ratio. After 48 h supernatant was collected, centrifuged for 5 minutes at 250 g to remove cell debris and filtrated through 0.45 m or 0.22 m polyethersulfon filters. Concentrated virus particles (Lenti-x-Concentrator, Takara) were used to transduce Jurkat NFAT cells (Signosis). Positive transduced cells were sorted as pool or single clones using a FACS-ARIA sorter (BD Bioscience). After cell expansion to appropriate density Jurkat NFAT reporter CAR-T cells were used for experiments.

Example 1

[0361] The anti-CD20 antibody GA101 was digoxigenylated and the incorporation of Digoxigenin (DIG) molecules verified by Western Blot analysis. For the coupling reaction of antibody and Digoxigenin, the antibody, which was dissolved in 20 mM His 140 mM NaCl, pH6 was first desalted and the buffer exchanged to 0.1M sodium bicarbonate (pH8) buffer using Zeba Spin Desalting Columns (ThermoFisher Cat.-No 89889). Equimolar or higher (1:3 ratio) amounts of antibody and Digoxigenin-3-O-methylcarbonyl-e-aminocaproic acid-N-hydroxysuccinimide ester (Sigma Aldrich Cat-No. 11333054001) were incubated for 1 hour at room temperature on a shaker at 300 rpm. Antibody-Digoxigenin conjugates were desalted again and the buffer was exchanged to 20 mM His 140 mM NaCl pH6. Unconjugated Dig-NHS was removed in the same step (cut-off 7 kDa).

[0362] Digoxigeninylation was detected by anti-Digoxigenin-AP Fab fragments (Sigma Aldrich Cat.-No 11093274910) in a Western Blot. 1 g of the respective (un-)conjugated antibody was mixed with NuPAGE LDS Sample Buffer (4 (ThermoFisher Cat.-No. NP0007) in a total volume of 20 l and boiled for 5 min at 95 C. 10 l were loaded on a NuPAGE 4-12% Bis-Tris Protein Gel, 1.0 mm, 10-well (ThermoFisher Cat.-No. NP0321) and run for 1 hour at 170V in 1NuPAGE MES SDS Running Buffer (Cat. No. NP0002). Subsequently, the gel was blotted onto a 0.2 m PVDF membrane (Trans-Blot Turbo Pack, Bio-Rad Cat.-No. 1704156) using the Trans-Blot Turbo Transfer System (Bio-Rad, Cat.-No 1704150, mixed molecular weight standard protocol). The membrane was blocked with 5% milk in 1TBS-T buffer for 1 hour at RT on an orbital shaker. Anti-Digoxigenin-AP Fab fragments were diluted 1:2000 in 5% milk/TBS-T and incubated for 1 hour on an orbital shaker at room temperature. The membrane was washed three times with 1TBS-T for 10 minutes each. The membrane was then incubated for 1 min in 2 ml of BCIP/NBT-Blue Liquid Substrate System for Membranes (Sigma Aldrich Cat.-No. B3804). After washing three times with bidistilled, the membrane was dried and documented (FIG. 7).

Example 2

[0363] The expression of anti-Digoxigenin-ds-scFv-CD28ATD-CD28CSDCD3zSSD in Jurkat NFAT reporter CAR-T cells and the binding of Digoxigenin-Cy5 to the CAR was confirmed by FACS. Anti-Digoxigenin-ds-scFv-CD28ATD-CD28CSDCD3zSSD transduced Jurkat NFAT reporter CAR-T cells were pelleted at 300 g for 3 min at room temperature and resuspended in fresh RPMI-1640+10% FCS+1% Glutamax (growth medium) in an appropriate volume. 310.sup.5 cells were then added to each well in a 96-well plate, spun down once at 300 g for 5 min and resuspended in 100 l in PBS with 2% FCS. Dig-Cy5 was added to a final concentration of 20 nM and incubated on ice for 45 minutes. Cells were then pelleted and resuspended in ice-cold PBS. The washing step was repeated two more times. Cells were then analyzed for Cy5 signal (APC channel) via flow cytometry (FIG. 8). As a negative control, untransduced Jurkat NFAT cells were treated and analyzed equally.

Example 3

[0364] Described herein is a reporter CAR-T cell assay using CD20 expressing SUDHDL4 tumor cells as target cells and a sorted pool of anti-Digoxigenin-ds-scFv-CD28ATD-CD28CSDCD3zSSD expressing Jurkat NFAT reporter CAR-T cells as reporter cells (FIG. 9). Digoxygeninylated GA101 IgG (antibody:Dig-NHS ratio 1:10) was used as IgG, which on one hand recognizes the tumor antigen and on the other hand is recognized by the transduced Jurkat NFAT reporter CAR-T cells. As positive control a 96 well plate (Cellstar Greiner-bio-one, CAT-No. 655185) was coated with 10 g/ml CD3 antibody (from Biolegend) in phosphate buffered saline (PBS) either for 4 C. over night or for at least 1 h at 37 C. The CD3 coated wells were washed twice with PBS, after the final washing step PBS was fully removed. Reporter cells or Jurkat NFAT wild type cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore, an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-1640+10% FCS+1% Glutamax (growth medium). Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted to 110.sup.6 viable cells/ml in growth medium. Target cells and reporter (effector) cells were plated in either 5:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one). As a next step a serial dilution of digoxigeninylated GA101 antibody, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.01 pg/ml in a final volume of 200 l per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96 well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere. After 20 hours incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96 well plate (Greiner-bio-one) and 100 l ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and room temperature, luminescence was measured using a Tecan Spark10M plate reader, at 1 sec/well as detection time. Upon co-cultivation of target and reporter cells in a ratio 5:1 (grey dots) for 20 hours, the graphs show a dose-dependent activation of anti-Digoxigenin-ds-scFv-CD28ATD-CD28CSDCD3zSSD expressing Jurkat NFAT reporter CAR-T cells when digoxigenylated GA101 IgG was used as antibody (FIG. 9). When the GA101 IgG without Digoxigeninylation (FIG. 9, depicted in grey squares) was used, no activation of the transduced Jurkat NFAT reporter CAR-T cells was detectable. Further Jurkat NFAT wild type cells incubated with 1 g/ml digoxigeninylated GA101 but without target cells did not show any activation (FIG. 9 black square). In contrast, anti-Digoxigenin-ds-scFv-CD28ATD-CD28CSDCD3zSSD expressing Jurkat NFAT reporter CAR-T cells incubated with 1 g/ml digoxigeninylated GA101 IgG but without target cells showed activation (FIG. 9 black triangle).

[0365] Each point represents the mean value of technical triplicates. All values are depicted as baseline corrected. Standard deviation is indicated by error bars.

Example 4

[0366] Described herein is a Jurkat NFAT reporter CAR-T cell assay using CD20 expressing SUDHDL4 tumor cells as target cells and a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 11A) or a pool of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 11B) as reporter cells. GA101 IgG with P329G LALA mutation was used as IgG, which on one hand recognizes the tumor antigen and on the other hand is recognized by the transduced Jurkat NFAT reporter CAR-T cells. As positive control a 96 well plate (Cellstar Greiner-bio-one, CAT-No. 655185) was coated with 10 g/ml CD3 antibody (from Biolegend) in phosphate buffered saline (PBS) either for 4 C. over night or for at least 1 h at 37 C. The CD3 coated wells were washed twice with PBS, after the final washing step PBS was fully removed. Reporter cells or Jurkat NFAT wild type cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-160+10% FCS+1% Glutamax (growth medium). Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted, analog as described for the reporter cells, to 110.sup.6 viable cells/ml in growth medium. Target cells and reporter cells were plated in either 5:1 or 1:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one). As a next step a serial dilution of GA101 with P329G LALA mutation, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.0001 g/ml in a final volume of 200 ul per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96 well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere. After 20 h incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96 well plate (Greiner-bio-one) and 100 ul ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and RT luminescence was measured using Tecan Spark10M plate reader, 1 sec/well as detection time.

[0367] Upon co-cultivation of target and reporter cells in a ratio 5:1 (dots) or 1:1 (squares) for 20 h the graphs show a dose-dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells as well as Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells when GA101 IgG with P329G LALA mutation was used as antibody (FIGS. 11 A and B, depicted in black). If the GA101 IgG without P329G LALA mutation (FIGS. 11 A and B, depicted in grey) was used, no activation of the transduced Jurkat NFAT reporter CAR-T cells was detectable. Each point represents the mean value of biological duplicates, each performed as technical duplicate. All values are depicted as baseline corrected. Standard deviation is indicated by error bars.

Example 5

[0368] Described herein is a Jurkat NFAT reporter CAR-T cell assay using CD20 expressing SUDHDL4 (FIGS. 12C and 12D) or WSUDLCL2 (FIGS. 12A and 12B) tumor cells as target cells and single clone Jurkat NFAT cells expressing Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD as reporter cells. GA101 IgG with P329G LALA mutation was used as IgG which on one hand recognizes the tumor antigen and on the other hand is recognized by the Jurkat NFAT reporter CAR-T cells. Reporter cells or Jurkat NFAT wild type cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-160+10% FCS+1% Glutamax (growth medium). Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted, analog as described for the reporter cells, to 110.sup.6 viable cells/ml in growth medium. Target cells and reporter cells were plated in either 10:1, 5:1 or 1:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one). As a next step a serial dilution of GA101 with P329G LALA mutation, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.0001 g/ml in a final volume of 200 ul per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96 well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere. After 20 h incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96 well plate (Greiner-bio-one) and 100 ul ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and RT luminescence was measured using Tecan Spark10M plate reader, 1 sec/well as detection time. Upon co-cultivation of target and reporter cells in a ratio 10:1 (dots), 5:1 (squares) or 1:1 (triangles) for 20 h the graphs show a GA101 IgG with P329G LALA dose-dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 12A-D, depicted in black). If the GA101 IgG without P329G LALA mutation (FIG. 12A-D, depicted in grey) was used, then only little activation of the transduced Jurkat NFAT reporter CAR-T cells was detectable at the highest antibody concentration of 1 g/ml. Each point represents the mean value of technical duplicate. All values are depicted as baseline corrected. Standard deviation is indicated by error bars.

Example 6

[0369] Described herein is a Jurkat NFAT reporter CAR-T cell assay performed using adherent FAP expressing NIH/3T3-huFAP cl 19 tumor cells as target cells. As reporter cells a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 13A) or Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 13C) were used. FAP 4B9 IgG with P329G LALA mutation was used as IgG which on one hand recognizes the tumor antigen and on the other hand is recognized by the Jurkat NFAT reporter CAR-T cells. IgG DP47/vk3 harboring P329G LALA mutation was included as isotype control. As positive control wells of a 96 well plate (Greiner-bio-one, CAT-No. 655185) were coated with 10 g/ml CD3 antibody (from Biolegend) in phosphate buffered saline (PBS) for at least 1 h at 37 C. The CD3 coated wells were washed twice with PBS, after the final washing step PBS was fully removed. Adherent NIH/3T3-huFAP cl 19 target cells were washed once with PBS and detached using Trypsin. Detached cells were resuspended in DMEM+4.5 g LD-Glucose+L-Glutamine+25 mM HEPES+10% FCS and 1% Glutamax. Reporter cells or Jurkat NFAT wild type T cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-160+10% FCS+1% Glutamax (growth medium). Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted, analog as described for the reporter cells, to 110.sup.6 viable cells/ml in growth medium. Target cells and reporter cells were plated in 5:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one). As a next step a serial dilution of an antibody with P329G LALA mutation, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.0001 g/ml, in a final volume of 200 ul per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96-well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere. After 20 h incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96-well plate (Greiner-bio-one) and 100 ul ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and RT luminescence was measured using Tecan Spark10M plate reader, 1 sec/well as detection time.

[0370] FIGS. 13B and 13D, represent data of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 13D) or Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 13 B) both co-cultivated with target cells and 1 g/ml of FAP 4B9 antibody compared to different control conditions.

[0371] Upon incubation with 1 g/ml FAP 4B9 P329G LALA, Jurkat NFAT reporter CAR-T cells (FIGS. 13B and 13D black triangle) as well as target cells only (FIGS. 13B and 13D upside down black triangle) do not show any detectable luminescence signal.

[0372] Also Jurkat NFAT reporter CAR-T cells show no luminescence signal upon co-cultivation with target cells and 1 g/ml of FAP 4B9 antibody (FIG. 13B and FIG. 13D black diamond). Whereas CD3 dependent activation of Jurkat NFAT cells co-cultivated with target cells and 1 g/ml of FAP 4B9 antibody proofs their functionality through a detectable luminescence signal (withe dots).

[0373] CD3 dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 13B white squares) and activation of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 13D depicted in white squares) co-cultivated with target cells and 1 g/ml of FAP 4B9 antibody shows the highest luminescence signals of all, since it combines the CAR mediated activation with CD3 mediated activation. CD3 mediated luminescence signal is also visible when CARs are incubated with target cells and 1 g/ml of DP47/vk3 antibody (FIG. 13B and FIG. 13D upside down white triangles). Each point represents the mean value of technical triplicates. All values are depicted as baseline corrected. Standard deviation is indicated by error bars.

Example 7

[0374] Described herein is a Jurkat NFAT reporter CAR-T cell assay using adherent CEA expressing MKN45 tumor cells as target cells. As reporter cells a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 14A) or Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 14C) were used. Either CEA A5B7 IgG or CEA T84 LCHA IgG both with P329G LALA mutation were used. Further IgG DP47/vk3 harboring P329G LALA mutation was included as isotype control.

[0375] As positive control wells of a 96 well plate (Greiner-bio-one, CAT-No. 655185) were coated with 10 g/ml CD3 antibody (from Biolegend) in phosphate buffered saline (PBS) for 1 h at 37 C. The CD3 coated wells were washed twice with PBS, after the final washing step, PBS was fully removed.

[0376] Adherent MKN45 target cells were washed once with PBS and detached using Trypsin. Detached cells were resuspended in DMEM+4.5 g LD-Glucose+L-Glutamine+25 mM HEPES+10% FCS and 1% Glutamax.

[0377] Reporter cells or Jurkat NFAT wild type cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-160+10% FCS+1% Glutamax (growth medium).

[0378] Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted, analog as described for the reporter cells, to 110.sup.6 viable cells/ml in RPMI-1640+10% FCS+1% Glutamax.

[0379] Target cells and reporter cells were plated in 5:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one).

[0380] As a next step a serial dilution of an antibody with P329G LALA mutation, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.0001 g/ml in a final volume of 200 ul per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96 well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere.

[0381] After 20 h incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96 well plate (Greiner-bio-one) and 100 ul ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and RT luminescence was measured using Tecan Spark10M plate reader, 1 sec/well as detection time. Upon co-cultivation of target and reporter cells in a ratio 5:1 (FIGS. 14A and 14C, dots) for 20 h the graphs show a dose-dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells as well Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells when CEA A5B7 with P329G LALA mutation was used as antibody (FIGS. 14A and 14C grey dots). The use of CEA T84 LCHA with P329G LALA mutation showed only for Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells a dose dependent activation (FIG. 14A black dots). Whereas, when using the antibody with P329G LALA mutation an activation of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was detectable only at the highest antibody concentration of 1 g/ml.

[0382] If the control antibody DP47/vk3 IgG with P329G LALA mutation (FIGS. 14A and 14C, black triangles) was used, no activation of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD Jurkat NFAT reporter CAR-T cells or Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was detectable. Each point represents the mean value of technical triplicates. Standard deviation is indicated by error bars.

[0383] FIGS. 14B and 14D, represent data of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 14B) or Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 14D) both co-cultivated with target cells and 1 g/ml of CEA T8 LCHA P329G LALA or CEA A5B7 P329G LALA antibody compared to different control conditions.

[0384] Upon incubation with 1 g/ml CEA T8 LCHA P329G LALA, Jurkat NFAT CAR T cells alone (FIGS. 14B and 14D black diamond) as well as target cells alone (FIGS. 14B and 14D white circle) do not show any detectable luminescence signal.

[0385] Also Jurkat NFAT reporter CAR-T cells do not show a detectable luminescence signal upon co-cultivation with target cells and 1 g/ml IgG (FIG. 14B and FIG. 14D white square and white diamond). Whereas CD3 dependent activation of Jurkat NFAT reporter CAR-T cells co-cultivated with target cells and 1 g/ml IgG proofs their functionality through a detectable luminescence signal (FIGS. 14B and D grey cross).

[0386] CD3 dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD Jurkat NFAT reporter CAR-T cells (FIG. 14B black star and grey star) and activation of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing NFAT T cells (FIG. 14D black star and grey star) co-cultivated with target cells and 1 g/ml IgG show the highest luminescence signals of all, since CAR mediated activation and CD3 mediated activation is combined. CD3 mediated luminescence signal is also visible when CARs are incubated with target cells and 1 g/ml of DP47/vk3 antibody (FIG. 14B and FIG. 14D, grey plus). Each point represents the mean value of technical triplicates. Standard deviation is indicated by error bars.

Example 8

[0387] Described herein is a Jurkat NFAT reporter CAR-T cell assay using adherent TNC expressing CT26TNC cl 19 tumor cells as target cells. As reporter cells, a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 15C) or Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 15A) were used. TNCA2B10 with P329G LALA mutation was used as IgG. Further IgG DP47/vk3 harboring P329G LALA mutation was included as isotype control.

[0388] As positive control wells of a 96 well plate (Greiner-bio-one, CAT-No. 655185) were coated with 10 g/ml CD3 antibody (from Biolegend) in phosphate buffered saline (PBS) for 1 h at 37 C. The CD3 coated wells were washed twice with PBS, after the final washing step, PBS was fully removed.

[0389] Adherent CT26TNC cl 19 target cells were washed once with PBS and detached using Trypsin. Detached cells were resuspended in RPMI-1630+10% FCS and 1% Glutamax+15 g/ml Puromycin.

[0390] Reporter cells or Jurkat NFAT wild type T cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-160+10% FCS+1% Glutamax (growth medium).

[0391] Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted, analog as described for the reporter cells, to 110.sup.6 viable cells/ml in RPMI-1640+10% FCS+1% Glutamax.

[0392] Target cells and reporter cells were plated in 5:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one).

[0393] As a next step a serial dilution of an antibody with P329G LALA mutation, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.0001 g/ml in a final volume of 200 ul per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96 well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere.

[0394] After 20 h incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96 well plate (Greiner-bio-one) and 100 ul ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and RT luminescence was measured using Tecan Spark10M plate reader, 1 sec/well as detection time. Upon co-cultivation of target and reporter cells in a ratio 5:1 (FIGS. 15A and 16C black dots) for 20 h the graphs show a dose-dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells as well as of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells when TNC A2B10 with P329G LALA mutation was used as antibody. If the control antibody DP47/vk3 IgG with P329G LALA mutation (FIGS. 15A and 15C black dots) was used, neither the activation of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells nor Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was detectable. Each point represents the mean value of technical triplicates. All values are depicted as baseline corrected. Standard deviation is indicated by error bars.

[0395] FIGS. 15B and 15D, represent data of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 15D) or Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 15B) both co-cultivated with target cells and 1 g/ml of TNC A2B10 compared to different control conditions.

[0396] Jurkat NFAT reporter CAR-T cells do not show any detectable luminescence signal upon co-cultivation with target cells and 1 g/ml IgG (FIG. 15B and FIG. 15D white triangle). Whereas CD3 dependent activation of Jurkat NFAT cells co-cultivated with target cells and 1 g/ml IgG proofs their functionality through a detectable luminescence signal (FIG. 15B and FIG. 15D white square).

[0397] CD3 dependent activation of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 15B white circle) and activation of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 15D white circle) co-cultivated with target cells and 1 g/ml IgG show the highest luminescence signals of all, since CAR mediated activation and CD3 mediated activation is combined. CD3 mediated luminescence signal is also visible when CARs are incubated with target cells and 1 g/ml of DP47/vk3 antibody (FIG. 15B and FIG. 15D, black diamond). Each point represents the mean value of technical triplicates. Standard deviation is indicated by error bars.

Example 9

[0398] Described herein is a Jurkat NFAT reporter CAR-T cell assay using adherent TNC expressing CT26TNC cl 19 tumor cells as target cells. As reporter cells, a sorted pool of Anti-P329G-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 16A) was used. TNCA2B10 with P329G LALA mutation was used as IgG. Further IgG DP47/vk3 harboring P329G LALA mutation was included as isotype control.

[0399] As positive control wells of a 96-well plate (Greiner-bio-one, CAT-No. 655185) were coated with 10 g/ml CD3 antibody (from Biolegend) in phosphate buffered saline (PBS) for 1 h at 37 C. The CD3 coated wells were washed twice with PBS, after the final washing step, PBS was fully removed.

[0400] Adherent CT26TNC cl 19 target cells were washed once with PBS and detached using Trypsin. Detached cells were resuspended in RPMI-1630+10% FCS and 1% Glutamax+15 g/ml Puromycin.

[0401] Reporter cells or Jurkat NFAT wild type cells were counted and checked for their viability using Cedex HiRes. The cell number was adjusted to 110.sup.6 viable cells/ml. Therefore an appropriate aliquot of the cell suspension was pelleted at 210 g for 5 min at room temperature (RT) and resuspended in fresh RPMI-160+10% FCS+1% Glutamax (growth medium).

[0402] Target cells expressing the antigen of interest, were counted and checked for their viability as well. The cell number was adjusted, analog as described for the reporter cells, to 110.sup.6 viable cells/ml in RPMI-1640+10% FCS+1% Glutamax.

[0403] Target cells and reporter cells were plated in 5:1 E:T ratio (110.000 cells per well in total) in triplicates in a 96-well suspension culture plate (Greiner-bio one).

[0404] As a next step a serial dilution of an antibody with P329G LALA mutation, targeting the antigen of interest, was prepared in growth medium using a 2 ml deep well plate (Axygen). To obtain final concentrations ranging from 1 g/ml to 0.0001 g/ml in a final volume of 200 ul per well, a 50 l aliquot of the different dilutions was pipetted to the respective wells. The 96 well plate was centrifuged for 2 min at 190 g and RT. Sealed with Parafilm, the plate was incubated at 37 C. and 5% CO.sub.2 in a humidity atmosphere.

[0405] After 20 h incubation the content of each well was mixed by pipetting up and down 10 times using a multichannel pipette. 100 l cell suspension was transferred to a new white flat clear bottom 96 well plate (Greiner-bio-one) and 100 ul ONE-Glo Luciferase Assay (Promega) was added. After 15 min incubation in the dark on a rotary shaker at 300 rpm and RT luminescence was measured using Tecan Spark10M plate reader, 1 sec/well as detection time. Upon co-cultivation of target and reporter cells in a ratio 5:1 (FIG. 16A black dots) for 20 h the graphs show a dose-dependent activation of Anti-P329G-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells beginning with 0.01 g/ml of TNC A2B10 with P329G LALA mutation. If the control antibody DP47/vk3 IgG with P329G LALA mutation (FIGS. 16A and 17C grey dots) was used, no activation of Anti-P329G-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells was detectable. Each point represents the mean value of technical triplicates. All values are depicted as baseline corrected. Standard deviation is indicated by error bars.

[0406] FIG. 16B, represents data of Anti-P329G-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells co-cultivated with target cells and 1 g/ml of TNC A2B10 antibody compared to different control conditions.

[0407] Anti-P329G-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells incubated with target cells but without antibody (FIG. 16B black square) as well as Jurkat NFAT cells incubated with target cells and 1 g/ml of TNC A2B10 antibody (FIG. 16B white dots) show no detectable luminescence signal. Whereas Jurkat NFAT cells co-cultured with target cells and 1 g/ml of TNC A2B10 plated in CD3 coated wells, show a clear luminescence signal.

[0408] Further Anti-P329G-CD28ATD-CD28CSD-CD3zSSD Fab expressing Jurkat NFAT reporter CAR-T cells incubated with target cells and either 1 g/ml of TNC A2B10 or 1 g/ml DP47/vk3 antibody, in CD3 coated wells, show a high luminescence signal. Each point represents the mean value of technical triplicates. Standard deviation is indicated by error bars.

Example 10

[0409] Described herein is a Jurkat NFAT reporter CAR-T cell assay using peptide-pulsed T2 cells as target cells in order to assess the specificity of HLA-A2/WT1-peptide-binders 33F05 (SEQ ID NOs: 139 and 140), 11D06 (SEQ ID NOs: 141 and 142), 33H09 (SEQ ID NOs: 143 and 144) and 5E11 (SEQ ID NOs: 145 and 146). As reporter cells, a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells were used. The HLA-A2/WT1-peptide-binders with P329G LALA mutation were used as IgG. Prior to incubation with the HLA-A2/WT1-peptide-binding antibodies and the reporter cells, T2 cells were pulsed with the respective peptide at 10.sup.5 M for 2 hours at 37 C., or left unpulsed. Target cells and reporter cells were plated in 5:1 E:T ratio (10.000 effector cells per 2000 target cells per well) in triplicates in a 384-well white flat clear bottom plate (Greiner-bio-one). As a next step serial dilutions of the IgGs in question were prepared in growth medium. Incubation of reporter cells, T2 cells and IgGs was allowed for 16 hours at 37 C., followed by addition of 6 l per well of ONE-Glo luciferase substrate (Promega) and direct measurement of luminescence using a TECAN infinite M1000Pro plate reader.

[0410] The resulting graphs (FIG. 18A to FIG. 18D) show a dose-dependent activation of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells. Importantly, this activation appears selectively on RMF-peptide-pulsed T2 cells only for binders 11D06 and 33H09, but unspecifically on RMF- and VLD-peptide-pulsed T2 cells for binders 33F05 and 5E11, indicating the unselective nature of T cell activation for these latter two antibodies.

Example 11

[0411] Described herein is a Jurkat NFAT reporter CAR-T cell assay with a sorted pool of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT CAR-T cells as reporter cells. The reporter cells bind the HLA-A2/WT1-peptide binders in IgG format with P329G LALA mutation, which in turn do recognize the tested HLA-A2/WT1 peptides (RMF or VLD, respectively) to different degrees.

[0412] The four different antibodies in question (33F05 (SEQ ID NOs: 139 and 140), 11D06 (SEQ ID NOs: 141 and 142), 33H09 (SEQ ID NOs: 143 and 144) and 5E11 (SEQ ID NOs: 145 and 146), respectively) were present at 10 nM. Prior to co-incubation with the Jurkat NFAT reporter cells and the IgGs, T2 cells were pulsed with RMF- or VLD-peptide, respectively, like described in Example 10, or left without peptide. Jurkat NFAT reporter cells and target cells were coincubated for 6 hours at 37 C. at an E:T-ratio of 5:1 with 10000 to 2000 cells in 20 l per well of a 384-well plate (white flat clear bottom 384 well plate (Greiner bio-one)) and an IgG concentration of 10 nM, followed by addition of 6 l per well of ONE-Glo luciferase substrate (Promega) and direct measurement of luminescence using a TECAN infinite M1000Pro plate reader. The activation of CAR-NFAT-signaling from triplicate measurements of the respective experimental settings is expressed as column graph (FIG. 19) with error bars indicating standard deviations. Comparison of signals on RMF-peptide (target) vs. signal on VLD-peptide (off-target) helps to assess specificity of activation of the respective binder. Signal strength on T2 cells without peptide indicates unspecific binding for candidate binders 35F05 and 05E11. Candidate binders 33H09 and 11D06 prove specific and selective for HLA-A2/WT1-peptide RMF, only, since the signal on off-target peptide VLD is low, especially with regard to the assessed background (T2 w/o peptide, effector cells without T2 and effector and target cell co-incubation without addition of IgG).

Example 12

[0413] Described herein is the assessment of specificity of HLA-A2/WT1-peptide-binders 5E11 (SEQ ID NOs: 102 and 103) and 33H09 (SEQ ID NOs: 100 and 101) by means of flow cytometry with T2 cells pulsed with RMF-peptide or VLD-peptide. Prior to incubation with the HLA-A2/WT1-peptide-binding antibodies, T2 cells were pulsed with the respective peptide at 10.sup.5 M for 2 hours at 37 C., or left unpulsed. Binding of the respective IgG to cell aliquots of 100000 cells, each, at different concentrations of the antibody in question was allowed for 1 h on ice, followed by two washing steps with PBS, and assessed via anti-huFc-detection (anti-human F(ab)2_AF647 from Jackson ImmunoResearch) at a concentration of 90 nM in flow cytometry on a Fortessa analyzer (BD Biosciences). Both binders 5E11 and 33H09 give clear concentration-dependent binding signal on RMF-peptide-pulsed, but not on VLD-peptide-pulsed T2 cells (FIG. 20A and FIG. 20B). According to this flow cytometry-based assessment, both antibody candidates appear to bind specifically to RMF-peptide-pulsed, but not to VLD-peptide-pulsed T2 cells.

Example 13

[0414] Described herein is a Jurkat NFAT reporter CAR-T cell assay using a primary, patient derived tumor sample (lung metastasis of colon carcinoma). The tumor sample was characterized by fluorescence activated cell sorting (FACS) showing the expression of CEA and FAP antigen levels. FACS analysis showed that about 80% the CD45 positive cells express CEA and about 16% express FAP on their surface (FIG. 22A). As reporter cells, a sorted pool of Anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 22B) or a sorted pool of Anti-P329G-ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells (FIG. 22C) were used. Human IgG1 anti-CEA T84 LCHA, or anti-FAP (4B9) antibodies with P329G LALA mutation were used as IgGs. Tumor cells and reporter cells were plated in 5:1 E:T ratio (20.000 effector cells per 200.000 target cells per well) in duplicates in a 96-well white flat clear bottom plate. As a next step 1 g/ml serial dilutions of the IgGs in question were prepared in growth medium. Incubation of reporter cells, target cells and IgGs was allowed for 8 h hours at 37 C., followed by addition of 50 l per well of ONE-Glo luciferase substrate (Promega) and direct measurement of luminescence using a TECAN infinite M1000Pro plate reader.

[0415] The resulting graphs (FIG. 22B and FIG. 22C) show an antigen dependent activation of anti-P329G-ds-Fab-CD28ATD-CD28CSD-CD3zSSD or ds-scFv-CD28ATD-CD28CSD-CD3zSSD expressing Jurkat NFAT reporter CAR-T cells respectively. Importantly, this activation appears only in the presence of the respective antibody that recognizes the tumor antigen present in the provided sample.

Exemplary Sequences

[0416]

TABLE-US-00002 TABLE2 Anti-P329G-ds-scFvaminoacidsequences: Construct Aminoacidsequence SEQIDNO Anti-P329GCDRH1 RYWMN 1 Kabat Anti-P329GCDRH2 EITPDSSTINYTPSLKD 2 Kabat Anti-P329GCDRH3 PYDYGAWFAS 3 Kabat Anti-P329GCDRL1 RSSTGAVTTSNYAN 4 Kabat Anti-P329GCDRL2 GTNKRAP 5 Kabat Anti-P329GCDRL3 ALWYSNHWV 6 Kabat Anti-P329G-ds-scFv- EVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMN 7 CD28ATD- WVRQAPGKCLEWIGEITPDSSTINYTPSLKDKFIISRD CD28CSD- NAKNTLYLQMIKVRSEDTALYYCVRPYDYGAWFAS CD3zSSDfusion WGQGTLVTVSAGGGGSGGGGSGGGGSGGGGSQAV VTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQ EKPDHLFTGLIGGTNKRAPGVPARFSGSLIGDKAALTI TGAQTEDEAIYFCALWYSNHWVFGCGTKLTVLGGG GSFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRL LHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSR VKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLD KRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEA YSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALH MQALPPR Anti-P329G-dsVH EVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMN 8 WVRQAPGKCLEWIGEITPDSSTINYTPSLKDKFIISRD NAKNTLYLQMIKVRSEDTALYYCVRPYDYGAWFAS WGQGTLVTVSA Anti-P329G-dsVL QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYAN 9 WVQEKPDHLFTGLIGGTNKRAPGVPARFSGSLIGDK AALTITGAQTEDEAIYFCALWYSNHWVFGCGTKLTVL Anti-P329G-ds-scFv EVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMN 10 WVRQAPGKCLEWIGEITPDSSTINYTPSLKDKFIISRD NAKNTLYLQMIKVRSEDTALYYCVRPYDYGAWFAS WGQGTLVTVSAGGGGSGGGGSGGGGSGGGGSQAV VTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQ EKPDHLFTGLIGGTNKRAPGVPARFSGSLIGDKAALTI TGAQTEDEAIYFCALWYSNHWVFGCGTKLTVL CD28ATD FWVLVVVGGVLACYSLLVTVAFIIFWV 11 CD28CSD RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDF 12 AAYRS CD3zSSD RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVL 13 DKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR CD28ATD- FWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLH 14 CD28CSD-CD3zSSD SDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKF SRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRR GRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQA LPPR eGFP VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGD 15 ATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSR YPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKT RAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNY NSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADH YQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDH MVLLEFVTAAGITLGMDELYK (G4S)4linker GGGGSGGGGSGGGGSGGGGS 16 G4Slinker GGGGS 17 T2Alinker GEGRGSLLTCGDVEENPGP 18

TABLE-US-00003 TABLE3 anti-P329G-ds-scFvDNAsequences: Construct DNAsequence SEQIDNO Anti-P329G-ds-scFv- ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGC 19 CD28ATD- AACAGCTACCGGTGTGCATTCCGAGGTGAAGCTGC CD28CSD- TGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGG CD3zSSDfusion CAGCCTGAAGCTGAGCTGCGCCGCCAGCGGCTTCG ACTTCAGCAGGTACTGGATGAACTGGGTGAGGCA GGCCCCCGGCAAGTGTCTGGAGTGGATCGGCGAG ATCACCCCCGACAGCAGCACCATCAACTACACCCC CAGCCTGAAGGACAAGTTCATCATCAGCAGGGAC AACGCCAAGAACACCCTGTACCTGCAGATGATCAA GGTGAGGAGCGAGGACACCGCCCTGTACTACTGC GTGAGGCCCTACGACTACGGCGCCTGGTTCGCCAG CTGGGGCCAGGGCACCCTGGTGACCGTGAGCGCC GGAGGGGGCGGAAGTGGTGGCGGGGGAAGCGGCG GGGGTGGCAGCGGAGGGGGCGGATCTCAGGCCGT GGTGACCCAGGAGAGCGCCCTGACCACCAGCCCC GGCGAGACCGTGACCCTGACCTGCAGGAGCAGCA CCGGCGCCGTGACCACCAGCAACTACGCCAACTGG GTGCAGGAGAAGCCCGACCACCTGTTCACCGGCCT GATCGGCGGCACCAACAAGAGGGCCCCCGGCGTG CCCGCCAGGTTCAGCGGCAGCCTGATCGGCGACAA GGCCGCCCTGACCATCACCGGCGCCCAGACCGAG GACGAGGCCATCTACTTCTGCGCCCTGTGGTACAG CAACCACTGGGTGTTCGGCTGTGGCACCAAGCTGA CCGTGCTGGGAGGGGGCGGATCCTTCTGGGTGCTG GTGGTGGTGGGCGGCGTGCTGGCCTGCTACAGCCT GCTGGTGACCGTGGCCTTCATCATCTTCTGGGTGA GGAGCAAGAGGAGCAGGCTGCTGCACAGCGACTA CATGAACATGACCCCCAGGAGGCCCGGCCCCACC AGGAAGCACTACCAGCCCTACGCCCCCCCCAGGG ACTTCGCCGCCTACAGGAGCAGGGTGAAGTTCAGC AGGAGCGCCGACGCCCCCGCCTACCAGCAGGGCC AGAACCAGCTGTATAACGAGCTGAACCTGGGCAG GAGGGAGGAGTACGACGTGCTGGACAAGAGGAGG GGCAGGGACCCCGAGATGGGCGGCAAGCCCAGGA GGAAGAACCCCCAGGAGGGCCTGTATAACGAGCT GCAGAAGGACAAGATGGCCGAGGCCTACAGCGAG ATCGGCATGAAGGGCGAGAGGAGGAGGGGCAAGG GCCACGACGGCCTGTACCAGGGCCTGAGCACCGCC ACCAAGGACACCTACGACGCCCTGCACATGCAGG CCCTGCCCCCCAGG Anti-P329G-dsVH GAGGTGAAGCTGCTGGAGAGCGGCGGCGGCCTGG 20 TGCAGCCCGGCGGCAGCCTGAAGCTGAGCTGCGCC GCCAGCGGCTTCGACTTCAGCAGGTACTGGATGAA CTGGGTGAGGCAGGCCCCCGGCAAGTGTCTGGAGT GGATCGGCGAGATCACCCCCGACAGCAGCACCAT CAACTACACCCCCAGCCTGAAGGACAAGTTCATCA TCAGCAGGGACAACGCCAAGAACACCCTGTACCT GCAGATGATCAAGGTGAGGAGCGAGGACACCGCC CTGTACTACTGCGTGAGGCCCTACGACTACGGCGC CTGGTTCGCCAGCTGGGGCCAGGGCACCCTGGTGA CCGTGAGCGCC Anti-P329G-dsVL CAGGCCGTGGTGACCCAGGAGAGCGCCCTGACCA 21 CCAGCCCCGGCGAGACCGTGACCCTGACCTGCAGG AGCAGCACCGGCGCCGTGACCACCAGCAACTACG CCAACTGGGTGCAGGAGAAGCCCGACCACCTGTTC ACCGGCCTGATCGGCGGCACCAACAAGAGGGCCC CCGGCGTGCCCGCCAGGTTCAGCGGCAGCCTGATC GGCGACAAGGCCGCCCTGACCATCACCGGCGCCC AGACCGAGGACGAGGCCATCTACTTCTGCGCCCTG TGGTACAGCAACCACTGGGTGTTCGGCTGTGGCAC CAAGCTGACCGTGCTG Anti-P329G-ds-scFv ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGC 22 AACAGCTACCGGTGTGCATTCCGAGGTGAAGCTGC TGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGG CAGCCTGAAGCTGAGCTGCGCCGCCAGCGGCTTCG ACTTCAGCAGGTACTGGATGAACTGGGTGAGGCA GGCCCCCGGCAAGTGTCTGGAGTGGATCGGCGAG ATCACCCCCGACAGCAGCACCATCAACTACACCCC CAGCCTGAAGGACAAGTTCATCATCAGCAGGGAC AACGCCAAGAACACCCTGTACCTGCAGATGATCAA GGTGAGGAGCGAGGACACCGCCCTGTACTACTGC GTGAGGCCCTACGACTACGGCGCCTGGTTCGCCAG CTGGGGCCAGGGCACCCTGGTGACCGTGAGCGCC GGAGGGGGCGGAAGTGGTGGCGGGGGAAGCGGCG GGGGTGGCAGCGGAGGGGGCGGATCTCAGGCCGT GGTGACCCAGGAGAGCGCCCTGACCACCAGCCCC GGCGAGACCGTGACCCTGACCTGCAGGAGCAGCA CCGGCGCCGTGACCACCAGCAACTACGCCAACTGG GTGCAGGAGAAGCCCGACCACCTGTTCACCGGCCT GATCGGCGGCACCAACAAGAGGGCCCCCGGCGTG CCCGCCAGGTTCAGCGGCAGCCTGATCGGCGACAA GGCCGCCCTGACCATCACCGGCGCCCAGACCGAG GACGAGGCCATCTACTTCTGCGCCCTGTGGTACAG CAACCACTGGGTGTTCGGCTGTGGCACCAAGCTGA CCGTGCTG CD28ATD TTCTGGGTGCTGGTGGTGGTGGGCGGCGTGCTGGC 23 CTGCTACAGCCTGCTGGTGACCGTGGCCTTCATCA TCTTCTGGGTG CD28CSD AGGAGCAAGAGGAGCAGGCTGCTGCACAGCGACT 24 ACATGAACATGACCCCCAGGAGGCCCGGCCCCAC CAGGAAGCACTACCAGCCCTACGCCCCCCCCAGGG ACTTCGCCGCCTACAGGAGC CD3zSSD AGGGTGAAGTTCAGCAGGAGCGCCGACGCCCCCG 25 CCTACCAGCAGGGCCAGAACCAGCTGTATAACGA GCTGAACCTGGGCAGGAGGGAGGAGTACGACGTG CTGGACAAGAGGAGGGGCAGGGACCCCGAGATGG GCGGCAAGCCCAGGAGGAAGAACCCCCAGGAGGG CCTGTATAACGAGCTGCAGAAGGACAAGATGGCC GAGGCCTACAGCGAGATCGGCATGAAGGGCGAGA GGAGGAGGGGCAAGGGCCACGACGGCCTGTACCA GGGCCTGAGCACCGCCACCAAGGACACCTACGAC GCCCTGCACATGCAGGCCCTGCCCCCCAGG CD28ATD- TTCTGGGTGCTGGTGGTGGTGGGCGGCGTGCTGGC 26 CD28CSD-CD3zSSD CTGCTACAGCCTGCTGGTGACCGTGGCCTTCATCA TCTTCTGGGTGAGGAGCAAGAGGAGCAGGCTGCT GCACAGCGACTACATGAACATGACCCCCAGGAGG CCCGGCCCCACCAGGAAGCACTACCAGCCCTACGC CCCCCCCAGGGACTTCGCCGCCTACAGGAGCAGGG TGAAGTTCAGCAGGAGCGCCGACGCCCCCGCCTAC CAGCAGGGCCAGAACCAGCTGTATAACGAGCTGA ACCTGGGCAGGAGGGAGGAGTACGACGTGCTGGA CAAGAGGAGGGGCAGGGACCCCGAGATGGGCGGC AAGCCCAGGAGGAAGAACCCCCAGGAGGGCCTGT ATAACGAGCTGCAGAAGGACAAGATGGCCGAGGC CTACAGCGAGATCGGCATGAAGGGCGAGAGGAGG AGGGGCAAGGGCCACGACGGCCTGTACCAGGGCC TGAGCACCGCCACCAAGGACACCTACGACGCCCTG CACATGCAGGCCCTGCCCCCCAGG T2Aelement TCCGGAGAGGGCAGAGGAAGTCTTCTAACATGCG 27 GTGACGTGGAGGAGAATCCCGGCCCTAGG eGFP GTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGG 28 TGCCCATCCTGGTCGAGCTGGACGGCGACGTAAAC GGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGG GCGATGCCACCTACGGCAAGCTGACCCTGAAGTTC ATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCC CACCCTCGTGACCACCCTGACCTACGGCGTGCAGT GCTTCAGCCGCTACCCCGACCACATGAAGCAGCAC GACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGT CCAGGAGCGCACCATCTTCTTCAAGGACGACGGCA ACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGG CGACACCCTGGTGAACCGCATCGAGCTGAAGGGC ATCGACTTCAAGGAGGACGGCAACATCCTGGGGC ACAAGCTGGAGTACAACTACAACAGCCACAACGT CTATATCATGGCCGACAAGCAGAAGAACGGCATC AAGGTGAACTTCAAGATCCGCCACAACATCGAGG ACGGCAGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGC CCGACAACCACTACCTGAGCACCCAGTCCGCCCTG AGCAAAGACCCCAACGAGAAGCGCGATCACATGG TCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACT CTCGGCATGGACGAGCTGTACAAGTGA Anti-P329G-ds-scFv- ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGC 29 CD28ATD- AACAGCTACCGGTGTGCATTCCGAGGTGAAGCTGC CD28CSD- TGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGG CD3zSSD- CAGCCTGAAGCTGAGCTGCGCCGCCAGCGGCTTCG eGFPfusion ACTTCAGCAGGTACTGGATGAACTGGGTGAGGCA GGCCCCCGGCAAGTGTCTGGAGTGGATCGGCGAG ATCACCCCCGACAGCAGCACCATCAACTACACCCC CAGCCTGAAGGACAAGTTCATCATCAGCAGGGAC AACGCCAAGAACACCCTGTACCTGCAGATGATCAA GGTGAGGAGCGAGGACACCGCCCTGTACTACTGC GTGAGGCCCTACGACTACGGCGCCTGGTTCGCCAG CTGGGGCCAGGGCACCCTGGTGACCGTGAGCGCC GGAGGGGGCGGAAGTGGTGGCGGGGGAAGCGGCG GGGGTGGCAGCGGAGGGGGCGGATCTCAGGCCGT GGTGACCCAGGAGAGCGCCCTGACCACCAGCCCC GGCGAGACCGTGACCCTGACCTGCAGGAGCAGCA CCGGCGCCGTGACCACCAGCAACTACGCCAACTGG GTGCAGGAGAAGCCCGACCACCTGTTCACCGGCCT GATCGGCGGCACCAACAAGAGGGCCCCCGGCGTG CCCGCCAGGTTCAGCGGCAGCCTGATCGGCGACAA GGCCGCCCTGACCATCACCGGCGCCCAGACCGAG GACGAGGCCATCTACTTCTGCGCCCTGTGGTACAG CAACCACTGGGTGTTCGGCTGTGGCACCAAGCTGA CCGTGCTGGGAGGGGGCGGATCCTTCTGGGTGCTG GTGGTGGTGGGCGGCGTGCTGGCCTGCTACAGCCT GCTGGTGACCGTGGCCTTCATCATCTTCTGGGTGA GGAGCAAGAGGAGCAGGCTGCTGCACAGCGACTA CATGAACATGACCCCCAGGAGGCCCGGCCCCACC AGGAAGCACTACCAGCCCTACGCCCCCCCCAGGG ACTTCGCCGCCTACAGGAGCAGGGTGAAGTTCAGC AGGAGCGCCGACGCCCCCGCCTACCAGCAGGGCC AGAACCAGCTGTATAACGAGCTGAACCTGGGCAG GAGGGAGGAGTACGACGTGCTGGACAAGAGGAGG GGCAGGGACCCCGAGATGGGCGGCAAGCCCAGGA GGAAGAACCCCCAGGAGGGCCTGTATAACGAGCT GCAGAAGGACAAGATGGCCGAGGCCTACAGCGAG ATCGGCATGAAGGGCGAGAGGAGGAGGGGCAAGG GCCACGACGGCCTGTACCAGGGCCTGAGCACCGCC ACCAAGGACACCTACGACGCCCTGCACATGCAGG CCCTGCCCCCCAGGTCCGGAGAGGGCAGAGGAAG TCTTCTAACATGCGGTGACGTGGAGGAGAATCCCG GCCCTAGGGTGAGCAAGGGCGAGGAGCTGTTCAC CGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCG ACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGA GGGCGAGGGCGATGCCACCTACGGCAAGCTGACC CTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGT GCCCTGGCCCACCCTCGTGACCACCCTGACCTACG GCGTGCAGTGCTTCAGCCGCTACCCCGACCACATG AAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGA AGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGG ACGACGGCAACTACAAGACCCGCGCCGAGGTGAA GTTCGAGGGCGACACCCTGGTGAACCGCATCGAGC TGAAGGGCATCGACTTCAAGGAGGACGGCAACAT

TABLE-US-00004 TABLE4 8:Anti-P329G-Fabaminoacidsequences: Construct Aminoacidsequence SEQIDNO Anti-P329GCDRH1 seeTable2 1 Kabat Anti-P329GCDRH2 seeTable2 2 Kabat Anti-P329GCDRH3 seeTable2 3 Kabat Anti-P329GCDRL1 seeTable2 4 Kabat Anti-P329GCDRL2 seeTable2 5 Kabat Anti-P329GCDRL3 seeTable2 6 Kabat Anti-P329G-Fab- EVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMN 30 heavychain- WVRQAPGKGLEWIGEITPDSSTINYTPSLKDKFIISRD CD28ATD- NAKNTLYLQMIKVRSEDTALYYCVRPYDYGAWFAS CD28CSD- WGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAAL CD3zSSDfusion GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSCGGGGSFWVLVVVGGVLACYSLLVTVAFIIFW VRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRD FAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRR EEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQK DKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKD TYDALHMQALPPR Anti-P329G-Fab EVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMN 31 heavychain WVRQAPGKGLEWIGEITPDSSTINYTPSLKDKFIISRD NAKNTLYLQMIKVRSEDTALYYCVRPYDYGAWFAS WGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSC Anti-P329G-Fab QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYAN 32 lightchain WVQEKPDHLFTGLIGGTNKRAPGVPARFSGSLIGDK AALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTV LRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Anti-P329GVL QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYAN 33 WVQEKPDHLFTGLIGGTNKRAPGVPARFSGSLIGDK AALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTV L CL RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA 34 KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Anti-P329GVH EVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMN 35 WVRQAPGKGLEWIGEITPDSSTINYTPSLKDKFIISRD NAKNTLYLQMIKVRSEDTALYYCVRPYDYGAWFAS WGQGTLVTVSA CH1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV 36 TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS SLGTQTYICNVNHKPSNTKVDKKVEPKSC

TABLE-US-00005 TABLE5 9:Anti-P329G-FabDNAsequences: Construct DNASequenz SEQIDNO Anti-P329G-Fab- ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGC 37 heavychain- AACAGCTACGGGTGTGCATTCCCAGGCCGTGGTGA CD28ATD- CCCAGGAGAGCGCCCTGACCACCAGCCCCGGCGA CD28CSD- GACCGTGACCCTGACCTGCAGGAGCAGCACCGGC CD3zSSDfusion GCCGTGACCACCAGCAACTACGCCAACTGGGTGCA GGAGAAGCCCGACCACCTGTTCACCGGCCTGATCG GCGGCACCAACAAGAGGGCCCCCGGCGTGCCCGC CAGGTTCAGCGGCAGCCTGATCGGCGACAAGGCC GCCCTGACCATCACCGGCGCCCAGACCGAGGACG AGGCCATCTACTTCTGCGCCCTGTGGTACAGCAAC CACTGGGTGTTCGGCGGTGGCACCAAGCTGACCGT GCTGCGTACGGTGGCTGCACCATCTGTCTTCATCTT CCCGCCATCTGATGAGCAGTTGAAATCTGGAACTG CCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCA GAGAGGCCAAAGTACAGTGGAAGGTGGATAACGC CCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAG AGCAGGACAGCAAGGACAGCACCTACAGCCTCAG CAGCACCCTGACGCTGAGCAAAGCAGACTACGAG AAACACAAAGTCTACGCCTGCGAAGTCACCCATCA GGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACA GGGGAGAGTGTTAGGAATTCCCCGAAGTAACTTAG AAGCTGTAAATCAACGATCAATAGCAGGTGTGGC ACACCAGTCATACCTTGATCAAGCACTTCTGTTTCC CCGGACTGAGTATCAATAGGCTGCTCGCGCGGCTG AAGGAGAAAACGTTCGTTACCCGACCAACTACTTC GAGAAGCTTAGTACCACCATGAACGAGGCAGGGT GTTTCGCTCAGCACAACCCCAGTGTAGATCAGGCT GATGAGTCACTGCAACCCCCATGGGCGACCATGGC AGTGGCTGCGTTGGCGGCCTGCCCATGGAGAAATC CATGGGACGCTCTAATTCTGACATGGTGTGAAGTG CCTATTGAGCTAACTGGTAGTCCTCCGGCCCCTGA TTGCGGCTAATCCTAACTGCGGAGCACATGCTCAC AAACCAGTGGGTGGTGTGTCGTAACGGGCAACTCT GCAGCGGAACCGACTACTTTGGGTGTCCGTGTTTC CTTTTATTCCTATATTGGCTGCTTATGGTGACAATC AAAAAGTTGTTACCATATAGCTATTGGATTGGCCA TCCGGTGTGCAACAGGGCAACTGTTTACCTATTTA TTGGTTTTGTACCATTATCACTGAAGTCTGTGATCA CTCTCAAATTCATTTTGACCCTCAACACAATCAAA CGCCACCATGGGATGGAGCTGTATCATCCTCTTCT TGGTAGCAACAGCTACCGGTGTGCACTCCGAGGTG AAGCTGCTGGAGAGCGGCGGCGGCCTGGTGCAGC CCGGCGGCAGCCTGAAGCTGAGCTGCGCCGCCAG CGGCTTCGACTTCAGCAGGTACTGGATGAACTGGG TGAGGCAGGCCCCCGGCAAGGGTCTGGAGTGGAT CGGCGAGATCACCCCCGACAGCAGCACCATCAACT ACACCCCCAGCCTGAAGGACAAGTTCATCATCAGC AGGGACAACGCCAAGAACACCCTGTACCTGCAGA TGATCAAGGTGAGGAGCGAGGACACCGCCCTGTA CTACTGCGTGAGGCCCTACGACTACGGCGCCTGGT TCGCCAGCTGGGGCCAGGGCACCCTGGTGACCGTG AGCGCCGCTAGCACCAAGGGCCCCTCCGTGTTCCC CCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGGC ACAGCCGCTCTGGGCTGCCTGGTCAAGGACTACTT CCCCGAGCCCGTGACCGTGTCCTGGAACAGCGGAG CCCTGACCTCCGGCGTGCACACCTTCCCCGCCGTG CTGCAGAGTTCTGGCCTGTATAGCCTGAGCAGCGT GGTCACCGTGCCTTCTAGCAGCCTGGGCACCCAGA CCTACATCTGCAACGTGAACCACAAGCCCAGCAAC ACCAAGGTGGACAAGAAGGTGGAGCCCAAGAGCT GCGGAGGGGGCGGATCCTTCTGGGTGCTGGTGGTG GTGGGCGGCGTGCTGGCCTGCTACAGCCTGCTGGT GACCGTGGCCTTCATCATCTTCTGGGTGAGGAGCA AGAGGAGCAGGCTGCTGCACAGCGACTACATGAA CATGACCCCCAGGAGGCCCGGCCCCACCAGGAAG CACTACCAGCCCTACGCCCCCCCCAGGGACTTCGC CGCCTACAGGAGCAGGGTGAAGTTCAGCAGGAGC GCCGACGCCCCCGCCTACCAGCAGGGCCAGAACC AGCTGTATAACGAGCTGAACCTGGGCAGGAGGGA GGAGTACGACGTGCTGGACAAGAGGAGGGGCAGG GACCCCGAGATGGGCGGCAAGCCCAGGAGGAAGA ACCCCCAGGAGGGCCTGTATAACGAGCTGCAGAA GGACAAGATGGCCGAGGCCTACAGCGAGATCGGC ATGAAGGGCGAGAGGAGGAGGGGCAAGGGCCAC GACGGCCTGTACCAGGGCCTGAGCACCGCCACCA AGGACACCTACGACGCCCTGCACATGCAGGCCCTG CCCCCCAGG Anti-P329GVL CAGGCCGTGGTGACCCAGGAGAGCGCCCTGACCA 38 CCAGCCCCGGCGAGACCGTGACCCTGACCTGCAGG AGCAGCACCGGCGCCGTGACCACCAGCAACTACG CCAACTGGGTGCAGGAGAAGCCCGACCACCTGTTC ACCGGCCTGATCGGCGGCACCAACAAGAGGGCCC CCGGCGTGCCCGCCAGGTTCAGCGGCAGCCTGATC GGCGACAAGGCCGCCCTGACCATCACCGGCGCCC AGACCGAGGACGAGGCCATCTACTTCTGCGCCCTG TGGTACAGCAACCACTGGGTGTTCGGCGGTGGCAC CAAGCTGACCGTGCTG CL CGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCG 39 CCATCTGATGAGCAGTTGAAATCTGGAACTGCCTC TGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAG AGGCCAAAGTACAGTGGAAGGTGGATAACGCCCT CCAATCGGGTAACTCCCAGGAGAGTGTCACAGAG CAGGACAGCAAGGACAGCACCTACAGCCTCAGCA GCACCCTGACGCTGAGCAAAGCAGACTACGAGAA ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGG GCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGG GGAGAGTGTTAG Anti-P329GVH GAGGTGAAGCTGCTGGAGAGCGGCGGCGGCCTGG 40 TGCAGCCCGGCGGCAGCCTGAAGCTGAGCTGCGCC GCCAGCGGCTTCGACTTCAGCAGGTACTGGATGAA CTGGGTGAGGCAGGCCCCCGGCAAGGGTCTGGAG TGGATCGGCGAGATCACCCCCGACAGCAGCACCAT CAACTACACCCCCAGCCTGAAGGACAAGTTCATCA TCAGCAGGGACAACGCCAAGAACACCCTGTACCT GCAGATGATCAAGGTGAGGAGCGAGGACACCGCC CTGTACTACTGCGTGAGGCCCTACGACTACGGCGC CTGGTTCGCCAGCTGGGGCCAGGGCACCCTGGTGA CCGTGAGCGCC CH1 GCTAGCACCAAGGGCCCCTCCGTGTTCCCCCTGGC 41 CCCCAGCAGCAAGAGCACCAGCGGCGGCACAGCC GCTCTGGGCTGCCTGGTCAAGGACTACTTCCCCGA GCCCGTGACCGTGTCCTGGAACAGCGGAGCCCTGA CCTCCGGCGTGCACACCTTCCCCGCCGTGCTGCAG AGTTCTGGCCTGTATAGCCTGAGCAGCGTGGTCAC CGTGCCTTCTAGCAGCCTGGGCACCCAGACCTACA TCTGCAACGTGAACCACAAGCCCAGCAACACCAA GGTGGACAAGAAGGTGGAGCCCAAGAGCTGC IRESEV71,internal CCCGAAGTAACTTAGAAGCTGTAAATCAACGATCA 42 ribosomalentryside ATAGCAGGTGTGGCACACCAGTCATACCTTGATCA AGCACTTCTGTTTCCCCGGACTGAGTATCAATAGG CTGCTCGCGCGGCTGAAGGAGAAAACGTTCGTTAC CCGACCAACTACTTCGAGAAGCTTAGTACCACCAT GAACGAGGCAGGGTGTTTCGCTCAGCACAACCCCA GTGTAGATCAGGCTGATGAGTCACTGCAACCCCCA TGGGCGACCATGGCAGTGGCTGCGTTGGCGGCCTG CCCATGGAGAAATCCATGGGACGCTCTAATTCTGA CATGGTGTGAAGTGCCTATTGAGCTAACTGGTAGT CCTCCGGCCCCTGATTGCGGCTAATCCTAACTGCG GAGCACATGCTCACAAACCAGTGGGTGGTGTGTCG TAACGGGCAACTCTGCAGCGGAACCGACTACTTTG GGTGTCCGTGTTTCCTTTTATTCCTATATTGGCTGC TTATGGTGACAATCAAAAAGTTGTTACCATATAGC TATTGGATTGGCCATCCGGTGTGCAACAGGGCAAC TGTTTACCTATTTATTGGTTTTGTACCATTATCACT GAAGTCTGTGATCACTCTCAAATTCATTTTGACCCT CAACACAATCAAAC CD28ATD- seeTable3 27 CD28CSD-CD3zSSD Anti-P329G-Fab- ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGC 43 heavychain- AACAGCTACGGGTGTGCATTCCCAGGCCGTGGTGA CD28ATD- CCCAGGAGAGCGCCCTGACCACCAGCCCCGGCGA CD28CSD- GACCGTGACCCTGACCTGCAGGAGCAGCACCGGC CD3zSSD- GCCGTGACCACCAGCAACTACGCCAACTGGGTGCA eGFPfusion GGAGAAGCCCGACCACCTGTTCACCGGCCTGATCG GCGGCACCAACAAGAGGGCCCCCGGCGTGCCCGC CAGGTTCAGCGGCAGCCTGATCGGCGACAAGGCC GCCCTGACCATCACCGGCGCCCAGACCGAGGACG AGGCCATCTACTTCTGCGCCCTGTGGTACAGCAAC CACTGGGTGTTCGGCGGTGGCACCAAGCTGACCGT GCTGCGTACGGTGGCTGCACCATCTGTCTTCATCTT CCCGCCATCTGATGAGCAGTTGAAATCTGGAACTG CCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCA GAGAGGCCAAAGTACAGTGGAAGGTGGATAACGC CCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAG AGCAGGACAGCAAGGACAGCACCTACAGCCTCAG CAGCACCCTGACGCTGAGCAAAGCAGACTACGAG AAACACAAAGTCTACGCCTGCGAAGTCACCCATCA GGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACA GGGGAGAGTGTTAGGAATTCCCCGAAGTAACTTAG AAGCTGTAAATCAACGATCAATAGCAGGTGTGGC ACACCAGTCATACCTTGATCAAGCACTTCTGTTTCC CCGGACTGAGTATCAATAGGCTGCTCGCGCGGCTG AAGGAGAAAACGTTCGTTACCCGACCAACTACTTC GAGAAGCTTAGTACCACCATGAACGAGGCAGGGT GTTTCGCTCAGCACAACCCCAGTGTAGATCAGGCT GATGAGTCACTGCAACCCCCATGGGCGACCATGGC AGTGGCTGCGTTGGCGGCCTGCCCATGGAGAAATC CATGGGACGCTCTAATTCTGACATGGTGTGAAGTG CCTATTGAGCTAACTGGTAGTCCTCCGGCCCCTGA TTGCGGCTAATCCTAACTGCGGAGCACATGCTCAC AAACCAGTGGGTGGTGTGTCGTAACGGGCAACTCT GCAGCGGAACCGACTACTTTGGGTGTCCGTGTTTC CTTTTATTCCTATATTGGCTGCTTATGGTGACAATC AAAAAGTTGTTACCATATAGCTATTGGATTGGCCA TCCGGTGTGCAACAGGGCAACTGTTTACCTATTTA TTGGTTTTGTACCATTATCACTGAAGTCTGTGATCA CTCTCAAATTCATTTTGACCCTCAACACAATCAAA CGCCACCATGGGATGGAGCTGTATCATCCTCTTCT TGGTAGCAACAGCTACCGGTGTGCACTCCGAGGTG AAGCTGCTGGAGAGCGGCGGCGGCCTGGTGCAGC CCGGCGGCAGCCTGAAGCTGAGCTGCGCCGCCAG CGGCTTCGACTTCAGCAGGTACTGGATGAACTGGG TGAGGCAGGCCCCCGGCAAGGGTCTGGAGTGGAT CGGCGAGATCACCCCCGACAGCAGCACCATCAACT ACACCCCCAGCCTGAAGGACAAGTTCATCATCAGC AGGGACAACGCCAAGAACACCCTGTACCTGCAGA TGATCAAGGTGAGGAGCGAGGACACCGCCCTGTA CTACTGCGTGAGGCCCTACGACTACGGCGCCTGGT TCGCCAGCTGGGGCCAGGGCACCCTGGTGACCGTG AGCGCCGCTAGCACCAAGGGCCCCTCCGTGTTCCC CCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGGC ACAGCCGCTCTGGGCTGCCTGGTCAAGGACTACTT CCCCGAGCCCGTGACCGTGTCCTGGAACAGCGGAG CCCTGACCTCCGGCGTGCACACCTTCCCCGCCGTG CTGCAGAGTTCTGGCCTGTATAGCCTGAGCAGCGT GGTCACCGTGCCTTCTAGCAGCCTGGGCACCCAGA CCTACATCTGCAACGTGAACCACAAGCCCAGCAAC ACCAAGGTGGACAAGAAGGTGGAGCCCAAGAGCT GCGGAGGGGGCGGATCCTTCTGGGTGCTGGTGGTG GTGGGCGGCGTGCTGGCCTGCTACAGCCTGCTGGT GACCGTGGCCTTCATCATCTTCTGGGTGAGGAGCA AGAGGAGCAGGCTGCTGCACAGCGACTACATGAA CATGACCCCCAGGAGGCCCGGCCCCACCAGGAAG CACTACCAGCCCTACGCCCCCCCCAGGGACTTCGC CGCCTACAGGAGCAGGGTGAAGTTCAGCAGGAGC GCCGACGCCCCCGCCTACCAGCAGGGCCAGAACC AGCTGTATAACGAGCTGAACCTGGGCAGGAGGGA GGAGTACGACGTGCTGGACAAGAGGAGGGGCAGG GACCCCGAGATGGGCGGCAAGCCCAGGAGGAAGA ACCCCCAGGAGGGCCTGTATAACGAGCTGCAGAA GGACAAGATGGCCGAGGCCTACAGCGAGATCGGC ATGAAGGGCGAGAGGAGGAGGGGCAAGGGCCAC GACGGCCTGTACCAGGGCCTGAGCACCGCCACCA AGGACACCTACGACGCCCTGCACATGCAGGCCCTG CCCCCCAGGTCCGGAGAGGGCAGAGGAAGTCTTCT AACATGCGGTGACGTGGAGGAGAATCCCGGCCCT AGGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGG TGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTA AACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCG AGGGCGATGCCACCTACGGCAAGCTGACCCTGAA GTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCT GGCCCACCCTCGTGACCACCCTGACCTACGGCGTG CAGTGCTTCAGCCGCTACCCCGACCACATGAAGCA GCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCT ACGTCCAGGAGCGCACCATCTTCTTCAAGGACGAC GGCAACTACAAGACCCGCGCCGAGGTGAAGTTCG AGGGCGACACCCTGGTGAACCGCATCGAGCTGAA GGGCATCGACTTCAAGGAGGACGGCAACATCCTG GGGCACAAGCTGGAGTACAACTACAACAGCCACA ACGTCTATATCATGGCCGACAAGCAGAAGAACGG CATCAAGGTGAACTTCAAGATCCGCCACAACATCG AGGACGGCAGCGTGCAGCTCGCCGACCACTACCA GCAGAACACCCCCATCGGCGACGGCCCCGTGCTGC TGCCCGACAACCACTACCTGAGCACCCAGTCCGCC CTGAGCAAAGACCCCAACGAGAAGCGCGATCACA TGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATC ACTCTCGGCATGGACGAGCTGTACAAGTGA

TABLE-US-00006 TABLE6 10:Anti-AAA-scFvaminoacidsequences Construct Aminoacidsequence SEQIDNO Anti-AAACDRH1 SYGMS 44 Kabat Anti-AAACDRH2 SSGGSY 45 Kabat Anti-AAACDRH3 LGMITTGYAMDY 46 Kabat Anti-AAACDRL1 RSSQTIVHSTGHTYLE 47 Kabat Anti-AAACDRL2 KVSNRFS 48 Kabat Anti-AAACDRL3 FQGSHVPYT 49 Kabat Anti-AAA-scFv- MNFGLSLVFLALILKGVQCEVQLVESGGDLVKPGGS 50 CD28ATD- LKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISS CD28CSD- GGSYIYYPDSVKGRFTISRDNAKNTLYLQMSSLKSED CD3zSSDfusion TAMYYCARLGMITTGYAMDYWGQGTSVTVSSGGG GSGGGGSGGGGSGGGGSDVLMTQTPLSLPVSLGDQ ASISCRSSQTIVHSTGHTYLEWFLQKPGQSPKLLIYKV SNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYC FQGSHVPYTFGGGTKLEIKGGGGSFWVLVVVGGVL ACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRP GPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPR Anti-AAA-scFv MNFGLSLVFLALILKGVQCEVQLVESGGDLVKPGGS 51 LKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISS GGSYIYYPDSVKGRFTISRDNAKNTLYLQMSSLKSED TAMYYCARLGMITTGYAMDYWGQGTSVTVSSGGG GSGGGGSGGGGSGGGGSDVLMTQTPLSLPVSLGDQ ASISCRSSQTIVHSTGHTYLEWFLQKPGQSPKLLIYKV SNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYC FQGSHVPYTFGGGTKLEIK Anti-AAAVH MNFGLSLVFLALILKGVQCEVQLVESGGDLVKPGGS 52 LKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISS GGSYIYYPDSVKGRFTISRDNAKNTLYLQMSSLKSED TAMYYCARLGMITTGYAMDYWGQGTSVTVSS Anti-AAAVL DVLMTQTPLSLPVSLGDQASISCRSSQTIVHSTGHTYL 53 EWFLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTD FTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIK

TABLE-US-00007 TABLE7 11:Anti-AAA-Fabaminoacidsequences Construct ProteinSequence SEQIDNO Anti-AAACDRH1 seeTable6 44 Kabat Anti-AAACDRH2 seeTable6 45 Kabat Anti-AAACDRH3 seeTable6 46 Kabat Anti-AAACDRL1 seeTable6 47 Kabat Anti-AAACDRL2 seeTable6 48 Kabat Anti-AAACDRL3 seeTable6 49 Kabat Anti-AAA-Fab- MNFGLSLVFLALILKGVQCEVQLVESGGDLVKPGGS 54 heavychain- LKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISS CD28ATD- GGSYIYYPDSVKGRFTISRDNAKNTLYLQMSSLKSED CD28CSD- TAMYYCARLGMITTGYAMDYWGQGTSVTVSSASTK CD3zSSDfusion GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT QTYICNVNHKPSNTKVDKKVEPKSCGGGGSFWVLV VVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMN MTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSAD APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPE MGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGE RRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Anti-AAA-Fab MNFGLSLVFLALILKGVQCEVQLVESGGDLVKPGGS 55 heavychain LKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISS GGSYIYYPDSVKGRFTISRDNAKNTLYLQMSSLKSED TAMYYCARLGMITTGYAMDYWGQGTSVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT QTYICNVNHKPSNTKVDKKVEPKSC Anti-AAA-Fab DVLMTQTPLSLPVSLGDQASISCRSSQTIVHSTGHTYL 56 lightchain EWFLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTD FTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIK RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Anti-AAAVL seeTable6 53 CL seeTable4 35 Anti-AAAVH seeTable6 52 CH1 seeTable4 37

TABLE-US-00008 TABLE8 8:Anti-DIG-ds-scFvaminoacidsequences: Construct Aminoacidsequence SEQIDNO Anti-DIGCDRH1 DYAMS 57 Kabat Anti-DIGCDRH2 SINIGATYIYYADSVKG 58 Kabat Anti-DIGCDRH3 PGSPYEYDKAYYSMAY 59 Kabat Anti-DIGCDRL1 RASQDIKNYLN 60 Kabat Anti-DIGCDRL2 YSSTLLS 61 Kabat Anti-DIGCDRL3 QQSITLPPT 62 Kabat Anti-DIG-ds-scFv- QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYAMSW 63 CD28ATD- IRQAPGKCLEWVSSINIGATYIYYADSVKGRFTISRDN CD28CSD- AKNSLYLQMNSLRAEDTAVYYCARPGSPYEYDKAY CD3zSSDfusion YSMAYWGQGTTVTVSSGGGGSGGGGSGGGGSGGG GSDIQMTQSPSSLSASVGDRVTITCRASQDIKNYLNW YQQKPGKAPKLLIYYSSTLLSGVPSRFSGSGSGTDFTL TISSLQPEDFATYYCQQSITLPPTFGCGTKVEIKGGGG SFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLL HSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRV KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDK RRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYS EIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQ ALPPR Anti-DIG-dsVH QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYAMSW 64 IRQAPGKCLEWVSSINIGATYIYYADSVKGRFTISRDN AKNSLYLQMNSLRAEDTAVYYCARPGSPYEYDKAY YSMAYWGQGTTVTVSS Anti-DIG-dsVL DIQMTQSPSSLSASVGDRVTITCRASQDIKNYLNWYQ 65 QKPGKAPKLLIYYSSTLLSGVPSRFSGSGSGTDFTLTI SSLQPEDFATYYCQQSITLPPTFGCGTKVEIK Anti-DIG-ds-scFv QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYAMSW 66 IRQAPGKCLEWVSSINIGATYIYYADSVKGRFTISRDN AKNSLYLQMNSLRAEDTAVYYCARPGSPYEYDKAY YSMAYWGQGTTVTVSSGGGGSGGGGSGGGGSGGG GSDIQMTQSPSSLSASVGDRVTITCRASQDIKNYLNW YQQKPGKAPKLLIYYSSTLLSGVPSRFSGSGSGTDFTL TISSLQPEDFATYYCQQSITLPPTFGCGTKVEIK

TABLE-US-00009 TABLE9 9:Anti-DIG-Fabaminoacidsequences: Construct Aminoacidsequence SEQIDNO Anti-DIGCDRH1 seeTable8 57 Kabat Anti-DIGCDRH2 seeTable8 58 Kabat Anti-DIGCDRH3 seeTable8 59 Kabat Anti-DIGCDRL1 seeTable8 60 Kabat Anti-DIGCDRL2 seeTable8 61 Kabat Anti-DIGCDRL3 seeTable8 62 Kabat Anti-DIG-Fab- QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYAMSW 67 heavychain- IRQAPGKGLEWVSSINIGATYIYYADSVKGRFTISRDN CD28ATD- AKNSLYLQMNSLRAEDTAVYYCARPGSPYEYDKAY CD28CSD- YSMAYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSG CD3zSSDfusion GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK VDKKVEPKSCGGGGSFWVLVVVGGVLACYSLLVTV AFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQP YAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLS TATKDTYDALHMQALPPR Anti-DIG-Fab QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYAMSW 68 heavychain IRQAPGKGLEWVSSINIGATYIYYADSVKGRFTISRDN AKNSLYLQMNSLRAEDTAVYYCARPGSPYEYDKAY YSMAYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSG GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK VDKKVEPKSC Anti-DIG-Fab DIQMTQSPSSLSASVGDRVTITCRASQDIKNYLNWYQ 69 lightchain QKPGKAPKLLIYYSSTLLSGVPSRFSGSGSGTDFTLTI SSLQPEDFATYYCQQSITLPPTFGGGTKVEIKRTVAAP SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC Anti-DIGVH QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYAMSW 70 IRQAPGKGLEWVSSINIGATYIYYADSVKGRFTISRDN AKNSLYLQMNSLRAEDTAVYYCARPGSPYEYDKAY YSMAYWGQGTTVTVSS Anti-DIGVL DIQMTQSPSSLSASVGDRVTITCRASQDIKNYLNWYQ 71 QKPGKAPKLLIYYSSTLLSGVPSRFSGSGSGTDFTLTI SSLQPEDFATYYCQQSITLPPTFGGGTKVEIK

TABLE-US-00010 TABLE10 10:Anti-FITC-scFvaminoacidsequences Construct Aminoacidsequence SEQIDNO Anti-FITCCDRH1 HYWMN 72 Kabat Anti-FITCCDRH2 QFRNKPYNYETYYSDSVKG 73 Kabat Anti-FITCCDRH3 ASYGMEY 74 Kabat Anti-FITCCDRL1 RSSQSLVHSNGNTYLR 75 Kabat Anti-FITCCDRL2 KVSNRVS 76 Kabat Anti-FITCCDRL3 SQSTHVPWT 77 Kabat Anti-FITC-scFv- GVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWM 78 CD28ATD- NWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGR CD28CSD- FTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGM CD3zSSDfusion EYLGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSDV VMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLR WYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSGTD FTLKINRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK RGGGGSFWVLVVVGGVLACYSLLVTVAFIIFWVRSK RSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAY RSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYD VLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKM AEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYD ALHMQALPPR Anti-FITC-scFv GVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWM 79 NWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGR FTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGM EYLGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSDV VMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLR WYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSGTD FTLKINRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK Anti-FITCVH GVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWM 80 NWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGR FTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGM EYLGQGTSVTVSS Anti-FITCVL DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTY 81 LRWYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSG TDFTLKINRVEAEDLGVYFCSQSTHVPWTFGGGTKL EIK

TABLE-US-00011 TABLE11 11:Anti-HA-scFvaminoacidsequences Construct Aminoacidsequence SEQIDNO Anti-HACDRH1 NYDMA 82 Kabat Anti-HACDRH2 TISHDGRNTNYRDSVKG 83 Kabat Anti-HACDRH3 PGFAH 84 Kabat Anti-HACDRL1 RSSKTLLNTRGITSLY 85 Kabat Anti-HACDRL2 RMSNLAS 86 Kabat Anti-HACDRL3 AQFLEFPLT 87 Kabat Anti-HA-scFv- EVQLVESGGGLVQPGRSMKLSCAVSGFIFSNYDMA 88 CD28ATD- WVRQAPKKCLEWVATISHDGRNTNYRDSVKGRFTG CD28CSD- SRDSAQSTLYLQMDSLRSEDTAIYFCAGPGFAHWGQ CD3zSSDfusion GTLVTVSSGGGGSGGGGSGGGGSGGGGSDIVLTQAP LSVSVSPGESASISCRSSKTLLNTRGITSLYWYLQKPG KSPQLLIYRMSNLASGIPDRFSGSGSETHFTLQISKVE TEDVGIYYCAQFLEFPLTFGCGTKLEIKGGGGSFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYM NMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSA DAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKG ERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Anti-HA-scFv EVQLVESGGGLVQPGRSMKLSCAVSGFIFSNYDMA 89 WVRQAPKKCLEWVATISHDGRNTNYRDSVKGRFTG SRDSAQSTLYLQMDSLRSEDTAIYFCAGPGFAHWGQ GTLVTVSSGGGGSGGGGSGGGGSGGGGSDIVLTQAP LSVSVSPGESASISCRSSKTLLNTRGITSLYWYLQKPG KSPQLLIYRMSNLASGIPDRFSGSGSETHFTLQISKVE TEDVGIYYCAQFLEFPLTFGCGTKLEIK Anti-HAVH EVQLVESGGGLVQPGRSMKLSCAVSGFIFSNYDMA 90 WVRQAPKKCLEWVATISHDGRNTNYRDSVKGRFTG SRDSAQSTLYLQMDSLRSEDTAIYFCAGPGFAHWGQ GTLVTVSS Anti-HAVL DIVLTQAPLSVSVSPGESASISCRSSKTLLNTRGITSLY 91 WYLQKPGKSPQLLIYRMSNLASGIPDRFSGSGSETHF TLQISKVETEDVGIYYCAQFLEFPLTFGCGTKLEIK

TABLE-US-00012 TABLE12 12:Anti-myc-Fabaminoacidsequences Construct ProteinSequence SEQIDNO Anti-mycCDRH1 HYGMS 92 Kabat Anti-mycCDRH2 TIGSRGTYTHYPDSVKG 93 Kabat Anti-mycCDRH3 RSEFYYYGNTYYYSAMDY 94 Kabat Anti-mycCDRL1 RASESVDNYGFSFMN 95 Kabat Anti-mycCDRL2 AISNRGS 96 Kabat Anti-mycCDRL3 QQTKEVPWT 97 Kabat Anti-myc-Fab- EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSW 98 heavychain- VRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRD CD28ATD- NDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNT CD28CSD- YYYSAMDYWGQGASVTVSSAKTTPPSVYPLAPGSA CD3zSSDfusion AQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHT FPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPAS STKVDKKIVPRDCGGGGSFWVLVVVGGVLACYSLL VTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKH YQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQL YNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR Anti-myc-Fab EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSW 99 heavychain VRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRD NDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNT YYYSAMDYWGQGASVTVSSAKTTPPSVYPLAPGSA AQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHT FPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPAS STKVDKKIVPRDC Anti-myc-Fab DIVLTQSPASLAVSLGQRATISCRASESVDNYGFSFM 100 lightchain NWFQQKPGQPPKLLIYAISNRGSGVPARFSGSGSGTD FSLNIHPVEEDDPAMYFCQQTKEVPWTFGGGTKLEIK RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC Anti-mycVH EVHLVESGGDLVKPGGSLKLSCAASGFTFSHYGMSW 101 VRQTPDKRLEWVATIGSRGTYTHYPDSVKGRFTISRD NDKNALYLQMNSLKSEDTAMYYCARRSEFYYYGNT YYYSAMDYWGQGASVTVSS Anti-mycVL DIVLTQSPASLAVSLGQRATISCRASESVDNYGFSFM 102 NWFQQKPGQPPKLLIYAISNRGSGVPARFSGSGSGTD FSLNIHPVEEDDPAMYFCQQTKEVPWTFGGGTKLEIK

TABLE-US-00013 TABLE13 13:Polypeptidetagsequences Construct Aminoacidsequence SEQIDNO HAtag YPYDVPDYA 103 Myctag EQKLISEEDL 104 GCN4tag YHLENEVARLKK 105 AviTag GLNDIFEAQKIEWHE 106

TABLE-US-00014 TABLE14 14 SEQID Construct Aminoacidsequence NO HumanCD3z MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGI 107 LFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELN LGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYN ELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA TKDTYDALHMQALPPR HumanCD3z ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTG 108 CAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTT GGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGAT GGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCT TGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGAG CCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTAT AACGAGCTCAATCTAGGACGAAGAGAGGAGTACGA TGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGAT GGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAA GGCCTGTACAATGAACTGCAGAAAGATAAGATGGC GGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGC GCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAG GGTCTCAGTACAGCCACCAAGGACACCTACGACGCC CTTCACATGCAGGCCCTGCCCCCTCGCTAA MurineCD3z MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDG 109 ILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELN LGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYN ALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTA TKDTYDALHMQTLAPR MurineCD3z ATGAAGTGGAAAGTGTCTGTTCTCGCCTGCATCCTC 110 CACGTGCGGTTCCCAGGAGCAGAGGCACAGAGCTTT GGTCTGCTGGATCCCAAACTCTGCTACTTGCTAGAT GGAATCCTCTTCATCTACGGAGTCATCATCACAGCC CTGTACCTGAGAGCAAAATTCAGCAGGAGTGCAGA GACTGCTGCCAACCTGCAGGACCCCAACCAGCTCTA CAATGAGCTCAATCTAGGGCGAAGAGAGGAATATG ACGTCTTGGAGAAGAAGCGGGCTCGGGATCCAGAG ATGGGAGGCAAACAGCAGAGGAGGAGGAACCCCCA GGAAGGCGTATACAATGCACTGCAGAAAGACAAGA TGGCAGAAGCCTACAGTGAGATCGGCACAAAAGGC GAGAGGCGGAGAGGCAAGGGGCACGATGGCCTTTA CCAGGGTCTCAGCACTGCCACCAAGGACACCTATGA TGCCCTGCATATGCAGACCCTGGCCCCTCGCTAA HumanCD28 ATGCTGCGCCTGCTGCTGGCGCTGAACCTGTTTCCG 111 AGCATTCAGGTGACCGGCAACAAAATTCTGGTGAA ACAGAGCCCGATGCTGGTGGCGTATGATAACGCGGT GAACCTGAGCTGCAAATATAGCTATAACCTGTTTAG CCGCGAATTTCGCGCGAGCCTGCATAAAGGCCTGGA TAGCGCGGTGGAAGTGTGCGTGGTGTATGGCAACTA TAGCCAGCAGCTGCAGGTGTATAGCAAAACCGGCTT TAACTGCGATGGCAAACTGGGCAACGAAAGCGTGA CCTTTTATCTGCAGAACCTGTATGTGAACCAGACCG ATATTTATTTTTGCAAAATTGAAGTGATGTATCCGCC GCCGTATCTGGATAACGAAAAAAGCAACGGCACCA TTATTCATGTGAAAGGCAAACATCTGTGCCCGAGCC CGCTGTTTCCGGGCCCGAGCAAACCGTTTTGGGTGC TGGTGGTGGTGGGCGGCGTGCTGGCGTGCTATAGCC TGCTGGTGACCGTGGCGTTTATTATTTTTTGGGTGCG CAGCAAACGCAGCCGCCTGCTGCATAGCGATTATAT GAACATGACCCCGCGCCGCCCGGGCCCGACCCGCA AACATTATCAGCCGTATGCGCCGCCGCGCGATTTTG CGGCGTATCGCAGC HumanCD28 MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVN 112 LSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQ QLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYF CKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPS KPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLL HSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS MurineCD28 ATGACCCTGCGCCTGCTGTTTCTGGCGCTGAACTTTT 113 TTAGCGTGCAGGTGACCGAAAACAAAATTCTGGTGA AACAGAGCCCGCTGCTGGTGGTGGATAGCAACGAA GTGAGCCTGAGCTGCCGCTATAGCTATAACCTGCTG GCGAAAGAATTTCGCGCGAGCCTGTATAAAGGCGT GAACAGCGATGTGGAAGTGTGCGTGGGCAACGGCA ACTTTACCTATCAGCCGCAGTTTCGCAGCAACGCGG AATTTAACTGCGATGGCGATTTTGATAACGAAACCG TGACCTTTCGCCTGTGGAACCTGCATGTGAACCATA CCGATATTTATTTTTGCAAAATTGAATTTATGTATCC GCCGCCGTATCTGGATAACGAACGCAGCAACGGCA CCATTATTCATATTAAAGAAAAACATCTGTGCCATA CCCAGAGCAGCCCGAAACTGTTTTGGGCGCTGGTGG TGGTGGCGGGCGTGCTGTTTTGCTATGGCCTGCTGG TGACCGTGGCGCTGTGCGTGATTTGGACCAACAGCC GCCGCAACCGCCTGCTGCAGAGCGATTATATGAACA TGACCCCGCGCCGCCCGGGCCTGACCCGCAAACCGT ATCAGCCGTATGCGCCGGCGCGCGATTTTGCGGCGT ATCGCCCG MurineCD28 MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVS 114 LSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTY QPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYF CKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLF WALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQS DYMNMTPRRPGLTRKPYQPYAPARDFAAYRP CD28YMNM YMNM 115 CD28PYAP PYAP 116 Signalpeptide ATMGWSCIILFLVATATGVHS 117 SignalpeptideDNA ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCA 118 sequence ACAGCTACCGGTGTGCACTCC Anti-CD20(GA101) QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINW 119 PGLALAheavychain VRQAPGQGLEWMGRIFPGDGDTDYNGKFKGRVTITA DKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVY WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS CDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALG APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK Anti-CD20(GA101) DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLY 120 lightchain WYLQKPGQSPQLLIYQMSNLVSGVPDRFSGSGSGTDF TLKISRVEAEDVGVYYCAQNLELPYTFGGGTKVEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKA DYEKHKVYACEVTHQGLSSPVTKSFNRGEC Anti-CEA QVQLVQSGAEVKKPGASVKVSCKASGYTFTEFGMNW 121 (CH1A1A98/992F1) VRQAPGQGLEWMGWINTKTGEATYVEEFKGRVTFTT PGLALAheavychain DTSTSTAYMELRSLRSDDTAVYYCARWDFAYYVEAM DYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL GAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSC AVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK Anti-CEA DIQMTQSPSSLSASVGDRVTITCKASAAVGTYVAWYQ 122 (CH1A1A98/992F1) QKPGKAPKLLIYSASYRKRGVPSRFSGSGSGTDFTLTIS lightchain SLQPEDFATYYCHQYYTYPLFTFGQGTKLEIKRTVAAP SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC HumanIgG1Fc ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT 123 VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Anti-WT1(33F05) QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIR 124 PGLALAheavychain QPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKN QFSLKLSSVTAADTAVYYCARSYYEAFDYWGQGTLV TVSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH TCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTI SKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Anti-WT1(33F05) SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQ 125 lightchain KPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITG AQAEDEADYYCNSPDMNGNAVFGGGTKLTVLRTVAA PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC Anti-WT1(11D06) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWV 126 PGLALAheavychain RQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKS TSTAYMELSSLRSEDTAVYYCARSIELWWGGFDYWG QGTTVTVSSSLGTQTYICNVNHKPSNTKVDKKVEPKS CDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALG APIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCA VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL VSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK Anti-WT1(11D06) DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQ 127 lightchain KPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTIGSL QPDDFATYYCQQYEDYTTFGQGTKVEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC Anti-WT1(33H09) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWV 128 PGLALAheavychain RQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKS TSTAYMELSSLRSEDTAVYYCARGSYDLFSLDYWGQG TTVTVSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPI EKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK Anti-WT1(33H09) DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQ 129 lightchain KPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSL QPDDFATYYCQQYYDGITFGQGTKVEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC Anti-WT1(5E11) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWV 130 PGLALAheavychain RQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKS TSTAYMELSSLRSEDTAVYYCARSSYDLYSFDYWGQG TTVTVSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPI EKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK Anti-WT1(5E11) DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQ 131 lightchain KPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSL QPDDFATYYCQQYSFPPMITFGQGTKVEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC HumanIgG1Fc ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW 132 NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK