METHOD OF GENERATING INTERACTING PEPTIDES
20210017226 ยท 2021-01-21
Inventors
Cpc classification
G01N33/6845
PHYSICS
International classification
Abstract
Disclosed herein is a method of designing small peptides for interacting with, binding to, or modulating the activity of, known protein or peptides. Further disclosed herein are methods for selecting sequences likely to have high binding activity against known protein sequences as well as peptides derived from the disclosed methods.
Claims
1. A composition comprising a binding polypeptide configured to interact with a known binding partner wherein said binding polypeptide has a sequence of between 6 and 30 amino acids in length; and wherein said binding polypeptide sequence is composed by the steps of identifying the sequence of said binding partner; and, identifying 20% or more of the residues in said binding partner sequence; and, for each of the identified residues within the binding partner sequence, selecting the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence as follows: where the identified residue within the binding partner sequence is Phe, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Lys or Glu; where the identified residue within the binding partner sequence is Leu, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Gln, Lys, or Glu; where the identified residue within the binding partner sequence is Ser, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Arg, Gly, Thr, or Ala; where the identified residue within the binding partner sequence is Thr, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Tyr, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Cys, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Thr or Ala; where the identified residue within the binding partner sequence is Trp, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Pro; where the identified residue within the binding partner sequence is Ile, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Asn, Asp, or Tyr; where the identified residue within the binding partner sequence is Met, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is His; where the identified residue within the binding partner sequence is Asn, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Lys, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Phe or Leu; where the identified residue within the binding partner sequence is Arg, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Thr, Ala, Ser, or Pro; where the identified residue within the binding partner sequence is Pro, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Arg, Gly, or Trp; where the identified residue within the binding partner sequence is His, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Met or Val; where the identified residue within the binding partner sequence is Gln, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Leu; where the identified residue within the binding partner sequence is Val, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Asn, Asp, Tyr, or His; where the identified residue within the binding partner sequence is Ala, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Asp, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Glu, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Phe or Leu; where the identified residue within the binding partner sequence is Gly, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Thr, Ala, Ser, or Pro; and wherein said binding polypeptide may comprise part of a larger polypeptide.
2. A method of making a polypeptide configured to interact with a known binding partner wherein said binding polypeptide has a sequence of between 6 and 20 amino acids in length; and wherein said binding polypeptide sequence is assembled by the steps of: identifying the sequence of said binding partner; and, identifying 20% or more of the residues in said binding partner sequence; and, for each of the identified residues within the binding partner sequence, selecting the corresponding residue for inclusion in the sequence of said binding polypeptide sequence as follows: where the identified residue within the binding partner sequence is Phe, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Lys or Glu; where the identified residue within the binding partner sequence is Leu, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Gln, Lys, or Glu; where the identified residue within the binding partner sequence is Ser, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Arg, Gly, Thr, or Ala; where the identified residue within the binding partner sequence is Thr, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Tyr, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Cys, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Thr or Ala; where the identified residue within the binding partner sequence is Trp, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Pro; where the identified residue within the binding partner sequence is Ile, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Asn, Asp, or Tyr; where the identified residue within the binding partner sequence is Met, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is His; where the identified residue within the binding partner sequence is Asn, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Lys, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Phe or Leu; where the identified residue within the binding partner sequence is Arg, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Thr, Ala, Ser, or Pro; where the identified residue within the binding partner sequence is Pro, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Arg, Gly, or Trp; where the identified residue within the binding partner sequence is His, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Met or Val; where the identified residue within the binding partner sequence is Gln, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Leu; where the identified residue within the binding partner sequence is Val, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Asn, Asp, Tyr, or His; where the identified residue within the binding partner sequence is Ala, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Asp, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Glu, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Phe or Leu; where the identified residue within the binding partner sequence is Gly, the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence is Thr, Ala, Ser, or Pro; and wherein said binding polypeptide may comprise part of a larger polypeptide.
3. (canceled)
4. (canceled)
5. (canceled)
6. (canceled)
7. (canceled)
8. The composition of claim 1, wherein the selected corresponding residues for inclusion in the binding polypeptide sequence occur at one of every two positions in the binding polypeptide sequence.
9. The composition of claim 1, wherein the selected corresponding residues for inclusion in the binding polypeptide sequence occur at every other position in the binding polypeptide sequence.
10. The composition of claim 1, wherein the selected corresponding residues for inclusion in the binding polypeptide sequence occur at one of every three positions in the binding polypeptide sequence.
11. The composition of claim 1, wherein the selected corresponding residues for inclusion in the binding polypeptide sequence occur at every third position in the binding polypeptide sequence.
12. The composition of claim 1, wherein the selected corresponding residues for inclusion in the binding polypeptide sequence occur at two of every three positions in the binding polypeptide sequence.
13. A polypeptide made according to the method of claim 2.
14. The polypeptide of claim 1, further comprising a functional moiety.
15. The polypeptide of claim 14 wherein said functional moiety comprises one or more of a polypeptide, a therapeutic molecule, a protein, a nucleic acid, or a diagnostic moiety.
16. The polypeptide of claim 14 wherein said functional moiety comprises one or more of a radiolabel, spin label, affinity tag, or fluorescent label.
17. The polypeptide of claim 14 further comprising a linker.
18. (canceled)
19. The polypeptide of claim 18 wherein said peptide has the sequence GSGS (SEQ ID NO: 1), (G).sub.n (SEQ ID NO: 2), (GS).sub.n (SEQ ID NO: 3), (GGSGG).sub.n (SEQ ID NO: 4), (GGGS).sub.n (SEQ ID NO: 5), CYPEN (SEQ ID NO: 6), or KTGEVNN (SEQ ID NO: 7).
20. A binding polypeptide according to claim 1, wherein said binding polypeptide contains residues configured to interact with a second and optionally a third target protein in addition to the first target protein.
21. A binding polypeptide generated according to claim 2, wherein said binding polypeptide contains residues configured to interact with a second and optionally a third target protein in addition to the first target protein.
22. A fusion polypeptide, wherein said fusion comprises one or more binding polypeptides made according to the method of claim 2.
23. (canceled)
24. The composition of claim 1, wherein said binding polypeptide is incorporated within a fusion polypeptide, and wherein said fusion comprises may further comprise one or more additional binding polypeptides.
25. (canceled)
26. A binding polypeptide according to claim 1, wherein the sequence of said polypeptide comprises one or more of sequence LEQIKRLF (SEQ ID NO: 8), LLQVDVILL (SEQ ID NO: 9), LLQVDVILLCYPENLEQIKIRLF (SEQ ID NO: 10), LLQVDVILLCYPENLEQIKIRLFGSGSHHHHHH (SEQ ID NO: 11), EDRLQSYDLD (SEQ ID NO: 12), EDRLQSYDLDGSGSHHHHHH (SEQ ID NO: 13), ELDKAGFIKRQL (SEQ ID NO: 14), LEERGVKDRQLQ (SEQ ID NO: 15), LEILRAKDLALE (SEQ ID NO: 16), LEQIKIRLF (SEQ ID NO: 17), LSGLNEQRTQ (SEQ ID NO: 18), YDVDAIVPQC (SEQ ID NO: 19), CLTYDSHYLQ (SEQ ID NO: 20), LVAHVTSRKC (SEQ ID NO: 21), EYRLYLRALC (SEQ ID NO: 22), IEIVRKKPIF (SEQ ID NO: 23), IEIVRKKPIFC (SEQ ID NO: 24), CEDRLQSYDLD (SEQ ID NO: 25), EKLYLYYLQ (SEQ ID NO: 26), EKLYLYYLQC (SEQ ID NO: 27), LEQIKIRLFGSGSHHHHHH (SEQ ID NO: 28), LSRAYLSYEGSGSHHHHHH (SEQ ID NO: 29), EYRLYLRALCYPENLSRAYLSYEGSGSHHHHHH (SEQ ID NO: 30), DLDYAQLRDKCYPENEDRLQSYDLDGSGSHHHHHH (SEQ ID NO: 31), GKPIPNPLLGLDST (SEQ ID NO: 32), ELDKAGFIKRQLC (SEQ ID NO: 33), LLQVDVILLHHHHHHLEQIKIRLF (SEQ ID NO: 34), and/or CFFDSLVKQ (SEQ ID NO: 35).
27. A binding polypeptide according to claim 1, or a nucleic acid encoding said binding peptide, wherein the sequence of said polypeptide comprises one or more of the sequences provided in Table 6 or 7.
28. (canceled)
29. A method of making a binding polypeptide configured to interact with a known binding partner wherein said binding polypeptide has a sequence of between 6 and 30 amino acids in length; and wherein said binding polypeptide sequence is composed by the steps of identifying the sequence of said binding partner; and, identifying 20% or more of the residues in said binding partner sequence; and, for each of the identified residues within the binding partner sequence, selecting the residue at the corresponding position for inclusion in the sequence of said polypeptide sequence according to the corresponding residues given in Table 10.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
DETAILED DESCRIPTION
[0038] In one aspect, the present disclosure relates to methods for producing peptides, and especially peptides that can engage in interactions with other peptide sequences. In some embodiments, the present disclosure relates to the making of peptide-peptide or peptide-protein complexes, wherein a peptide is designed to interact with a known protein or a protein of known structure or sequence. In some aspects, the present disclosure relates to small peptides that are capable of interacting with other peptides or with proteins, said peptides being designed according to the methods and compositions described herein.
[0039] In some embodiments according to the methods and compositions disclosed herein, peptides can be designed to interact with one or more peptides or proteins of known structure or sequence by identifying the sequence of the target protein and, identifying the sequence of the binding peptide according to the following:
[0040] where the identified residue within the binding partner sequence is Phe, the residue at the corresponding position for inclusion in the binding peptide sequence is Lys or Glu; where the identified residue within the binding partner sequence is Leu, the residue at the corresponding position for inclusion in the binding peptide sequence is Gln, Lys, or Glu; where the identified residue within the binding partner sequence is Ser, the residue at the corresponding position for inclusion in the binding peptide sequence is Arg, Gly, Thr, or Ala; where the identified residue within the binding partner sequence is Thr, the residue at the corresponding position for inclusion in the binding peptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Tyr, the residue at the corresponding position for inclusion in the binding peptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Cys, the residue at the corresponding position for inclusion in the binding peptide sequence is Thr or Ala; where the identified residue within the binding partner sequence is Trp, the residue at the corresponding position for inclusion in the binding peptide sequence is Pro; where the identified residue within the binding partner sequence is Ile, the residue at the corresponding position for inclusion in the binding peptide sequence is Asn, Asp, or Tyr; where the identified residue within the binding partner sequence is Met, the residue at the corresponding position for inclusion in the binding peptide sequence is His; where the identified residue within the binding partner sequence is Asn, the residue at the corresponding position for inclusion in the binding peptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Lys, the residue at the corresponding position for inclusion in the binding peptide sequence is Phe or Leu; where the identified residue within the binding partner sequence is Arg, the residue at the corresponding position for inclusion in the binding peptide sequence is Thr, Ala, Ser, or Pro; where the identified residue within the binding partner sequence is Pro, the residue at the corresponding position for inclusion in the binding peptide sequence is Arg, Gly, or Trp; where the identified residue within the binding partner sequence is His, the residue at the corresponding position for inclusion in the binding peptide sequence is Met or Val; where the identified residue within the binding partner sequence is Gln, the residue at the corresponding position for inclusion in the binding peptide sequence is Leu; where the identified residue within the binding partner sequence is Val, the residue at the corresponding position for inclusion in the binding peptide sequence is Asn, Asp, Tyr, or His; where the identified residue within the binding partner sequence is Ala, the residue at the corresponding position for inclusion in the binding peptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Asp, the residue at the corresponding position for inclusion in the binding peptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Glu, the residue at the corresponding position for inclusion in the binding peptide sequence is Phe or Leu; and where the identified residue within the binding partner sequence is Gly, the residue at the corresponding position for inclusion in the binding peptide sequence is Thr, Ala, Ser, or Pro. In some embodiments, not all of the residues of the binding peptide will be determined according to the relationships disclosed herein. In some embodiments, for example, every other residue, every third residue, or two of every three residues will be determined according to the disclosed relationships.
[0041] Subject as used herein, has its customary and ordinary meaning as understood by one of skill in the art in view of this disclosure. It refers to a human or a non-human animal, for example selected or identified for a diagnosis, treatment, inhibition, amelioration of a disease, disorder, condition, or symptom. Subject suspected of having has its customary and ordinary meaning as understood by one of skill in the art in view of this disclosure. It refers to a subject exhibiting one or more indicators of a disease or condition. In certain embodiments, the disease or condition may comprise one or more of a disease, disorder, condition, or symptom.
[0042] Administering has its customary and ordinary meaning as understood by one of skill in the art in view of this disclosure. It refers to providing a substance, for example a pharmaceutical agent, dietary supplement, or composition, to a subject, and includes, but is not limited to, administering by a medical professional and self-administration. Administration of the compounds disclosed herein or the pharmaceutically acceptable salts thereof can be via any of the accepted modes of administration for agents that serve similar utilities such as are consistent with the formulation of said compounds. Oral administrations are customary in administering the compositions that are the subject of the preferred embodiments. In some embodiments, administration of the compounds may occur outside the body, for example, by apheresis or dialysis.
[0043] In some embodiments, the methods of the present disclosure contemplate the administration of one or more compositions useful for the amelioration or treatment of one or more disorders, diseases, conditions, or symptoms.
[0044] Standard pharmaceutical and/or dietary supplement formulation techniques are used, such as those disclosed in Remington's The Science and Practice of Pharmacy, 21st Ed., Lippincott Williams & Wilkins (2005), incorporated herein by reference in its entirety. Accordingly, some embodiments include pharmaceutical and/or dietary supplement compositions comprising, consisting of, or consisting essentially of: (a) a safe and therapeutically effective amount of one or more compounds described herein, or pharmaceutically acceptable salts thereof; and (b) a pharmaceutically acceptable carrier, diluent, excipient or combination thereof.
[0045] The term pharmaceutically acceptable carrier or pharmaceutically acceptable excipient has its customary and ordinary meaning as understood by one of skill in the art in view of this disclosure. It includes any and all appropriate solvents, diluents, emulsifiers, binders, buffers, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like, or any other such compound as is known by those of skill in the art to be useful in preparing pharmaceutical formulations of the compounds disclosed herein. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions. In addition, various adjuvants such as are commonly used in the art may be included. These and other such compounds are described in the literature, e.g., in the Merck Index, Merck & Company, Rahway, N.J. Considerations for the inclusion of various components in pharmaceutical compositions are described, e.g., in Gilman et al. (Eds.) (1990); Goodman and Gilman's: The Pharmacological Basis of Therapeutics, 8th Ed., Pergamon Press.
[0046] The choice of a pharmaceutically-acceptable carrier to be used in conjunction with the one or more compounds for administration as described herein can be determined by the way the compound is to be administered.
[0047] In some embodiments, the methods of the present disclosure contemplate topical or localized administration. In some embodiments, the methods of the present disclosure contemplate systemically or parenterally, such as subcutaneously, intraperitoneally, intravenously, intraarterially, orally, enterically, subdermally, transdermally, sublingually, transbuccally, rectally, or vaginally.
[0048] The present disclosure describes binding peptides that interact with proteins or peptides of known structure or sequence. In certain embodiments according to the methods and compositions disclosed herein, said binding peptides may comprise, consist of, or consist essentially of, one or more sequences determined by the steps of: identifying the sequence of the target protein or peptide; and for each residue of the target protein or polypeptide, placing a corresponding residue in the sequence of the binding peptide according to the following relationships: where the identified residue within the binding partner sequence is Phe, the residue at the corresponding position for inclusion in the binding peptide sequence is Lys or Glu; where the identified residue within the binding partner sequence is Leu, the residue at the corresponding position for inclusion in the binding peptide sequence is Gln, Lys, or Glu; where the identified residue within the binding partner sequence is Ser, the residue at the corresponding position for inclusion in the binding peptide sequence is Arg, Gly, Thr, or Ala; where the identified residue within the binding partner sequence is Thr, the residue at the corresponding position for inclusion in the binding peptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Tyr, the residue at the corresponding position for inclusion in the binding peptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Cys, the residue at the corresponding position for inclusion in the binding peptide sequence is Thr or Ala; where the identified residue within the binding partner sequence is Trp, the residue at the corresponding position for inclusion in the binding peptide sequence is Pro; where the identified residue within the binding partner sequence is Ile, the residue at the corresponding position for inclusion in the binding peptide sequence is Asn, Asp, or Tyr; where the identified residue within the binding partner sequence is Met, the residue at the corresponding position for inclusion in the binding peptide sequence is His; where the identified residue within the binding partner sequence is Asn, the residue at the corresponding position for inclusion in the binding peptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Lys, the residue at the corresponding position for inclusion in the binding peptide sequence is Phe or Leu; where the identified residue within the binding partner sequence is Arg, the residue at the corresponding position for inclusion in the binding peptide sequence is Thr, Ala, Ser, or Pro; where the identified residue within the binding partner sequence is Pro, the residue at the corresponding position for inclusion in the binding peptide sequence is Arg, Gly, or Trp; where the identified residue within the binding partner sequence is His, the residue at the corresponding position for inclusion in the binding peptide sequence is Met or Val; where the identified residue within the binding partner sequence is Gln, the residue at the corresponding position for inclusion in the binding peptide sequence is Leu; where the identified residue within the binding partner sequence is Val, the residue at the corresponding position for inclusion in the binding peptide sequence is Asn, Asp, Tyr, or His; where the identified residue within the binding partner sequence is Ala, the residue at the corresponding position for inclusion in the binding peptide sequence is Ser, Gly, Cys, or Arg; where the identified residue within the binding partner sequence is Asp, the residue at the corresponding position for inclusion in the binding peptide sequence is Ile or Val; where the identified residue within the binding partner sequence is Glu, the residue at the corresponding position for inclusion in the binding peptide sequence is Phe or Leu; and where the identified residue within the binding partner sequence is Gly, the residue at the corresponding position for inclusion in the binding peptide sequence is Thr, Ala, Ser, or Pro.
[0049] In certain embodiments according to the methods and compositions disclosed herein, said binding peptide sequence may be designed to be parallel to the direction of the target sequence (i.e., with the identified residues in the binding peptide sequence placed from N terminal to C-terminal, corresponding to the residues of the target peptide in their N-terminal to C-terminal orientation) or may be designed to be antiparallel to the direction of the target sequence (i.e., with the identified residues in the binding peptide sequence placed from N terminal to C-terminal, corresponding to the residues of the target peptide in their C-terminal to N-terminal orientation). In some embodiments, a portion, but not all, of the residues of the binding peptide will be determined according to the disclosed relationships. In some embodiments, for example, every other residue, every third residue, one of every three residues, two of every three residues, or one, two, or three out of every four residues will be determined according to the disclosed relationships. In some embodiments, the residues to be determined according to the disclosed relationships will follow a pattern such as [OOXOOOXOO].sub.n, [OOOXOXOOO].sub.n, and [OOOOOXOOOO].sub.n (Where O represents a residue determined according to the disclosed relationships, X represents any residue, and n represents any integer). In some embodiments, the residues to be determined according to the disclosed relationships will follow a pattern such as [OOOOOOOOO].sub.n, [OOOOOOOOO].sub.n, and [OOOOOOOOOO].sub.n (Where O represents a residue determined according to the disclosed relationships with respect to a first target protein or peptide, and O a residue determined according to the disclosed relationships with respect to a second target protein or peptide, and n represents any integer).
[0050] In some embodiments, without respect to their specific placement within the sequence of the binding peptide, all of the residues of the binding peptide will be selected according to the relationships given herein. In some embodiments, without respect to their specific placement within the sequence of the binding peptide, less than all of the residues of the binding peptide will be selected according to the relationships given herein. In some embodiments, without respect to their specific placement within the sequence of the binding peptide, the percentage of residues within the binding peptide sequence that are selected according to the relationships given herein is 10-30%. In some embodiments, without respect to their specific placement within the sequence of the binding peptide, the percentage of residues within the binding peptide sequence that are selected according to the relationships given herein is between 20-40%, 30-50%, 40-60%, 50-70%, 60-80%, 70-90%, 20-90%, 30-90%, or 30-80%. In some embodiments, without respect to their specific placement within the sequence of the binding peptide, the percentage of residues within the binding peptide sequence that are selected according to the relationships given herein is greater than 90%. In some embodiments, without respect to their specific placement within the sequence of the binding peptide, the percentage of residues within the binding peptide sequence that are selected according to the relationships given herein is, or is at least, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%, or a range selected from any two of the preceding values.
[0051] In some embodiments according to the methods and compositions described herein, a library of binding peptides may be developed according to the relationships and criteria described herein. Said libraries may be screened, such as by surface plasmon resonance spectroscopy, nuclear magnetic resonance spectroscopy, fluorescence resonance energy transfer, fluorescence quenching, Raman spectroscopy, ELISA, western blotting, or dot blot or other methods as are known to those of skill in the art, for binding to the selected target sequence or protein. Sequences identified as having desirable binding properties or other desirable properties may optionally be subjected to another round of design, such as by placing alternate residues still in compliance with the relationships described herein for the design of binding peptides, or by altering the location or register of one or more of the residues selected according to the criteria described herein. Additional rounds of screening and optimization may follow.
[0052] In some embodiments, the method is structured according to the steps shown in
[0053] The next box illustrates an additional step according to some embodiments of the present method, wherein the length and probable secondary structure of the target sequence can be determined. This may be done according to such criteria as are suitable for the target protein, such as by observing the boundaries of secondary structure elements (e.g. Beta strands, alpha helices, loops, knots, pseudoknots, beta hairpins, 3.sub.10 helices, and the like) within the three dimensional structure of the target protein or peptide, or by predicting the secondary structures within the target protein using sequence alignments or sequence analysis tools such as are known in the art. Target sequences may be of any length appropriate for the interaction of the binding peptide with the target protein, and as noted herein, exemplary target sequences may be between 2 and 100 amino acids, 2 and 50 amino acids, between 2 and 25 amino acids, between 5 and 20 amino acids, or between 5 and 15 amino acids in length.
[0054] The third box depicts a step according to some embodiments of the present method, wherein a binding peptide is designed according to the relationships and design criteria described herein. For example, where the target sequence is primarily alpha helical, CAAP residues corresponding to the residues of the target sequence according to the relationships disclosed herein may be placed at one or two of every three positions within the designed sequence, or when the target sequence comprises significant beta strand character, CAAP residues corresponding to the residues of the target sequence according to the relationships disclosed herein may be placed at every other position within the designed sequence. Likewise, one of skill in the art may determine proper placement of CAAP residues in order to interact with other secondary structure elements, including but not limited to loops, knots, pseudoknots, beta-hairpins, and 3.sub.10 helices. In some embodiments, the size of the binding peptide may be commensurate with the size of the target sequence, and exemplary binding peptide sequences may be between 2 and 100 amino acids, 2 and 50 amino acids, between 2 and 25 amino acids, between 5 and 20 amino acids, or between 5 and 15 amino acids in length. The contemplated size of the binding peptide, or the binding portion of a protein, is, is about, is at least, or is not more than, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids long, or a range defined by any two of the preceding values.
[0055] Optionally, multiple binding sequences may be designed, for example incorporating alternate CAAP residues as disclosed herein and shown in Table 1 or having a different number or placement of the CAAP residues. Exemplary libraries may comprise more than one peptide sequences, between 1 and 5 peptide sequences, between 2 and 10 peptide sequences, 12 or fewer peptide sequences, 24 or fewer peptide sequences, 48 or fewer peptide sequences, 96 or fewer peptide sequences, 192 or fewer peptide sequences, 384 or fewer peptide sequences, 1536 or fewer peptide sequences, or greater than 1536 peptide sequences, or a range between any of the preceding values. Such a library has considerable advantages over conventional library screening methods. For example, while a fully random library of 10-mer peptides would comprise 10.sup.13 peptides, an amount which could not reasonably be screened with specificity, by applying the methods described herein, library size and complexity can be reduced by 10.sup.9-10.sup.10-fold, reducing the size of the library to one in which each peptide can reasonably be individually screened.
[0056] The next box depicts a step according to some embodiments of the present method, wherein a library of designed binding sequences is synthesized or produced, for example by heterologous gene expression. In some embodiments, DNA sequences corresponding to the sequences of the designed binding peptides can be obtained and transformed into appropriate organisms for expression using such methods as are known in the art (see, for example, Green, M. R. and Sambrook, J., Molecular Cloning: A Laboratory Manual, 4.sup.th ed. Volume 3, Cold Spring Harbor Laboratory Press (2012); and Greenfield, E. A., ed., which is hereby incorporated by reference for purposes of its description of genetic modification of organisms and heterologuous protein production). Purification of expressed peptides may be carried out by such methods as are known in the art and may optionally include high performance liquid chromatography, precipitation, and/or affinity purification such as, for example, metal affinity purification, glutathione-S-transferase affinity purification, protein A affinity purification, or Ig-Fc affinity purification. Binding peptides may be synthesized using for example solid phase or liquid phase methods, for example, those described in Jensen, K. J. et al., eds. Peptide Synthesis and Applications, 2.sup.nd ed., Humana Press (2013), which is hereby incorporated by reference with respect to its disclosure of methods for the synthesis, purification, and characterization of peptides.
[0057] The next box in the figure depicts a step according to some embodiments of the present method, wherein and as noted herein, binding peptide libraries are screened for binding to the target protein using such methods as or known in the art and/or are described herein.
[0058] The final box depicts a step wherein optionally, sequences screened may be revised, for example by designing new peptides retaining residues shown to be important to binding, and by varying the position and or composition of the remaining CAAP residues utilizing the relationships disclosed herein and in Table 4. A redesigned library may then be produced or synthesized, and screened, as described, in order to identify peptides with optimal binding activity.
[0059] In some embodiments, the binding peptide may comprise one part of a larger fusion peptide. Such a fusion polypeptide may comprise, for example, one or more binding peptides and optionally, an effector peptide. In some embodiments, an effector peptide may comprise a therapeutic or diagnostic peptide, an affinity tag, an antibody, a signaling protein, an enzyme, an inhibitor, or any such peptide moiety as may be desired to be bound to the target protein via the binding peptide. In some embodiments, a fusion peptide comprises a linker as described herein or as known to one of skill in the art. In some embodiments, the binding peptide may comprise the full length of a given fusion polypeptide sequence. In some embodiments, the binding peptide may comprise less than the full length of a given fusion polypeptide sequence. In some embodiments, the binding peptide may comprise between 10% and 100% of the length of a given fusion polypeptide sequence. In some embodiments the binding peptide may comprise between 20% and 90% of the length of a given fusion polypeptide sequence. In some embodiments, the binding peptide may comprise less than 90%, less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, or less than 5% of the length of a given fusion polypeptide sequence. In some embodiments, a fusion polypeptide may comprise one, two, three, four, or more than four binding peptides. In some embodiments, a fusion polypeptide may be from 10 to 600 amino acids in length. In some embodiments, a fusion polypeptide may be from 10 to 500 amino acids in length. In some embodiments, a fusion polypeptide may be from 20 to 400 amino acids, from 30 to 300 amino acids, from 40 to 200 amino acids, from 50 to 100 amino acids, from 10 to 100 amino acids, from 20 to 100 amino acids, from 10 to 200 amino acids, or from 20 to 200 amino acids in length, or a range defined by any two of the preceding values (e.g. 20 to 600 amino acids).
[0060] In some embodiments, the binding peptide may be linked to, or may comprise, an affinity tag or an enzyme. Exemplary tags or enzymes include but are not limited to metal affinity tags such as His.sub.6, glutathione-S-transferase, protein A, lectins, immunoglobulin constant regions, fluorescent proteins such as the Green Fluorescent Protein and the like, and/or horseradish peroxidase.
[0061] In some embodiments, a sequence may be designed to bind to multiple targets. For example, a sequence may have 50% of its residues selected according to the relationships described herein with respect to the sequence of one target sequence, and 50% of its residues selected according to the relationships described herein with respect to the sequence of a second binding target. The second binding target may be a second target protein or may be a second sequence within a single target protein. The division of residues may be more or less than 50%-50%, for example, from 70-90% to from 10-30%, from 60-80% to from 20-40%, from 50-70% to from 30-50%, from 40-60% to from 40-60%, from 30-50% to from 50-70%, from 20-40% to from 60-80%, or from 10-30% to from 70-90%. Likewise, in some embodiments a sequence may be designed to bind to three or more sequences by allocating a percentage of the residues in the binding peptide sequence to interact according to the relationships described herein with the sequences of three or more target sequences.
[0062] In certain embodiments, said binding peptides may exist in single copies. In certain other embodiments, said binding peptides may be fused to other binding peptides. In some embodiments, said binding peptides may be present as dimers, trimers, tetramer, pentamers, hexamers, or the like. In some embodiments, said binding peptides may be fused to identical binding peptides. In some embodiments, two or more different binding peptides may be fused together. In some embodiments said binding peptides may be fused in the same orientation (i.e., C terminus to N terminus). In some embodiments, said peptides may be fused in the opposite orientation (i.e., N terminus to N terminus, or C terminus to C terminus). In some embodiments, said binding peptides may be linked together by a peptide linker. In some embodiments, said peptide linker may comprise, consist of, or consist essentially of, one or more sequences such as (G).sub.n (SEQ ID NO: 2), (GS).sub.n (SEQ ID NO: 3), (GGSGG).sub.n (SEQ ID NO: 4), (GGGS).sub.n (SEQ ID NO: 5), CYPEN (SEQ ID NO: 6), or KTGEVNN (SEQ ID NO: 7) or the like. In some embodiments, said binding peptides may be linked together by a nonpeptide linker. Exemplary nonpeptide linkers include but are not limited to polyethylene glycol, polypropylene glycol, polyols, polysaccharides or hydrocarbons. In some embodiments, each binding peptide within the fusion binds to the same target. In some embodiments, the binding peptides within the fusion bind to different targets.
[0063] In some embodiments, the present disclosure describes peptides that interact with target proteins. In some embodiments, said target proteins may comprise, consist of, or consist essentially of, one or more of human c-Jun/c-Fos heterodimer; Human Myc/Max heterodimer; Arabidopsis thaliana Hy5/Hy5 homodimer; Yeast GCN4/GCN4 homodimer; Ylan/Ylan homodimer; Drosophila melanogaster DSX/DSX homodimer; human PALS-1-L27N/Mouse PATJ-L27 heterodimer; Staphylococcus pyogenes Cas9; Escherichia coli alkaline phosphatase (AP); and Human Platelet-Derived Growth Factor (PDGF)/PDGF Receptor (PDGFR) complex. In some embodiments, the binding peptides comprise, consist of, or consist essentially of, one or more of the sequences ELDKAGFIKRQL (SEQ ID NO: 14), LEERGVKDRQLQ (SEQ ID NO: 15), LEILRAKDLALE (SEQ ID NO: 16), LEQIKIRLF (SEQ ID NO: 17), LSGLNEQRTQ (SEQ ID NO: 18), YDVDAIVPQC (SEQ ID NO: 19), CLTYDSHYLQ (SEQ ID NO: 20), LVAHVTSRKC (SEQ ID NO: 21), EYRLYLRALC (SEQ ID NO: 22), IEIVRKKPIF (SEQ ID NO: 23), IEIVRKKPIFC (SEQ ID NO: 24), CEDRLQSYDLD (SEQ ID NO: 25), EKLYLYYLQ (SEQ ID NO: 26), EKLYLYYLQC (SEQ ID NO: 27), LEQIKIRLFGSGSHHHHHH (SEQ ID NO: 28), LLQVDVILLCYPENLEQIKIRLFGSGSHHHHHH (SEQ ID NO: 11), LSRAYLSYEGSGSHHHHHH (SEQ ID NO: 29), EYRLYLRALCYPENLSRAYLSYEGSGSHHHHHH (SEQ ID NO: 30), EDRLQSYDLDGSGSHHHHHH (SEQ ID NO: 13), DLDYAQLRDKCYPENEDRLQSYDLDGSGSHHHHHH (SEQ ID NO: 31), GKPIPNPLLGLDST (SEQ ID NO: 32), ELDKAGFIKRQLC (SEQ ID NO: 33), LLQVDVILLHHHHHHLEQIKIRLF (SEQ ID NO: 34), and/or CFFDSLVKQ (SEQ ID NO: 35), or any combination or derivative thereof.
[0064] In some embodiments, binding peptides according to the methods and compositions as disclosed herein may be conjugated to a therapeutic moiety. Exemplary therapeutic moieties include but are not limited to, antibacterial agents, antifungal agents, chemotherapeutic agents, and biologics. In some embodiments the binding peptides according to the methods and compositions disclosed herein may be conjugated to a detectable moiety, including, for example, a fluorescent label, a radiolabel, an enzyme, a colorimetric label, a spin label, a metal ion binding moiety, a nucleic acid, a polysaccharide, or a polypeptide. In some embodiments, binding peptides as disclosed herein or made according to the methods described herein bind to or interact with biomarkers of human or animal diseases, disorders, conditions, or symptoms. It is contemplated that such peptides could be attached to a detectable moiety as described herein to provide for diagnosis, prognosis, or identification of said human or animal diseases, disorders, conditions, or symptoms.
[0065] Also contemplated herein are methods of treating diseases or disorders in a subject by administering the peptides as disclosed herein, including administering peptides designed and/or made according to the methods described herein, to a subject in need thereof. The present disclosure contemplates the making of peptide-protein complexes wherein said complex may occur in vivo or wherein said complexes are made by contacting the binding peptides disclosed herein or made by the methods as disclosed herein with a target protein or peptide, and wherein said contacting occurs in vivo. The making of said complexes or the contacting of said binding peptides with said target protein or peptide in vitro or ex vivo is also contemplated. Some embodiments according to the methods and compositions of the present disclosure provide for a composition comprising, consisting of, or consisting essentially of, one or more of the binding peptides as disclosed herein or made according to the methods disclosed herein, and optionally one or more excipients as described herein. Said composition may be prepared according to methods known in the art for delivery to the body of a subject, for example by parenteral, topical, subcutaneous, intramuscular, intraocular, intracerebral, intravenous, intraarterial, oral, ocular, intranasal, or transdermal delivery.
[0066] Specific targeting of a protein area by pre-selected sequence would be extremely useful for many branches of biotechnological sciences including medical diagnostics, disease prevention/eradication, biomedical engineering, and metabolic engineering. Antibodies are the present workhorse for detecting target proteins because they recognize epitopes with high affinity and specificity. Currently, however, production of antibodies for the pre-selected target sequence is tedious, time-consuming, and expensive. In addition, it is difficult to produce antibodies in very large quantities. As a large protein with disulfide bonds, moreover, antibodies are relatively fragile and unsuitable for certain applications such as delivery into live cells and very small biological environments. Therefore, it is an important goal to develop small biopolymers that retain the favorable molecular recognition characteristics of antibodies but that can be easily synthesized in large amounts. In the present study, we provide a new concept for the protein detection that has a potential to at least in part replace antibodies for protein targeting. Certain embodiments of the methods and compositions described herein are illustrated by the following non-limiting examples.
Example 1
Development of the Design Principles:
[0067] We summarized pairings of amino acids in Table 1. This pairing is named complementary amino acid pairing (CAAP). Using the hydrophobicity grouping of amino acids [Kyte J, and Doolittle RF (1982) J Mol Biol 157: 105-132], we found that there are four different types of pairing relationships between the CAAP residues: hydrophilic-hydrophobic (44%), hydrophilic-neutral (20%), neutral-hydrophobic (13%), and neutral-neutral (23%). There are no hydrophilic-hydrophilic and hydrophobic-hydrophobic relationships. Interestingly, 38% of the CAAP interactions (shaded in Table 1) belong to the acceptable amino acid pairings [Root-Bernstein, R. S. J Theor Biol. 1982 Feb. 21; 94(4):885-94]. In addition, the most CAAP interactions have a good stereochemical arrangement: the high molecular weight (bulky) side chains are pairing with the low molecular weight (small) side chains, and vice versa. These observations led us to postulate that the physicochemical and stereochemical natures of the CAAP relationships between two polypeptide chains may provide an attractive environment for protein-protein interaction.
[0068] We first focused on finding the CAAP interactions in the protein-protein interaction structure database from the protein data bank (PDB). We first examined the well-known leucine zipper proteins: human c-Jun/c-Fos heterodimer [PDB_1FOS]; Human Myc/Max heterodimer [PDB_1NKP]; Arabidopsis thaliana Hy5/Hy5 homodimer [PDB_2OQQ]; and Yeast GCN4/GCN4 homodimer [PDB_2DGC]. As shown in
[0069] Next, we expanded the search for the CAAP boxes into some non-leucine-zipper proteins: Staphylococcus aureus Ylan/Ylan homodimer [PDB_2ODM]; Drosophila melanogaster DSX/DSX homodimer [PDB_1ZV1]; and human PALS-1-L27N/Mouse PATJ-L27 hetero dimer [PDB_1VF6]. The CAAP boxes are also found in all protein-protein interaction domains of the non-leucine-zipper proteins (
Designing Polypeptide Sequence to Target Pre-Selected Polypeptide Sequence
[0070] We assessed the composition of all amino acid pairings in the CAAP boxes to obtain information on pairing preference and how the CAAPs were spaced out. First, we wrote a simple computational program to count all amino acid pairings in two different sets, parallel alignment and antiparallel alignment.
[0071] The numbers are shown in
The Synthetic CAAP Oligopeptide Interacts with the Pre-Selected Target Protein Sequence
[0072] To test our CAAP design system, we selected target sequences in the three different proteins: Streptococcus pyogenes Cas9 [PDB_5B2R]; Escherichia coli alkaline phosphatase (AP) [PDB_3TG0]; Human Platelet-Derived Growth Factor (PDGF)/PDGF Receptor (PDGFR) complex [PDB_3MJG], and Horseradish Peroxidase plus V5 epitope (
[0073] First, we performed a dot blot experiment to detect a Cas9 target sequence (PTD12 (SEQ ID NO: 27)) using the His-tagged CAAP oligopeptides, PTD13 (SEQ ID NO: 28) and PTD14 (SEQ ID NO: 11), (
[0074] Dual detection using a purified polypeptide V5C2-L-HRPC2 with two CAAP box dimer arms designed to interact with V5 epitope and HRP was also achieved. The V5C2-L-HRPC2 was designed with dual CAAP dimers to detect V5 epitope and HRP. Dot blot analysis using synthetic polypeptides, PTD1 (SEQ ID NO: 14) (unrelated, control) and immobilized PTD19 (SEQ ID NO: 32) (part of V5 epitope), as target molecules in presence or absence of V5C2-L-HRPC2 showed that the first interaction between immobilized V5 epitope and V5C2-L-HRPC2 was required for the second interaction between V5C2-L-HRPC2 and purified HRP protein. The interactions were visualized using a HRP chromogenic substrate (
[0075] To verify these results, we produced three recombinant fusion proteins, C9-813-92P (monomer, parallel), C9-813-93P (monomer, antiparallel), and C9-813-CAA2 (dimer, antiparallel and parallel), that consist of the N-terminal His-tag (for purification), CAAP oligopeptide, and alkaline phosphatase (AP). Then the same amount of the purified proteins (
[0076] Finally, we further examined the performance of the CAAP oligopeptides to detect the whole Cas9 protein in both non-denatured (dot blot) and denatured (western blot) conditions. We used two different forms of the Cas9 protein: the Cas9 protein without any tag (no tag) as an actual target and the His-tagged Cas9 protein as a positive control. The purified Cas9 proteins are shown in
[0077] To evaluate the specificity of the synthetic CAAP oligopeptides, PTD13 (SEQ ID NO: 28) and PTD14 (SEQ ID NO: 11), we used them to detect any potential target in the whole proteome of E. coli BL21 Star DE3 (
[0078] To investigate whether the CAAP-base protein interaction might be applicable for detecting the -sheet structure, we designed CAAP oligopeptides to interact with two more target oligopeptide sequences: n_LVAHVTSRKC_c (SEQ ID NO: 21) (PTD8 (SEQ ID NO: 21), coil-beta sheet-coil) in the AP and n_IEIVRKKPIF_c (SEQ ID NO: 23) (PTD10 (SEQ ID NO: 24), beta sheet) in the PDGF-. We first tested two synthetic His-tagged CAAP oligopeptides, PTD15 (SEQ ID NO: 29) (monomer, antiparallel) and PTD16 (SEQ ID NO: 30) (dimer, parallel and antiparallel), to detect the synthetic oligopeptide PTD8 (SEQ ID NO: 21) (
The CAAP Oligopeptide PTD14 Induces Non-Specific DNA Binding Activity of the Cas9 Nuclease
[0079] The PTD14 (SEQ ID NO: 11) target site [E813 to Q821] in the Cas9 protein is located in the HNH domain, which is important for DNA binding and DNA cleavage by conformational change. Thus we first tested the effect of the PTD14-Cas9 (SEQ ID NO: 11) interaction on the RNA-guided DNA cleavage by Cas9 nuclease. The PTD16 (SEQ ID NO: 30) was used as negative control. We used a 510 bp human AAV1 region as a target DNA and in vitro transcribed gRNA. We designed a gRNA specific for the AAVS1 to produce 191 bp and 319 bp DNA cleavage products (
Materials and Methods
Oligonucleotides, Synthetic DNA, Synthetic Peptides, and Enzymes
[0080] Oligonucleotides were obtained from Integrated DNA Technologies (IDT) and Thermo Fisher Scientific, and listed in Table 1. Synthetic DNA fragments were obtained from IDT DNA, and listed in Table 1. Synthetic peptides were purchased from Peptide 2.0 and listed in Table 1. Restriction enzymes and DNA modifying enzymes were purchased from New England Biolabs (NEB) and Thermo Fisher Scientific. The purified horseradish peroxidase (HRP) was obtained from PROSPEC.
Generation of Expression Vectors for the Recombinant Proteins
[0081] The bacterial expression vector, pET-21b, was obtained from EMD Millipore (catalog #69741-3). All plasmids were constructed by assembling two linear DNA fragments, vector and insert, with overlapping ends using a seamless DNA assembly method following the manufacturer's protocol [Thermo Fisher Scientific, GeneArt Seamless Cloning and Assembly Enzyme Mix, catalog #A14606]. Briefly, the pET-21b vector was digested with SwaI/XhoI, and assembled with a 143 bp DNA fragment, 92_6HNLS to produce vector pC9-813-92 or 93_6HNLS to produce vector pC9-813-93. The DNA fragments correspond to the parallel CAAP box and antiparallel CAAP box used to detect the Cas9 protein, respectively. The pC9-813-92 and pC9-813-93 vectors were digested with BamHI, and assembled with a 1501 bp DNA fragment 92P or 93P, corresponding to the E. coli alkaline phosphatase (AP) fusion, to generate pC9-813-92P and pC9-813-93P, respectively. The pC9-813-92P vector was digested with BglII, assembled with a 204 bp synthetic DNA fragment Sp-C9_813-821_CAA, corresponding to the CAAP box tetramer used to detect Cas9, to generate pC9-813-CAA4. The pC9-813-CAA4 vector was digested with BglII, and self-ligated (to remove 117 bp DNA fragment encoding two CAAP boxes), producing pC9-813-CAA2 which corresponds to the CAAP box dimer to used detect Cas9. A 258 bp synthetic DNA fragment V5C2-L-HRPC2, corresponding to the dual CAAP box dimer arms used to detect both V5 epitope and HRP, was assembled with the SwaI/XhoI-digested pET-21b to generate pV5C2-L-HRPC2.
[0082] For production of the recombinant Cas9 proteins, the pET-Spy-Cas9_6His and pET-Spy-Cas9_d6H vectors were constructed by assembling five parts with overlapping DNA ends using the seamless DNA assembly kit. Briefly, four insert parts [a 1000 bp Spy-Cas9_1, a 1030 bp Spy-Cas9_2, a 1030 bp Spy-Cas9_3, and a 1300 bp Spy-Cas9_4, corresponding to the His-tagged Cas9] and the SwaI/XhoI-digested pET-21b were assembled, to create pET-Spy-Cas9_6His. Similarly, four insert parts [a 1000 bp Spy-Cas9_1, a 1030 bp Spy-Cas9_2, a 1030 bp Spy-Cas9_3, and a 1303 bp Spy-Cas9_5, corresponding to the tagless Cas9] and the SwaI/XhoI-digested pET-21b were assembled, to create pET-Spy-Cas9_d6H.
Bacterial Strains
[0083] The E. coli strain DH10B T1 [Thermo Fisher Scientific, catalog #12331013] was used as a cloning host. The E. coli strain BL21 Star (DE3) [Thermo Fisher Scientific, catalog #C601003] was used for production of the recombinant proteins.
Protein Purification
[0084] For the recombinant protein production, the BL21 Star (DE3) cells harboring an expression vector were grown to mid-log phase (optical density at 600 nm [OD600] of 0.6) in LB medium [ampicillin (Amp), 100 g/ml] at 28 C. and induced with 1 mM IPTG (isopropyl--D-thiogalactopyranoside) for 5 h. Cells were harvested by centrifugation at 3000 rpm for 10 min. The harvested cells were disrupted by using a chemical lysis method following the manufacturer's protocol [Thermo Fisher Scientific, BPER Complete Bacterial Protein Extraction Reagent, catalog #89821]. Cell debris and insoluble proteins in the lysate were separated by centrifugation at 16,000g for 5 minutes. The His-tagged recombinant proteins were purified by a metal-affinity chromatography using the Dynabeads His-Tag Isolation and Pulldown beads following the manufacturer's protocol [Thermo Fisher Scientific, catalog #10103D].
[0085] The recombinant Cas9 proteins were purified using the HiTrap heparin HP column [GE Healthcare, catalog #17-0406-01] as previously described (Karvelis et al., 2015).
CRISPR-Cas9 Single Guide RNA (sgRNA) Synthesis
[0086] The sgRNA targeting human AAVS1 region (target sequence GGCTACTGGCCTTATCTCACAGG (SEQ ID NO: 36), PAM sequence underlined) was synthesized by in vitro transcription using a 118 bp PCR-assembled DNA fragment AAVS1_T23826 as template, following the manufacturer's protocol [Thermo Fisher Scientific, TranscriptAid T7 High Yield Transcription Kit, catalog #K0441]. The sgRNA product was purified using the GeneJET RNA Purification Micro Column [Thermo Fisher Scientific, catalog #K0841].
Dot Blot and Western Blot Analysis
[0087] For dot blot analysis, 1 l (2.5 g) or 2 l (5 g) of samples were spotted onto the nitrocellulose (NC) membrane and dried completely. Then, non-specific sites were blocked by soaking the membrane in the blocking solution made for NC membranes [Thermo Fisher Scientific, WesternBreeze Blocker/Diluent (Part A and B), catalog #WB7050]. The membrane was washed twice with water (1 ml per cm.sup.2 membrane), and incubated with the 1.sup.st antibody (Ab) in a binding/wash (BW) buffer [50 mM sodiumphosphate, pH 8.0, 300 mM NaCl, and 0.01% Tween 20] for 1 h. The membrane was washed 4 times (for 2 minutes per wash) with the wash buffer [Thermo Fisher Scientific, WesternBreeze Wash Solution, catalog #WB7003]. If the 1.sup.st oligopeptide was Anti-Cas9 Ab-HRP conjugate [Thermo Fisher Scientific, catalog #MAC133P] or the peptide-AP fusions, the membrane was washed twice with water, and incubated with the chromogenic substrates, Chromogenic Substrate (TMB) [Thermo Fisher Scientific, catalog #WP20004] for HRP and NBT/BCIP substrate solution for AP [Thermo Fisher Scientific, catalog #34042]. Otherwise, the membrane was incubated with in the blocking solution for 1 h. To detect His-tagged peptide and proteins, the Anti-6His Ab-HRP conjugate [Thermo Fisher Scientific, catalog 46-0707] was used. Then the membrane was washed four times with the wash buffer and two times with water. Finally, the blot was incubated with the chromogenic substrates.
[0088] For the western blot analysis, the protein samples were resolved in 4-20% gradient SDS-PAGE gel, transferred to NC membrane, and subjected to the western blot analysis using the same method for the dot blot analysis.
Cas9 Activity Assay In Vitro
[0089] A 510 bp human AAVS1 region was amplified from HEK293 genomic DNA by PCR using a primer set (CH1161 and CH1162) and used as a target DNA for the in vitro CRISPR/Cas9 assay. Performance of the Cas9 protein was assessed in various concentrations of Cas9 [100, 50, 25, 12.5, and 0 ng] in presence or absence of sgRNA and peptides (PTD14 (SEQ ID NO: 11) and PTD16 (SEQ ID NO: 30)) in the 1 buffer K [20 mM Tris-HCl, pH 8.5, 10 mM MgCl2, 1 mM Dithiothreitol (DTT), and 100 mM KCl]. The PTD16 (SEQ ID NO: 30) was used as an unrelated peptide control. The reaction mixture was incubated at 37 C. for 15 minutes. The reaction was stopped by adding a stop buffer [1 mM Tris-HCl (pH 7.5), 10 mM EDTA, 6.5% (w/v) Sucrose, 0.03% (w/v) Bromophenol Blue] and heat inactivated at 75 C. for 5 minutes. The reaction samples were resolved in 4% agarose gel.
TABLE-US-00001 TABLE 1 Corresponding Amino Acid Target Amino Acid for Binding Peptide N I, V Y I, V C T, A S R, G, T, A T S, G, C, R Q L W P I N, D, Y M H P R, G, W F K, E G T, A, S, P A S, G, C, R V N, D, Y, H L Q, K, E H M, V E F, L R T, A, S, P K F, L D I, V
TABLE-US-00002 TABLE2 Primersusedinthisstudy RelatedDNA Name Sequence(5to3) fragment(s) CH1149 taatacgactcactatagggctactggccttat(SEQIDNO:37) AAVS1_T23826 CH1150 TTCTAGCTCTAAAACgtgagataaggccagtagcc(SEQIDNO:38) AAVS1_T23826 CH1161 ggaggaatatgtcccagatag(SEQIDNO:39) AAVS1 CH1162 AAGGTTTGCTTACGATGGAG(SEQIDNO:40) AAVS1 CH1389 ccctctagaatagaaggagatttaaatgcaccatcaccaccatcacGAGCTC(SEQID 92_6HNLSand NO:41) 93_6HNLS CH1392 TCAGGATCCTTACAGCTGCTGAACTTCAACGCTCAGCAGGAGC 92_6HNLS TCGTGATGGTGGTGATG(SEQIDNO:42) CH1393 TCAGGATCCTTAAAACAGACGGATTTTAATCTGCTCTAAGAGC 93_6HNLS TCGTGATGGTGGTGATG(SEQIDNO:43) CH1405 GGACTTTGCGTTTCTTTTTCGGATC(SEQIDNO:44) 92Pand93P CH1424 agcgttgaagttcagcagctgagatctgtgaaacaaagcactattg(SEQIDNO:45) 92P CH1425 cagattaaaatccgtctgtttagatctgtgaaacaaagcactattg(SEQIDNO:46) 93P CH1496 agccggatctcagtggtggtggtggtggtgctcgaggactttgcgtttctttttcggatcctta 92_6HNLSand (SEQIDNO:47) 93_6HNLS CH1497 AAAAGCACCGACTCGGTG(SEQIDNO:48) AAVS1_T23826
TABLE-US-00003 TABLE3 DNAfragmentsusedinthisstudy Name Sequence(5to3) Production 92_6HNLS ccctctagaatagaaggagatttaaatgcacCATCACCACCATCACGAGCTCCTGCT PCR GAGCGTTGAAGTTCAGCAGCTGTAAGGATCCgaaaaagaaacgcaaagtcct cgagcaccaccaccaccaccactgagatccggct(SEQIDNO:49) 93_6HNLS ccctctagaatagaaggagatttaaatgcacCATCACCACCATCACGAGCTCTTAGA PCR GCAGATTAAAATCCGTCTGTTTTAAGGATCCgaaaaagaaacgcaaagtcctc gagcaccaccaccaccaccactgagatccggct(SEQIDNO:50) Sp-C9_813- AGCGTTGAAGTTCAGCAGCTGTGCTATCCGGAAAACCTCGAATAC Synthetic 821_CAA CTGTTTATTGAAAAATTAAGATCTGAAGCCGAAGGCAACGGCACT ATAGACTTCGAGCTCCTGTTACAGGTGGATGTGATTCTGCTCAAA ACCGGTGAAGTCAACAACTTAGAGCAGATTAAAATCCGTCTGTTT AGATCTGTGAAACAAAGCACTATT(SEQIDNO:51) 92P agcgttgaagttcagcagctgagatctgtgaaacaaagcactattgcactggcactcttaccgttactgtttacc PCR cctgtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca cccggcggtgctcgccgtttaacgggtgatcagactgccgctctgcgtgattctcttagcgataaacctgcaa aaaatattattttgctgattggcgatgggatgggggactcggaaattactgccgcacgtaattatgccgaaggt gcgggcggcttttttaaaggtatagatgcctcaccgcttaccgggcaatacactcactatgcgctgaataaaaa aaccggcaaaccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacct ataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagccgca ggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcgctggtggcacatgt gacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccgggtaacgctctggaaaaaggc ggaaaaggatcgattaccgaacagctgcttaacgctcgtgccgacgttacgcttggcggcggcgcaaaaac ctttgctgaaacggcaaccgctggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggt tatcagttggtgagcgatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcc tgtttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccatggcaatatcgataagc ccgcagtcacctgtacgccaaatccgcaacgtaatgacagtgtaccaaccctggcgcagatgaccgacaaa gccattgaattgttgagtaaaaatgagaaaggctttttcctgcaagttgaaggtgcgtcaatcgataaacaggat catgctgcgaatccttgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctgga attcgctaaaaaggagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgc gccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatggtgatgagtt acgggaactccgaagaggattcacaagaacataccggcagtcagttgcgtattgcggcgtatggcccgcat gccgccaatgttgttggactgaccgaccagaccgatctcttctacaccatgaaagccgctctggggctgaaa gcttccggctctagccatcaccatcaccatcacggttcatctgcggatccgaaaaagaaacgcaaagtcctcg agaccaccaccaccaccactga(SEQIDNO:52) 93P cagattaaaatccgtctgtttagatctgtgaaacaaagcactattgcactggcactcttaccgttactgtttacccc PCR tgtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgcacc cggcggtgctcgccgtttaacgggtgatcagactgccgctctgcgtgattctcttagcgataaacctgcaaaa aatattattttgctgattggcgatgggatgggggactcggaaattactgccgcacgtaattatgccgaaggtgc gggcggcttttttaaaggtatagatgcctcaccgcttaccgggcaatacactcactatgcgctgaataaaaaaa ccggcaaaccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctat aacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagccgcag gtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcgctggtggcacatgtga cctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccgggtaacgctctggaaaaaggcgg aaaaggatcgattaccgaacagctgcttaacgctcgtgccgacgttacgcttggcggcggcgcaaaaacctt tgctgaaacggcaaccgctggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttat cagttggtgagcgatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctg tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccatggcaatatcgataagccc gcagtcacctgtacgccaaatccgcaacgtaatgacagtgtaccaaccctggcgcagatgaccgacaaagc cattgaattgttgagtaaaaatgagaaaggctttttcctgcaagttgaaggtgcgtcaatcgataaacaggatca tgctgcgaatccttgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaatt cgctaaaaaggagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcgc cggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatggtgatgagttac gggaactccgaagaggattcacaagaacataccggcagtcagttgcgtattgcggcgtatggcccgcatgc cgccaatgttgttggactgaccgaccagaccgatctcttctacaccatgaaagccgctctggggctgaaagct tccggctctagccatcaccatcaccatcacggttcatctgcggatccgaaaaagaaacgcaaagtcctcgag caccaccaccaccaccactga(SEQIDNO:53) Spy-Cas9_1 ccctctagaatagaaggagatttaaatggataagaaatacagcattggtttggacattggtacgaatagcgttg Synthetic gttgggcagtcattaccgacgagtacaaggtgccgagcaagaagtttaaagtattgggtaacacggaccgtc acagcattaagaaaaacctgattggtgcactgctgtttgacagcggtgaaactgcagaggcgactcgcctga agcgtaccgcgcgtcgccgctatactcgtcgtaaaaaccgtatctgctatctgcaggagatctttagcaacga gatggcgaaggttgatgacagcttctttcaccgtctggaagaaagcttcctggtcgaagaggacaaaaagca cgagcgccatccgatcttcggcaacattgtggacgaagtggcttatcatgaaaagtatccgaccatttatcatct gcgtaagaagctggttgatagcaccgataaagcggatctgcgtctgatttacctggcactggcccacatgatc aagtttcgcggccactttctgatcgagggtgatctgaatccggacaatagcgacgttgacaagctgttcatcca actggtccaaacgtacaaccagctgttcgaagaaaacccgatcaacgcgagcggtgtggatgcaaaagcta ttctgagcgcgcgtctgagcaagagccgtcgtttggagaatctgatcgcgcaattgccgggtgagaagaaaa atggcctgttcggtaatctgattgcactgtccctgggcctgacgccgaacttcaaaagcaattttgatctggcag aagatgcgaagctgcaactgagcaaagatacttatgatgacgacctggacaatctgttggcacaaatcggtg accagtatgcagatctgtttctggcggcaaagaacctgtccgatgcgatcctgctgagcgacattctgcgcgt gaacacggaaattaccaaggctccgctgagcgcgagcatgattaagcgttac(SEQIDNO:54) Spy-Cas9_2 ccgctgagcgcgagcatgattaagcgttacgatgagcaccaccaggatctgaccctgctgaaggcgctggt Synthetic ccgtcagcaactgccggaaaagtacaaagagattttctttgaccagagcaagaatggctacgcgggctatat cgatggtggcgctagccaagaagagttctacaagtttatcaagccgattttggagaaaatggatggtaccgaa gagttgctggttaaactgaatcgtgaagatctgctgcgtaagcaacgcacctttgataatggcagcattccgca tcaaattcacctgggtgagttgcatgctatcctgcgccgtcaagaggatttctacccgtttctgaaagacaacc gtgagaagatcgagaaaattctgactttccgcatcccgtattacgtcggtccgctggcgcgtggtaacagccg tttcgcatggatgacccgtaagagcgaagaaaccatcaccccatggaacttcgaagaggttgtggataaggg tgcatccgcgcaaagcttcatcgagcgtatgacgaattttgacaagaatctgccgaatgaaaaagtgctgccg aagcacagcctgctgtacgaatactttaccgtctataacgagctgaccaaagtcaaatacgtcaccgagggta tgcgtaaaccggcgttcctgagcggcgagcagaagaaggcgattgtcgatctgctgttcaaaacgaatcgta aagttacggttaagcaactgaaagaggactacttcaagaaaattgaatgtttcgactctgtcgagattagcggt gttgaagatcgcttcaatgcgagcttgggtacctatcatgatctgctgaagatcatcaaagacaaagatttcctg gataatgaagagaacgaggacattctggaagatatcgttttgacgctgaccttgttcgaagatcgtgagatgat cgaagaacgcctgaaaacgtatgcgcacctgtttgatgataaagtgatgaaacaactgaagcgtcgccgttat accggtt(SEQIDNO:55) Spy-Cas9_3 aacaactgaagcgtcgccgttataccggttggggtcgtctgagccgtaagctgatcaacggcattcgtgataa Synthetic acagtccggtaagacgatcctggattttctgaaaagcgacggcttcgcaaaccgtaatttcatgcagctgattc acgacgacagcttgaccttcaaagaggacatccagaaagcacaagttagcggtcaaggcgatagcctgcat gagcacattgcaaatttggcgggtagcccagcgatcaagaagggtattctgcagaccgttaaagtggttgat gaactggtgaaagttatgggccgtcacaagcctgaaaacatcgtcattgagatggcgcgtgaaaatcagacc acgcaaaagggccagaagaatagccgtgaacgcatgaaacgtatcgaagagggcattaaagaactgggct cccaaatcctgaaagagcatccggtggagaatactcaactgcagaatgaaaagctgtacctgtactatctgca aaacggtcgcgatatgtacgtcgaccaggagctggacatcaaccgcctgtccgactatgacgttgatcacatt gtcccgcagagcttcctgaaagatgacagcatcgacaacaaggtcctgacccgtagcgataagaatcgcgg taaaagcgataacgtgccaagcgaagaagtggtgaagaagatgaaaaactattggcgtcaactgttgaacg ctaaattgattacgcaacgtaagttcgacaacctgaccaaggcggaacgtggtggcctgagcgaactggac aaagcgggtttcatcaagcgccaactggtggaaacccgtcagattacgaaacatgtcgcccaaattctggac agccgtatgaacacgaagtacgatgaaaacgataaactgattcgtgaagtcaaagttatcacgctgaaaagc aagctggtgagcgacttccgtaaggattttcagttttacaaagtccgtgaaatcaacaactaccaccatgcgca cgatgcctatctgaacgctgt(SEQIDNO:56) Spy-Cas9_4 ccatgcgcacgatgcctatctgaacgctgtggtgggtaccgcgctgattaagaagtatccgaaactggaaag Synthetic cgagttcgtgtacggtgattacaaggtttacgatgttcgtaagatgatcgcgaagtccgaacaagaaatcggc aaagcgaccgctaagtatttcttttactccaacattatgaactttttcaaaaccgagatcaccctggcaaacggt gagatccgcaaacgtccgctgatcgagactaatggcgagactggcgaaatcgtgtgggacaaaggtcgtga cttcgccaccgtccgtaaggtattgagcatgccgcaagtcaatattgttaagaaaaccgaagttcaaaccggt ggtttcagcaaagagagcattctgcctaagcgcaactccgacaaactgattgcccgtaagaaggattgggac ccgaaaaagtatggcggtttcgatagcccaactgtggcatacagcgtgctggtggttgccaaagtggagaaa ggtaagtccaagaagctgaaatctgtcaaagagctgctgggcatcaccattatggagcgcagcagctttgag aaaaatccaatcgacttcctggaagcgaagggctacaaagaggtcaagaaagacctgatcatcaagttgcca aagtacagcctgttcgagctggagaatggtcgtaagcgcatgctggcctctgccggtgaactgcaaaagggt aacgaactggcgctgccgtcgaaatacgttaactttctgtacctggcatcccactacgagaaactgaaaggca gccctgaagataacgagcaaaaacaactgtttgttgagcagcacaaacactatctggatgagatcattgaaca gattagcgaattcagcaagcgtgtgatcctggcggacgcgaacctggacaaagtcctgtccgcgtacaataa acatcgcgacaaaccgattcgtgagcaggcggaaaacattatccacctgtttaccctgacgaatctgggtgcc cctgcggcgtttaagtactttgacactactatcgatcgtaaacgttatacgagcaccaaagaggttctggatgc gaccctgattcaccagagcattaccggcctgtatgaaacgcgtatcgacctgagccaattgggtggtgaccg ctctcgtgcagatccgaaaaagaaacgcaaagtcgatccgaagaagaagcgcaaggtggacccgaagaa aaagcgtaaagtcggctctaccggtagccgtggctctggttcgctcgagcaccaccaccaccaccactga (SEQIDNO:57) Spy-Cas9_5 ccatgcgcacgatgcctatctgaacgctgtggtgggtaccgcgctgattaagaagtatccgaaactggaaag Synthetic cgagttcgtgtacggtgattacaaggtttacgatgttcgtaagatgatcgcgaagtccgaacaagaaatcggc aaagcgaccgctaagtatttcttttactccaacattatgaactttttcaaaaccgagatcaccctggcaaacggt gagatccgcaaacgtccgctgatcgagactaatggcgagactggcgaaatcgtgtgggacaaaggtcgtga cttcgccaccgtccgtaaggtattgagcatgccgcaagtcaatattgttaagaaaaccgaagttcaaaccggt ggtttcagcaaagagagcattctgcctaagcgcaactccgacaaactgattgcccgtaagaaggattgggac ccgaaaaagtatggcggtttcgatagcccaactgtggcatacagcgtgctggtggttgccaaagtggagaaa ggtaagtccaagaagctgaaatctgtcaaagagctgctgggcatcaccattatggagcgcagcagctttgag aaaaatccaatcgacttcctggaagcgaagggctacaaagaggtcaagaaagacctgatcatcaagttgcca aagtacagcctgttcgagctggagaatggtcgtaagcgcatgctggcctctgccggtgaactgcaaaagggt aacgaactggcgctgccgtcgaaatacgttaactttctgtacctggcatcccactacgagaaactgaaaggca gccctgaagataacgagcaaaaacaactgtttgttgagcagcacaaacactatctggatgagatcattgaaca gattagcgaattcagcaagcgtgtgatcctggcggacgcgaacctggacaaagtcctgtccgcgtacaataa acatcgcgacaaaccgattcgtgagcaggcggaaaacattatccacctgtttaccctgacgaatctgggtgcc cctgcggcgtttaagtactttgacactactatcgatcgtaaacgttatacgagcaccaaagaggttctggatgc gaccctgattcaccagagcattaccggcctgtatgaaacgcgtatcgacctgagccaattgggtggtgaccg ctctcgtgcagatccgaaaaagaaacgcaaagtcgatccgaagaagaagcgcaaggtggacccgaagaa aaagcgtaaagtcggctctaccggtagccgtggctctggttcgTAActcgagcaccaccaccaccaccac tga(SEQIDNO:58) AAVS1_ TAATACGACTCACTATAGGGCTACTGGCCTTATCTCACGTTTTAG PCR T23826 AGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTT GAAAAAGTGGCACCGAGTCGGTGCTTTT(SEQIDNO:59) V5C2-L- gcggataacaattcccctctagaatagaaggagatttaaatgagccgtaaagaagcacgcgagctctgttacc Synthetic HRPC2 cggagaatggtctggaagcactgattagatctggaggtggaggttcaggtggaggtggatccggtggtgga ggatcatattatctgcgtaaacgtattctgtgctacccggaaaatcaggttctggaacgtagcaatgaaggtagt ggtagcaagcttctcgagcaccaccaccaccaccactga(SEQIDNO:60) AAVS1 ggaggaatatgtcccagatagcactggggactctttaaggaaagaaggatggagaaagagaaagggagta PCR gaggcggccacgacctggtgaacacctaggacgcaccattctcacaaagggagttttccacacggacaccc ccctcctcaccacagccctgccaggacggggctggctactggccttatctcacaggtaaaactgacgcac ggaggaacaatataaattggggactagaaaggtgaagagccaaagttagaactcaggaccaacttattctga ttttgtttttccaaactgcttctcctcttgggaagtgtaaggaagctgcagcaccaggatcagtgaaacgcacca gacggccgcgtcagagcagctcaggttctgggagagggtagcgcagggtggccactgagaaccgggca ggtcacgcatcccccccttccctcccaccccctgccaagctctccctcccaggatcctctctggctccatcgta agcaaacctt(SEQIDNO:61)
TABLE-US-00004 TABLE4 Complementaryamino Inter- PDB acidpairing(CAAP, Pairing Protein(chain_structure) action ID underlined)Box Orientation Source AmyloidPrecursorE2(chain Homo 3NYL KAKERLEA(SEQID Antiparallel Homo A_helix2) dimer NO:62) sapiens AmyloidPrecursorE2(chain FHKLTHQR(SEQID B_helix4) NO:63) AmyloidPrecursorE2(chain Homo 3NYL ERQQLVET(SEQID Antiparallel Homo A_helix3) dimer NO:64) sapiens AmyloidPrecursorE2(chain LSLSQNMR(SEQID B_helix5) NO:65) APPL1-BAR(chainA_helix2) Homo 2Z0N ELSAATHL(SEQID Antiparallel Homo APPL1-BAR(chainB_helix2) dimer NO:66) sapiens LHTAASLE(SEQID NO:67) APPL1-BAR(chainA_helix7) Homo 2Z0N TSVQNVRR(SEQID Antiparallel Homo APPL1-BAR(chainB_helix5) dimer NO:68) sapiens RSTYVDET(SEQID NO:69) C.esp1396i(chainA_helix4) Homo 3G5G FEMLIKEILK(SEQ Antiparallel Enterobacter C.esp1396i(chainB_helix4) dimer IDNO:70) sp.RFL1396 KLIEKILMEF(SEQ IDNO:71) Cag1(chainA_helix2) Homo 4CII IGGTASLITASQ Antiparallel Helicobacter Cag1(chainB_helix2) dimer (SEQIDNO:72) pylori26695 YQRKSQELSREL (SEQIDNO:73) Cag1(chainA_helix2) Homo 4CII LEELDALERSLEQS Antiparallel Helicobacter Cag1(chainB_helix2) dimer KR pylori26695 (SEQIDNO:74) KLSEVLTQSATILSA T (SEQIDNO:75) Cce_0567(chainA_helix1) Homo 3CSX LKKKVRKL(SEQID Antiparallel Cyano- Cce_0567(chainB_helix1) dimer NO:76) bacterium KKKLQDLE(SEQID Cyanothece NO:77) Csor(chainA_helix2) Homo 2HH7 QSSLERAN(SEQID Antiparallel Myco- Csor(chainB_helix2) dimer NO:78) bacterium NARELSSQ(SEQID tuberculosis NO:79) CytochromeC(chainA_helix1) Homo 1BBH AGLSPEEQ(SEQID Antiparallel Allo- CytochromeC(chainB_helix1) dimer NO:80) chromatium GAQRTEIQ(SEQID vinosum NO:81) CytochromeC(chainA_helix2) Homo 1BBH IAAIANSG(SEQID Antiparallel Allo- CytochromeC(chainB_helix2) dimer NO:82) chromatium MGSNAIAA(SEQID vinosum NO:83) DD_Ribeta_PKA(chain Homo 4F9K LREHFEKLEK(SEQ Antiparallel Homo A_helix3) dimer IDNO:84) sapiens DD_Ribeta_PKA(chain KELKEFHERL(SEQ B_helix3) IDNO:85) Endothelin-1(chainA_betasheet) Homo 1T7H KRCSCSSL(SEQID Antiparallel Homo Endothelin-1(chainB_betasheet) dimer NO:86) sapiens LSSCSCRK(SEQID NO:87) Fkbp22(chainA_helix1) Homo 3B09 SYGVGRQG(SEQID Antiparallel Shewanella Fkbp22(chainB_helix3) dimer NO:88) sp.SIB1 RRSIETFA(SEQID NO:89) Gp7-Myh7-EB1(chainA_helix3) Homo 4XA1 LEKEKSEFKLEL Antiparallel Homo Gp7-Myh7-EB1(chainB_helix3) dimer (SEQIDNO:90) sapiens KLEKEKSEFKLE (SEQIDNO:91) HDAg(chainA_helix1) Homo 1A92 KLEELERDLRKL Antiparallel Hepatitis HDAg(chainB_helix1) octamer (SEQIDNO:92) deltavirus LKRLDRELEELK (SEQIDNO:93) Hi0947(chainA_helix2) Homo 2JUZ ASNLLTTS(SEQID Antiparallel Haemophilus Hi0947(chainB_helix2) dimer NO:94) influenzae STTLLNSA(SEQID NO:95) Hi0947(chainA_helix3) Homo 2JUZ SLINAVKT(SEQID Antiparallel Haemophilus Hi0947(chainB_helix3) dimer NO:96) influenzae TKVANILS(SEQID NO:97) Hp0062(chainA_helix1) Homo 3FX7 LERFKELL(SEQID Antiparallel Helicobacter Hp0062(chainB_helix1) dimer NO:98) pylori RLLEKFRE(SEQID NO:99) Hp0062(chainA_helix2) Homo 3FX7 DKFSEVLDNLKSTF Antiparallel Helicobacter Hp0062(chainB_helix2) dimer NEFDEAAQEQIAWL pylori KERI(SEQID NO:100) IREKLWAIQEQAAE DFENFTSKLNDLVE SFKD(SEQID NO:101) If1(chainA_helix1) Homo 1GMJ QSIKKLKQS(SEQID Antiparallel Bostaurus If1(chainB_helix1) dimer NO:102) LAALQEKAR(SEQ IDNO:103) Jip3(chainA_helix1) Homo 4PXJ LSGEQEVLRGELEA Antiparallel Homo Jip3(chainB_helix1) dimer AK sapiens (SEQIDNO:104) KAAELEGRLVEQE GSL (SEQIDNO:105) LambdaCRORepressor(chain Homo 1D1L MEQRITLK(SEQID Antiparallel Bacteriophage A_betasheet1) dimer NO:106) Lambda LambdaCRORepressor(chain DKLTIRQE(SEQID B_betasheet1) NO:107) Rev(chainA_helix1) Homo 3LPH RLIKFLYQS(SEQID Antiparallel HIVtype1 Rev(chainB_helix1) dimer NO:108) (HXB3 SQYLFKILR(SEQID ISOLATE) NO:109) Rev(chainA_helix2) Homo 3LPH SERIRSTYLGR(SEQ Antiparallel HIVtype1 Rev(chainB_helix2) dimer IDNO:110) (HXB3 RGLYTSRIRES(SEQ ISOLATE) IDNO:111) ROM(chainA_helix1) Homo 2IJK FIRSQTLT(SEQID Antiparallel Escherichia ROM(chainB_helix1) dimer NO:112) coli ELLTLTQS(SEQID NO:113) ROM(chainA_helix2) Homo 2IJK ESLHDHADEL(SEQ Antiparallel Escherichia ROM(chainB_helix2) dimer IDNO:114) coli FRALCSRYLE(SEQ IDNO:115) Trim25(chainA_helix1) Homo 4LTB SLSQASADL(SEQID Antiparallel Homo Trim25(chainB_helix1) dimer NO:116) sapiens RKTLSQEIE(SEQID NO:117) Trim25(chainA_helix3) Homo 4LTB QSTIDLKN(SEQID Antiparallel Homo Trim25(chainB_helix3) dimer NO:118) sapiens LRGICQKL(SEQID NO:119) Usp8(chainA_helix1) Homo 2A9U KSYVHSALKIFKTA Antiparallel Homo Usp8(chainB_helix1) dimer EECRL sapiens (SEQIDNO:120) LRCEEATKFIKLAS HVYSK (SEQIDNO:121) Usp8(chainA_helix2) Homo 2A9U YVLYMKYV(SEQID Antiparallel Homo Usp8(chainB_helix2) dimer NO:122) sapiens VYKMYLVY(SEQID NO:123) Xcl1(chainA_betasheet3) Homo 2N54 RCVIFITF(SEQID Antiparallel Homo Xcl1(chainB_betasheet2) dimer NO:124) sapiens ITYTKIRS(SEQID NO:125) Gemin6(chainA_betasheet5) Hetero 1Y96 GSMSVTGI(SEQID Antiparallel Homo Gemin7(chainB_betasheet7) dimer NO:126) sapiens PKFTYSII(SEQID NO:127) Lin-7(chainA_helix1) Hetero 1ZL8 QRILELMEHV(SEQ Antiparallel Caenorhabditis Lin-2(chainB_helix2) dimer IDNO:128) elegans LIRKLEKADN(SEQ Homo IDNO:129) sapiens Lin-7(chainA_helix2) Hetero 1ZL8 ASLQQVLQ(SEQID Antiparallel Caenorhabditis Lin-2(chainB_helix1) dimer NO:130) elegans SIEELVEK(SEQID Homo NO:131) sapiens Med7(chainA_helix1) Hetero 1YKH IQELRKLL(SEQID Antiparallel Saccharomyces Srb7(chainB_helix2) dimer NO:132) cerevisiae DILKNIQR(SEQID NO:133) Mst1(chainA_helix) Hetero 4OH8 LQKRLLALDP(SEQ Antiparallel Homo Rassf5Sarah(chainB_helix) dimer IDNO:134) sapiens ERLAEELKQR(SEQ IDNO:135) PALS-1-L27N(chainA_helix1) Hetero 1VF6 VLDRLKMK(SEQID Antiparallel Homo PATJ-L27(chainB_helix2) dimer NO136) sapiens NQVLQLLL(SEQID Mus NO:137) musculus PALS-1-L27N(chainA_helix2) Hetero 1VF6 LSMFYETL(SEQID Antiparallel Homo PATJ-L27(chainB_helix1) dimer NO:138) sapiens QIHKLSSF(SEQID Mus NO:139) musculus TAF(II)-18(chainA_helix1) Hetero 1BH8 LFSKELRC(SEQID Antiparallel Homo TAF(II)-28(chainB_helix1) dimer NO:140) sapiens EYRNLQEE(SEQID NO:141) TAF(II)-18(chainA_helix2) Hetero 1BH8 LEDLVIEFITEMTH Antiparallel Homo TAF(II)-28(chainB_helix3) dimer (SEQIDNO:142) sapiens EVVEGVFVKSIGSM (SEQIDNO:143) TypeIAntifreezeProtein(chain Homo 4KE2 NoCAAPBox Antiparallel Pseudopleuro A_helix) dimer nectes TypeIAntifreezeProtein(chain americanus B_helix) Swi5(chainB_helix) Homo 3VIR VQKHIDLLHTYNEI Antiparallel Schizosaccha Swi5(chainA_helix) tetramer (SEQIDNO:144) romyces HLLDIHKQVTQKA pombe D (SEQIDNO:145) Swi5(chainC_helix) Homo 3VIR EQQKEQLESSLQ Antiparallel Schizosaccha Swi5(chainA_helix) tetramer (SEQIDNO:146) romyces LKALADQLSSEL pombe (SEQIDNO:147) Arenicin-2(chainA_betasheet1) Homo 2L8X VYAYVRIR(SEQID Parallel Arenicola Arenicin-2(chainB_betasheet1) dimer NO:148) marina RWCVYAYV(SEQID (lugworm) NO:149) Beta-myosinS2(chainA_helix1) Homo 2FXO EALEKSEARRKELE Parallel Homo Beta-myosinS2(chainB_helix1) dimer E sapiens (SEQIDNO:150) LKEALEKSEARRKE L (SEQIDNO:151) Beta-myosinS2(chainA_helix2) Homo 2FXO EKNDLQLQVQ(SEQ Parallel Homo Beta-myosinS2(chainB_helix2) dimer IDNO:152) sapiens LLQEKNDLQL(SEQ IDNO:153) Beta-myosinS2(chainA_helix3) Homo 2FXO ELKRDIDDLE(SEQ Parallel Homo Beta-myosinS2(chainB_helix3) dimer IDNO:154) sapiens LKRDIDDLEL(SEQ IDNO:155) Cc1-fha(chainA_helix1) Homo 5DJO LKEKLEES(SEQID Parallel Mus Cc1-fha(chainB_helix1) dimer NO:156) musculus ELKEKLEE(SEQID NO:157) Cc2-LZ(chainA_helix1) Homo 4BWN LEDLKQQLQ(SEQ Parallel Homo Cc2-LZ(chainB_helix1) dimer IDNO:158) sapiens QLEDLKQQL(SEQ IDNO:159) Cc2-LZ(chainA_helix2) Homo 4BWN LLQEQLEQLQ(SEQ Parallel Homo Cc2-LZ(chainB_helix2) dimer IDNO:160) sapiens ELLQEQLEQL(SEQ IDNO:161) Cenp-b(chainA_helix1) Homo 1UFI AYFAMVKR(SEQID Parallel Homo Cenp-b(chainB_helix1) dimer NO:162) sapiens GEAMAYFA(SEQID NO:163) Cenp-b(chainA_helix2) Homo 1UFI HLEHDLVH(SEQID Parallel Homo Cenp-b(chainB_helix2) dimer NO:164) sapiens VQSHILHL(SEQID NO:165) cGMP-dependentproteinkinase Homo 1ZXA LEKRLSEK(SEQID Parallel Homo (chainA_helix) dimer NO:166) sapiens cGMP-dependentproteinkinase KELEKRLS(SEQID (chainB_helix) NO:167) DSX(chainA_helix3) Homo 1ZV1 EEGQYVVNEYSR Parallel Drosophila DSX(chainB_helix2) dimer (SEQIDNO:168) melanogaster LMPLMYVILKDA (SEQIDNO:169) Ferritin(chainA_helix1) Homo 1LB3 VEAAVNRL(SEQID Parallel Mus Ferritin(chainB_helix2) 24mer NO:170) musculus HFFRELAE(SEQID NO:171) FGFR3(chainA_helix1) Homo 2LZL AGSVYAGI(SEQID Parallel Homo FGFR3(chainB_helix1) dimer NO:172) sapiens EAGSVYAG(SEQID NO:173) Fkbp22(chainA_helix1) Homo 3B09 GVGRQGEQ(SEQID Parallel Shewanella Fkbp22(chainB_helix2) dimer NO:174) sp.SIB1 AGLADAFA(SEQID NO:175) Gal4(chainA_helix1) Homo 1HBW RLERLEQL(SEQID Parallel Saccharomyces Gal4(chainB_helix1) dimer NO:176) cerevisiae SRLERLEQ(SEQID NO:177) GCN4(chainA_helix2) Homo 2DGC RRSRARKLQRMKQ Parallel Saccharomyces GCN4(chainB_helix2) dimer LE cerevisiae (SEQIDNO:178) ARRSRARKLQRMK QL (SEQIDNO:179) Gld1(chainA_helix1) Homo 3K6T ADLVKEKK(SEQID Parallel Caenorhabditis Gld1(chainB_helix2) dimer NO:180) elegans NVERLLDD (SEQID NO:181) Gld1(chainA_helix2) Homo 3K6T SNVERLLD(SEQID Parallel Caenorhabditis Gld1(chainB_helix1) dimer NO:182) elegans LADLVKEK(SEQID NO:183) Hmfa(chainA_helix2) Homo 1HTA SDDARIAL(SEQID Parallel Methano- Hmfa(chainB_helix1) dimer NO:184) bacterium RIIKNAGA(SEQID fervidus NO:185) Hnf-1alpha(chainA_helix1) Homo 1JB6 LSQLQTEL(SEQID Parallel Mus Hnf-1alpha(chainB_helix1) dimer NO:186) musculus KLSQLQTE(SEQID NO:187) Hnf-1alpha(chainA_helix1) Homo 1JB6 LSQLQTEL(SEQID Parallel Mus Hnf-1alpha(chainB_helix2) dimer NO:188) musculus EALIQALG(SEQID NO:189) Hv1(chainA_helix1) Homo 3VMX LNKLLKQN(SEQID Parallel Mus Hv1(chainB_helix1) dimer NO:190) musculus ERLNKLLK(SEQID NO:191) Hy5(chainA_helix) Homo 2OQQ SAYLSELE(SEQID Parallel Arabidopsis Hy5(chainB_helix) dimer NO:192) thaliana GSAYLSEL(SEQID NO:193) Interleukin-10(chainA_helix4) Homo 1ILK ALSEMIQF(SEQID Parallel Homo Interleukin-10(chainB_helix6) dimer NO:194) sapiens SKAVEQVK(SEQID NO:195) LaminCoil2B(chainA_helix1) Homo 1X8Y LARERDTSRRLLAE Parallel Homo LaminCoil2B(chainB_helix1) dimer KEREMA sapiens (SEQIDNO:196) EDSLARERDTSRRL LAEKER (SEQIDNO:197) Max(chainA_helix1) Homo 1R05 DSFHSLRD(SEQID Parallel Homo Max(chainB_helix1) dimer NO:198) sapiens IQYMRRKV(SEQID NO:199) Max(chainA_helix1) Homo 1R05 RALEGSGC(SEQID Parallel Homo Max(chainB_helix1) dimer NO:200) sapiens VRALEGSG(SEQID NO:201) MyosinX(chainA_helix2) Homo 5HMO KQVEEILR(SEQID Parallel Bostaurus MyosinX(chainC_helix3) dimer NO:202) LQQLRDEE(SEQID NO:203) MyosinX(chainA_helix3) Homo 5HMO LQKLQQLRD(SEQ Parallel Bostaurus MyosinX(chainC_helix2) dimer IDNO:204) EILRLEKEI(SEQID NO:205) NEMO(chainA_helix1) Homo 4OWF LRQQLQQA(SEQID Parallel Mus NEMO(chainB_helix1) dimer NO:206) musculus EDLRQQLQ(SEQID NO:207) NEMO(chainA_helix3) Homo 4OWF QEQLEQLQREF Parallel Mus NEMO(chainB_helix3) dimer (SEQIDNO:208) musculus LQEQLEQLQRE (SEQIDNO:209) Nsp3(chainA_helix1) Homo 1LJ2 LQVYNNKLE(SEQ Parallel Simian Nsp3(chainB_helix3) dimer IDNO:210) rotavirus ELQVYNNKL(SEQ A/SA11 IDNO:211) Nsp3(chainA_helix1) Homo 1LJ2 NKIGSLTS(SEQID Parallel Simian Nsp3(chainB_helix3) dimer NO:212) rotavirus AFDDLESV(SEQID A/SA12 NO:213) p53LZ2(chainA_helix) Homo 4OWI ELEVARLKKL(SEQ Parallel Synthetic p53LZ2(chainB_helix) dimer IDNO:214) construct LELEVARLKK(SEQ IDNO:215) Pkg1-Alpha(chainA_helix) Homo 4R4M LKRKLHKLQ(SEQ Parallel Homo Pkg1-Alpha(chainB_helix) dimer IDNO:216) sapiens ELKRKLHKL(SEQ IDNO:217) Pkg1-Beta(chainA_helix) Homo 3NMD DELELELDQKDELI Parallel Homo Pkg1-Beta(chainB_helix) dimer QLQNEL sapiens (SEQIDNO:218) IDELELELDQKDELI QLQNE (SEQIDNO:219) Put3(chainA_helix) Homo 1AJY LQQLQKDL(SEQID Parallel Saccharomyces Put3(chainB_helix) dimer NO:220) cerevisiae KYLQQLQK(SEQID NO:221) Qua1(chainA_helix2) Homo 4DNN LDEEISRVRKD(SEQ Parallel Mus Qua1(chainB_helix2) dimer IDNO:222) musculus ERLLDEEISRV(SEQ IDNO:223) Sgt2(chainA_helix2) Homo 3ZDM GADSLNVAMDCISE Parallel Saccharomyces Sgt2(chainB_helix1) tetramer A cerevisiae (SEQIDNO:224) ASKEEIAALIVNYFS (SEQIDNO:225) TarH(chainA_helix1) Homo 1VLT LRQQQSEL(SEQID Parallel Salmonella TarH(chainB_helix1) dimer NO:226) enterica ISNELRQQ(SEQID serovar NO:227) Typhimurium Ylan(chainA_helix1) Homo 2ODM EVLDTQFGLQKEV Parallel Staphylococcus Ylan(chainB_helix1) dimer DFAVK aureus (SEQIDNO:228) subsp.aureus LYEEVLDTQFGLQ MW2 KEVDF (SEQIDNO:229) AMSH(chainB_helix1) Hetero 2XZE KAEELKAE(SEQID Parallel Homo CHAMP3(chainR_helix1) dimer NO:230) sapiens SRLATLRS(SEQID NO:231) ATF4(chainA_helix1) Hetero 1CI6 LEKKNEALKERA Parallel Mus C/EBPbeta(chainB_helix1) dimer (SEQIDNO:232) musculus ERLQKKVEQLSR (SEQIDNO:233) c-Fos(chainA_helix1) Hetero 2WT7 LEDEKSALQ(SEQ Parallel Mus MafB(chainB_helix1) dimer IDNO:234) musculus QLIQQVEQL(SEQ IDNO:235) c-Jun(chainF_helix2) Hetero 1FOS LKAQNSEL(SEQID Parallel Homo c-Fos(chainE_helix2) dimer NO:236) sapiens EDEKSALQ(SEQID NO:237) c-Jun(chainF_helix2) Hetero 1FOS VAQLKQKV(SEQ Parallel Homo c-Fos(chainE_helix2) dimer IDNO:238) sapiens EKLEFILA(SEQID NO:239) DP1(chainA_helix1) Hetero 2AZE AQECQNLE(SEQID Parallel Homo E2F1(chainB_helix1) dimer NO:240) sapiens RLEGLTQD(SEQID NO:241) E47(chainA_helix1) Hetero 2QL2 LILQQAVQVI(SEQ Parallel Mus NeuroD1(chainB_helix1) dimer IDNO:242) musculus KIETLRLAKN(SEQ IDNO:243) ErbB2(chainA_loop1) Hetero 2KS1 GCPAEQRA(SEQID Parallel Homo ErbB1(chainB_loop1) dimer NO:244) sapiens TNGPKIPS(SEQID NO:245) GBR1(chainA_helix1) Hetero 4PAS EERVSELRHQLQ Parallel Homo GBR2(chainB_helix1) dimer (SEQIDNO:246) sapiens LDKDLEEVTMQL (SEQIDNO:247) Lin-7(chainA_helix3) Hetero 1ZL8 REVYETVY(SEQID Parallel Caenorhabditis Lin-2(chainB_helix3) dimer NO:248) elegans THDVVAHE(SEQID Homo NO:249) sapiens Med7(chainA_helix3) Hetero 1YKH LLEEQLEY(SEQID Parallel Saccharomyces Srb7(chainB_helix3) dimer NO:250) cerevisiae QKKLVEVE(SEQID NO:251) Myc(chainA_helix1) Hetero 1NKP LRKRREQL(SEQID Parallel Homo Max(chainB_helix1) dimer NO:252) sapiens KRQNALLE(SEQID NO:253) SCL(chainA_helix2) Hetero 2YPB LSKNEILR(SEQID Parallel Homo E47(chainB_helix2) dimer NO:254) sapiens KLLILQQA(SEQID NO:255) Ala-14(chainA_helix) Homo 1JCD ARANQRAD(SEQID Parallel Escherichia Ala-14(chainB_helix) trimer NO:256) coli AARANQRA(SEQID NO:257) C/EBP(chainA_helix1) Homo 1NWQ VLELTSDN(SEQID Parallel Rattus C/EBP(chainB_helix1) dimer NO:258) norvegicus KVLELTSD(SEQID NO:259) C/EBP(chainA_helix2) Homo 1NWQ QLSRELDT(SEQID Parallel Rattus C/EBP(chainB_helix2) dimer NO:260) norvegicus EQLSRELD(SEQID NO:261) c-Jun(chainA_helix) Homo 1JUN KAQNSELAST(SEQ Parallel Homo c-Jun(chainB_helix) dimer IDNO:262) sapiens LKAQNSELAS(SEQ IDNO:263) EB1(chainA_helix1) Homo 3GJO KLTVEDLE(SEQID Parallel Homo EB1(chainB_helix1) dimer NO:264) sapiens LKLTVEDL(SEQID NO:265) EB1(chainA_helix2) Homo 3GJO LQRIVDIL(SEQID Parallel Homo EB1(chainB_helix2) dimer NO:266) sapiens VLQRIVDI(SEQID NO:267) Geminin(chainA_helix1) Homo 1T6F EALKENEKLHK Parallel Homo Geminin(chainB_helix1) dimer (SEQIDNO:268) sapiens LYEALKENEKL (SEQIDNO:269) Phe-14(chainA_helix) Homo 2GUV KDDFARFNQR(SEQ Parallel Escherichia Phe-14(chainB_helix) pentamer IDNO:270) coli FNAFRSDFQA(SEQ IDNO:271) VBP(chainA_helix) Homo 4U5T EIRAAFLE(SEQID Parallel Homo VBP(chainB_helix) dimer NO:272) sapiens LEIRAAFL(SEQID NO:273)
TABLE-US-00005 TABLE5 Syntheticpeptidesusedinthisstudy Peptide name Sequence PTD1 ELDKAGFIKRQL(SEQIDNO:14) PTD2 LEERGVKDRQLQ(SEQIDNO:15) PTD3 LEILRAKDLALE(SEQIDNO:16) PTD4 LEQIKIRLF(SEQIDNO:17) PTD5 LSGLNEQRTQ(SEQIDNO:18) PTD6 YDVDAIVPQC(SEQIDNO:19) PTD7 CLTYDSHYLQ(SEQIDNO:20) PTD8 LVAHVTSRKC(SEQIDNO:21) PTD9 EYRLYLRALC(SEQIDNO:22) PTD10 IEIVRKKPIFC(SEQIDNO:24) PTD11 CEDRLQSYDLD(SEQIDNO:25) PTD12 EKLYLYYLQC(SEQIDNO:27) PTD13 LEQIKIRLFGSGSHHHHHH(SEQIDNO:28) PTD14 LLQVDVILLCYPENLEQIKIRLFGSGSHHHHHH(SEQID NO:11) PTD15 LSRAYLSYEGSGSHHHHHH(SEQIDNO:29) PTD16 EYRLYLRALCYPENLSRAYLSYEGSGSHHHHHH(SEQID NO:30) PTD17 EDRLQSYDLDGSGSHHHHHH(SEQIDNO:13) PTD18 DLDYAQLRDKCYPENEDRLQSYDLDGSGSHHHHHH(SEQ IDNO:31) PTD19 GKPIPNPLLGLDST(SEQIDNO:32) PTD20 GSGSHHHHHH(SEQIDNO:289) PTD21 ELDKAGFIKRQLC(SEQIDNO:33) PTD22 LLQVDVILLHHHHHHLEQIKIRLF(SEQIDNO:34) PTD23 CFFDSLVKQ(SEQIDNO:35)
Example 2
Materials and Methods
[0090] Synthetic peptides were purchased from Peptide 2.0 and are listed in Table 6. Synthetic DNA fragments are listed in Table 7. E. coli strain DH10B T1 [Thermo Fisher Scientific, catalog #12331013] was used as a cloning host. E. coli strain BL21 Star (DE3) [Thermo Fisher Scientific, catalog #C601003] was used for the production of the recombinant proteins.
TABLE-US-00006 TABLE6 Peptide(PTD) Number PeptideName Sequence(NtoC) PTD6 Sp-C9_836-841 YDVDAIVPQC PTD7 Sp-C9_CAA836-841AP CLTYDSHYLQ PTD8 Ec-AP_159-168 LVAHVTSRKC PTD10 Hs-PDGF-B_136-145 IEIVRKKPIFC PTD12 Sp-C9_CAA813-821 EKLYLYYLQC PTD13 Sp-C9_CAA813- LEQIKIRLFGSGSHHHHHH 821APH PTD14 Sp-C9_CAA813- LLQVDVILLCYPENLEQIKIRLFGSGSHHHHHH 821PAPH PTD15 Ec-AP_CAA159- LSRAYLSYEGSGSHHHHHH 168APH PTD16 Ec-AP_CAA159- EYRLYLRALCYPENLSRAYLSYEGSGSHHHHHH 168PAPH PTD17 Hs-PDGF-B_CAA136- EDRLQSYDLDGSGSHHHHHH 145APH PTD18 Hs-PDGF-B_CAA136- DLDYAQLRDKCYPENEDRLQSYDLDGSGSHHHHHH 145PAPH PTD20 2GS6H GSGSHHHHHH PTD23 Hs-Bace1_Helix CFFDSLVKQ PTD24 Hs-Brca1-Brct_51-64 LKYFLGIAC PTD25 Hs-CCA10_51-58 NFIQLCLEC PTD26 Hs-PDGDR_109-116 EITEITIPC PTD27 Hs-Hsp90_44-51 FLRELISNC PTD28 Hs-EstrogenR_50-57 LTNLADREC PTD29 Hs-Xiap_30-37 MVQEAIRMC PTD32 Hs-Renin_115-122 LPFMLAEFC
TABLE-US-00007 TABLE7 Name Sequence(5to3) 92_6HNLS CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC CTGCTGAGCGTTGAAGTTCAGCAGCTGTAAGGATCCGAAAAAGAAACGCAAA GTCCTCGAGCACCACCACCACCACCACTGAGATCCGGCT 93_6HNLS CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC TTAGAGCAGATTAAAATCCGTCTGTTTTAAGGATCCGAAAAAGAAACGCAAA GTCCTCGAGCACCACCACCACCACCACTGAGATCCGGCT Sp-C9_813-821_ AGCGTTGAAGTTCAGCAGCTGTGCTATCCGGAAAACCTCGAATACCTGTTTAT CAA TGAAAAATTAAGATCTGAAGCCGAAGGCAACGGCACTATAGACTTCGAGCTC CTGTTACAGGTGGATGTGATTCTGCTCAAAACCGGTGAAGTCAACAACTTAG AGCAGATTAAAATCCGTCTGTTTAGATCTGTGAAACAAAGCACTATT Anti-Bace1 CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC AAAAAAGAACGTGAACAGCTGCTGAAAACCGGTGAAGTCAACAACCTGAAA TATGAACGTATTCAAGAGAGATCTGTG Anti-Brca1 CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC GAACTGGCCAAAGAATGTGATCGTTGCTATCCGGAAAACAGCATTGCAGAAG AAGTGAAAGAAAGATCTGTG Anti-Xiap CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC CATTATGAACTGCGTCAGGCACATTGCTATCCGGAAAACCATGAAGATAGCC TGCTGATTCATAGATCTGTG Anti-Hsp90 CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC AAAGAAGAACTGGAACAGCGTATCTGCTATCCGGAAAACGTCAAAGATGAA CTGAGCCGTGAAAGATCTGTG Anti-EstR CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC GAAAGCCAAGAACGTAAAGCACTGTGCTATCCGGAAAACCTGTTAATTAGCG AAGTTGCCGAAAGATCTGTG Anti-PDGFR CCCTCTAGAATAGAAGGAGATTTAAATGCACCATCACCACCATCACGAGCTC CTGGATGCACTGGATCTGGATGGTAAAACCGGTGAAGTCAACAACCGTATTA GCGATCTGAGCATTCTGAGATCTGTG Spy-Cas9_1 ccctctagaatagaaggagatttaaatggataagaaatacagcattggtttggacattggtacgaatagcgttggttgggcagtcat taccgacgagtacaaggtgccgagcaagaagtttaaagtattgggtaacacggaccgtcacagcattaagaaaaacctgattgg tgcactgctgtttgacagcggtgaaactgcagaggcgactcgcctgaagcgtaccgcgcgtcgccgctatactcgtcgtaaaaa ccgtatctgctatctgcaggagatctttagcaacgagatggcgaaggttgatgacagcttctttcaccgtctggaagaaagcttcct ggtcgaagaggacaaaaagcacgagcgccatccgatcttcggcaacattgtggacgaagtggcttatcatgaaaagtatccga ccatttatcatctgcgtaagaagctggttgatagcaccgataaagcggatctgcgtctgatttacctggcactggcccacatgatca agtttcgcggccactttctgatcgagggtgatctgaatccggacaatagcgacgttgacaagctgttcatccaactggtccaaacg tacaaccagctgttcgaagaaaacccgatcaacgcgagcggtgtggatgcaaaagctattctgagcgcgcgtctgagcaagag ccgtcgtttggagaatctgatcgcgcaattgccgggtgagaagaaaaatggcctgttcggtaatctgattgcactgtccctgggcc tgacgccgaacttcaaaagcaattttgatctggcagaagatgcgaagctgcaactgagcaaagatacttatgatgacgacctgga caatctgttggcacaaatcggtgaccagtatgcagatctgtttctggcggcaaagaacctgtccgatgcgatcctgctgagcgac attctgcgcgtgaacacggaaattaccaaggctccgctgagcgcgagcatgattaagcgttac Spy-Cas9_2 ccgctgagcgcgagcatgattaagcgttacgatgagcaccaccaggatctgaccctgctgaaggcgctggtccgtcagcaact gccggaaaagtacaaagagattttctttgaccagagcaagaatggctacgcgggctatatcgatggtggcgctagccaagaag agttctacaagtttatcaagccgattttggagaaaatggatggtaccgaagagttgctggttaaactgaatcgtgaagatctgctgc gtaagcaacgcacctttgataatggcagcattccgcatcaaattcacctgggtgagttgcatgctatcctgcgccgtcaagaggat ttctacccgtttctgaaagacaaccgtgagaagatcgagaaaattctgactttccgcatcccgtattacgtcggtccgctggcgcgt ggtaacagccgtttcgcatggatgacccgtaagagcgaagaaaccatcaccccatggaacttcgaagaggttgtggataaggg tgcatccgcgcaaagcttcatcgagcgtatgacgaattttgacaagaatctgccgaatgaaaaagtgctgccgaagcacagcct gctgtacgaatactttaccgtctataacgagctgaccaaagtcaaatacgtcaccgagggtatgcgtaaaccggcgttcctgagc ggcgagcagaagaaggcgattgtcgatctgctgttcaaaacgaatcgtaaagttacggttaagcaactgaaagaggactacttc aagaaaattgaatgtttcgactctgtcgagattagcggtgttgaagatcgcttcaatgcgagcttgggtacctatcatgatctgctga agatcatcaaagacaaagatttcctggataatgaagagaacgaggacattctggaagatatcgttttgacgctgaccttgttcgaa gatcgtgagatgatcgaagaacgcctgaaaacgtatgcgcacctgtttgatgataaagtgatgaaacaactgaagcgtcgccgtt ataccggtt Spy-Cas9_3 aacaactgaagcgtcgccgttataccggttggggtcgtctgagccgtaagctgatcaacggcattcgtgataaacagtccggtaa gacgatcctggattttctgaaaagcgacggcttcgcaaaccgtaatttcatgcagctgattcacgacgacagcttgaccttcaaag aggacatccagaaagcacaagttagcggtcaaggcgatagcctgcatgagcacattgcaaatttggcgggtagcccagcgatc aagaagggtattctgcagaccgttaaagtggttgatgaactggtgaaagttatgggccgtcacaagcctgaaaacatcgtcattg agatggcgcgtgaaaatcagaccacgcaaaagggccagaagaatagccgtgaacgcatgaaacgtatcgaagagggcatta aagaactgggctcccaaatcctgaaagagcatccggtggagaatactcaactgcagaatgaaaagctgtacctgtactatctgca aaacggtcgcgatatgtacgtcgaccaggagctggacatcaaccgcctgtccgactatgacgttgatcacattgtcccgcagag cttcctgaaagatgacagcatcgacaacaaggtcctgacccgtagcgataagaatcgcggtaaaagcgataacgtgccaagcg aagaagtggtgaagaagatgaaaaactattggcgtcaactgttgaacgctaaattgattacgcaacgtaagttcgacaacctgac caaggcggaacgtggtggcctgagcgaactggacaaagcgggtttcatcaagcgccaactggtggaaacccgtcagattacg aaacatgtcgcccaaattctggacagccgtatgaacacgaagtacgatgaaaacgataaactgattcgtgaagtcaaagttatca cgctgaaaagcaagctggtgagcgacttccgtaaggattttcagttttacaaagtccgtgaaatcaacaactaccaccatgcgca cgatgcctatctgaacgctgt Spy-Cas9_5 ccatgcgcacgatgcctatctgaacgctgtggtgggtaccgcgctgattaagaagtatccgaaactggaaagcgagttcgtgtac ggtgattacaaggtttacgatgttcgtaagatgatcgcgaagtccgaacaagaaatcggcaaagcgaccgctaagtatttcttttac tccaacattatgaactttttcaaaaccgagatcaccctggcaaacggtgagatccgcaaacgtccgctgatcgagactaatggcg agactggcgaaatcgtgtgggacaaaggtcgtgacttcgccaccgtccgtaaggtattgagcatgccgcaagtcaatattgttaa gaaaaccgaagttcaaaccggtggtttcagcaaagagagcattctgcctaagcgcaactccgacaaactgattgcccgtaagaa ggattgggacccgaaaaagtatggcggtttcgatagcccaactgtggcatacagcgtgctggtggttgccaaagtggagaaag gtaagtccaagaagctgaaatctgtcaaagagctgctgggcatcaccattatggagcgcagcagctttgagaaaaatccaatcg acttcctggaagcgaagggctacaaagaggtcaagaaagacctgatcatcaagttgccaaagtacagcctgttcgagctggag aatggtcgtaagcgcatgctggcctctgccggtgaactgcaaaagggtaacgaactggcgctgccgtcgaaatacgttaactttc tgtacctggcatcccactacgagaaactgaaaggcagccctgaagataacgagcaaaaacaactgtttgttgagcagcacaaac actatctggatgagatcattgaacagattagcgaattcagcaagcgtgtgatcctggcggacgcgaacctggacaaagtcctgtc cgcgtacaataaacatcgcgacaaaccgattcgtgagcaggcggaaaacattatccacctgtttaccctgacgaatctgggtgcc cctgcggcgtttaagtactttgacactactatcgatcgtaaacgttatacgagcaccaaagaggttctggatgcgaccctgattcac cagagcattaccggcctgtatgaaacgcgtatcgacctgagccaattgggtggtgaccgctctcgtgcagatccgaaaaagaaa cgcaaagtcgatccgaagaagaagcgcaaggtggacccgaagaaaaagcgtaaagtcggctctaccggtagccgtggctct ggttcgTAActcgagcaccaccaccaccaccactga
Construction of Vectors
[0091] The bacterial expression vector, pET-21b, was obtained from EMD Millipore (catalog #69741-3). The pET-21b vector was digested with SwaI/XhoI, and assembled with a linear 143 bp synthetic DNA fragment, 92_6HNLS or 93_6HNLS, using a seamless DNA assembly method following the manufacturer's protocol [Thermo Fisher Scientific, GeneArt Seamless Cloning and Assembly Enzyme Mix, catalog #A14606] to produce vector pC9-813-92 and vector pC9-813-93, respectively. The pC9-813-92 and pC9-813-93 vectors were digested with BamHI, and assembled with a PCR-amplified 1501 bp DNA fragment 92P [primer set: AGCGTTGAAGTTCAGCAGCTGAGATCTGTGAAACAAAGCACTATTG (CH1424) and GGACTTTGCGTTTCTTTTTCGGATCCGCAGATGAACCGTGATGGTGATGGTGATG GCTAGAGCCGGAAGCTTTCAGCCCCAGAGCGGCTTTC (CH1425ART-R)] or 93P [primer set: CAGATTAAAATCCGTCTGTTTAGATCTGTGAAACAAAGCACTATTG (CH1425) and GGACTTTGCGTTTCTTTTTCGGATCCGCAGATGAACCGTGATGGTGATGGTGATG GCTAGAGCCGGAAGCTTTCAGCCCCAGAGCGGCTTTC (CH1425ART-R)] from the E. coli MG1655 genome, corresponding to the E. coli alkaline phosphatase (AP) fusion, to generate pC9-813-92P and pC9-813-93P, respectively. The pC9-813-92P vector was digested with BglII, assembled with a 204 bp synthetic DNA fragment Sp-C9_813-821_CAA, corresponding to the CCAAP box tetramer recombinant antibody (rAb) against Cas9, to generate vector pC9-813-CAA4. The pC9-813-CAA4 vector was digested with BglII, and self-ligated to remove 117 bp DNA fragment encoding two CCAAP boxes, producing pC9-813-CAA2 which corresponds to the CCAAP box dimer antibody used to detect Cas9. To introduce two mutations, D153G and D330N, into the E. coli AP protein, we PCR-amplified three DNA fragments, P957-1 [primer set: GAATACCTGTTTATTGAAAAATTAAGATCCGGTGGTGGAGGATCAGGATCCGGT GGTGGAGGATCAGGATCTGTGAAACAAAGCACTATTG (CH1483ART-F) and CAGCGCAGCGGGCGTGGCACCCTGCAACTCTGCGGTAG (CH1486)], P957-2 [primer set: CTACCGCAGAGTTGCAGGGTGCCACGCCCGCTGCGCTG (CH1487) and CAAGGATTCGCAGCATGATTCTGTTTATCGATTGACGCAC (CH1492)], and P957-3 [primer set: GTGCGTCAATCGATAAACAGAATCATGCTGCGAATCCTTG (CH1493) and GTGCTCGAGTTTCAGCCCCAGAGCGGCTTTCATG (CH1494)] and assembled to produce a 1,473-bp DNA fragment corresponding to the mutant AP (or P957). This PCR product was digested with BamHI and XhoI, and ligated into BglII/XhoI digested pC9-813-CAA2, to generate p813C2-P957 dB. For the production of the recombinant antibodies (rAbs), two synthetic DNA fragments, Anti-Bace1 (130 bp) and Anti-PDGFR (130 bp) (Table 7), were digested with SwaI/BglII and ligated into the same enzyme site of the pC9-813-CAA2, to generate pAnti-Bace1-P and pAnti-PDGFR-P, respectively. Four synthetic DNA fragments, Anti-Brca1 (124 bp), Anti-Hsp90 (124 bp), Anti-EstR (124 bp), and Anti-Xiap (124 bp) (Table 7), were digested with SwaI/BglII and ligated into the SwaI/BamHI sites of the p813C2-P957 dB, to generate pAnti-Brca1-P957, pAnti-Hsp90-P957, pAnti-EstR-P957, and pAnti-Xiap-P957, respectively. To produce the recombinant Cas9 protein, pET-Spy-Cas9_d6H vectors were constructed by assembling five parts with overlapping DNA ends using the seamless DNA assembly kit. Briefly, four insert parts [a 1000 bp Spy-Cas9_1, a 1030 bp Spy-Cas9_2, a 1030 bp Spy-Cas9_3, and a 1303 bp Spy-Cas9_5, corresponding to the tagless Cas9] (Table 7) and the SwaI/XhoI-digested pET-21b were assembled, to create pET-Spy-Cas9_d6H.
Protein Production and Purification
[0092] For recombinant protein production, BL21 Star (DE3) cells harboring an expression vector were grown to mid-log phase (optical density at 600 nm [OD600] of 0.6) in LB medium [ampicillin (Amp), 100 g/ml] at 28 C. and induced with 1 mM IPTG (isopropyl--D-thiogalactopyranoside) for 5 h. Cells were harvested by centrifugation at 3000g for 10 min. Harvested cells were disrupted using a chemical lysis method following the manufacturer's protocol [Thermo Fisher Scientific, BPER Complete Bacterial Protein Extraction Reagent, catalog #89821]. Cell debris and insoluble proteins in the lysate were separated by centrifugation at 16,000g for 5 minutes. His-tagged recombinant proteins were purified via metal-affinity chromatography using Dynabeads His-Tag Isolation and Pulldown beads following the manufacturer's protocol [Thermo Fisher Scientific, catalog #10103D]. Recombinant Cas9 proteins were purified using the HiTrap Heparin HP column [GE Healthcare, catalog #17-0406-01] as previously described (Karvelis et al. 2015).
Dot Blot and Western Blot Analyses
[0093] For dot blot analysis, 2 l (5 g) of samples were spotted onto a nitrocellulose (NC) membrane and dried completely. Then, non-specific sites were blocked by soaking the membrane in blocking solution [Thermo Fisher Scientific, WesternBreeze Blocker/Diluent (Part A and B), catalog #WB7050] for lhr at room temperature (or up to 72 hr at 4 C.). The membrane was washed twice with water (1 ml per cm2 of membrane), and incubated with the 1.sup.st antibody (Ab) in a binding/wash (BW) buffer [50 mM sodium phosphate, pH 8.0, 300 mM NaCl, and 0.01% Tween 20] for 1 hr at room temperature. The membrane was washed 4 times (2 minutes per wash) with wash buffer [Thermo Fisher Scientific, WesternBreeze Wash Solution, catalog #WB7003]. If the 1.sup.st Ab was Anti-Cas9 Ab-HRP conjugate [Thermo Fisher Scientific, catalog #MAC133P] or the peptide-AP fusions (2.sup.nd Ab not required), the membrane was washed twice with water, and incubated with a chromogenic substrate: Chromogenic Substrate (TMB) [Thermo Fisher Scientific, catalog #WP20004] for HRP and NBT/BCIP substrate solution for AP [Thermo Fisher Scientific, catalog #34042]. Otherwise, the membrane was incubated with 2.sup.nd Ab in the blocking solution for 1 hr. To detect His-tagged peptide and proteins, the Anti-6His Ab-HRP conjugate [Thermo Fisher Scientific, catalog #46-0707] was used as 2.sup.nd Ab. Then the membrane was washed four times with the wash buffer and two times with water. Finally, the blot was incubated with the chromogenic substrates. For the western blot analysis, the protein samples were resolved in 4-20% gradient SDS-PAGE gel, transferred to an NC membrane, and analyzed using the same method for the dot blot analysis [note: we have obtained the best result with a long blocking time (72 hr at 4 C.)].
Digital Image Processing and Analysis
[0094] For the image processing, we used Adobe Photoshop 7.0. Quantitative image analysis of the digital images was carried out using measuring tools of imaging software ImageJ (Schneider et al. 2012). Image analysis results were calculated by averaging data from three independent experiments.
Statistical Analysis
[0095] Statistical analyses were performed using a one-way analysis of variance (ANOVA) and confirmed by Student's t-test [two tails, two-sample equal variance (homoscedastic)]. p values<0.05 considered statistically significant, and scored with five different levels: .diamond-solid., p<0.05; .diamond-solid. .diamond-solid., p<0.01; .diamond-solid. .diamond-solid. .diamond-solid., p<0.001; .diamond-solid. .diamond-solid. .diamond-solid. .diamond-solid., p<0.0001; and; .diamond-solid. .diamond-solid. .diamond-solid. .diamond-solid. .diamond-solid., p<0.00001. All graphs display meanSD.
Results and Discussion
Physicochemical and Stereochemical Features of the Complementary Amino Acid Pairing (CAAP)
[0096] In the present study, we demonstrate that the pairing between two amino acids encoded by a codon and the reverse complementary codon (c-codon) is favored in PPI. We name this pairing the Complementary Amino Acid Pairing (CAAP). We summarize all possible CAAPs in
The CAAP Interactions are Clustered in all PPI Sites
[0097] To address the CAAP hypothesis for PPI, we first focused on finding the CAAP interactions in the PPI structure database from the Protein Data Bank (PDB). We examined the well-known leucine zipper proteins: Saccharomyces cerevisiae GCN4/GCN4 homodimer [PDB_2ZTA], Mus musculus NF-k-B essential modulator (NEMO) homodimer [PDB_4OWF], and Homo sapiens c-Jun/c-Fos heterodimer [PDB_1FOS], and Rattus norvegicus C/EBPA homodimer [PDB_1NWQ] (
[0098] We also investigated 75 additional PPI structures for CCAAP interactions (Table 8). A total of 84 protein structures were selected for their relatively simple PPI structures, which limit the effect of any other potential parameters. Protein structures were also categorized according to parallel or antiparallel alignment. We found CCAAP boxes in all PPI sites in the 82 structure data from PDB (Table 8). However, we could not find any CCAAP box from PPI sites of two dimers: Homo sapiens ERBB2-EGFR heterodimer [PDB_2KS1] and Bos taurus If1 homodimer [PDB_1GMJ]. Interestingly, the PPI sites of these two dimers have a high content of either charged amino acids [PDB_2KS1] or hydrophobic amino acids [PDB_1GMJ]. We found 79 CCAAP boxes in the parallel () interactions (76 helix/helix, 2 -sheet/coil, and 1 -sheet/-sheet interactions) and 81 CCAAP boxes in antiparallel () interactions (67 helix/helix and 14 -sheet/-sheet interactions) (Table 8). Notably, 93% of the -sheet/-sheet interactions are antiparallel interactions.
TABLE-US-00008 TABLE8 Protein Inter- PDB Pairing (chain_structure) action ID CCAAPBox.sup.a Orientation Source CD2(chainA_beta Homodimer 1A6P TYNVT Antiparallel Rattus sheet5) GREWR norvegicus CD2(chainB_beta sheet1) HDAg(chain Homo 1A92 LEELERDLRKLK Antiparallel Hepatitisdelta A_helix1) octamer KLKRLDRELEEL virus HDAg(chain B_helix1) Put3(chain Homodimer 1AJY LEPSKKIVVSTKYLQQLQ Parallel Saccharomyces A_helix)Put3 EPSKKIVVSTKYLQQLQK cerevisiae (chainB_helix) CytochromeC Homodimer 1BBH LSPEEQIE Antiparallel Allochromatium (chainA_helix1) KGMNWGMF vinosum CytochromeC (chainB_helix1) TAF(II)-18(chain Heterodimer 1BH8 LFSKELRC Antiparallel Homosapiens A_helix1) EYRNLQEE TAF(II)-28(chain B_helix1) TAF(II)-18(chain Heterodimer 1BH8 LEDLVIEFITEMTH Antiparallel Homosapiens A_helix2) EVVEGVFVKSIGSM TAF(II)-28(chain B_helix3) ATF4(chain Heterodimer 1CI6 LTGECKELEK Parallel Musmusculus A_helix1) ETQHKVLELT C/EBPbeta(chain B_helix1) ATF4(chain Heterodimer 1CI6 LKERADSL Parallel Musmusculus A_helix1) RLQKKVEQ C/EBPbeta(chain B_helix1) ATF4(chain Heterodimer 1CI6 QYLKDLIE Parallel Musmusculus A_helix1) LSTLRNLF C/EBPbeta(chain B_helix1) c-Jun(chain Heterodimer 1FOS KLERIARLE Parallel Homosapiens F_helix2) RELTDTLQA c-Fos(chain E_helix2) c-Jun(chain Heterodimer 1FOS LKAQNSEL Parallel Homosapiens F_helix2)c-Fos EDEKSALQ (chainE_helix2) c-Jun(chain Heterodimer 1FOS VAQLKQKV Parallel Homosapiens F_helix2) EKLEFILA c-Fos(chain E_helix2) Domain-Swapped Homodimer 1G6U PEELAALESE Antiparallel Domain- (chainA_helix2) GKLAQLKSKL Swapped Domain-Swapped (chainB_helix2) Domain-Swapped Homodimer 1G6U LEKKLAAL Antiparallel Domain- (chainA_helix2) KKELAQLE Swapped Domain-Swapped (chainB_helix2) Gal4(chain Homodimer 1HBW RLERLEQL Parallel Saccharomyces A_helix1) SRLERLEQ cerevisiae Gal4(chain B_helix1) HumanLectin Homodimer 1HLC SSFKL Antiparallel Homosapiens (chainA_betasheet KLKFS 13) HumanLectin (chainB_betasheet 13) Ala-14(chain Homotrimer 1JCD ARANQRAD Parallel Escherichiacoli A_helix) AARANQRA Ala-14(chain B_helix) c-Jun(chain Homodimer 1JUN KAQNSELAST Parallel Homosapiens A_helix) LKAQNSELAS c-Jun(chain B_helix) Nsp3(chain Homodimer 1LJ2 MHSLQNVI Parallel Simianrotavirus A_helix1) HSLQNVIP A/SA11 Nsp3(chain B_helix1) Nsp3(chain Homodimer 1LJ2 ELQVYNNKLERDLQNKIGSLT Parallel Simianrotavirus A_helix1) LQVYNNKLERDLQNKIGSLTS A/SA12 Nsp3(chain B_helix1) Tpm1(chain Homodimer 1MV4 IDDLEDELYAQKL Parallel Rattus A_helix1) DDLEDELYAQKLK norvegicus Tpm1(chain B_helix1) Arc(chainA_coil) Homodimer 1MYL MPQFNLRW Antiparallel Bacteriophage Arc(chainB_coil) WRLNFQPM P22 Myc(chainA_helix Heterodimer 1NKP LRKRREQL Parallel Homosapiens 1) KRQNALLE Max(chainB_helix 1) C/EBPA(chain Homodimer 1NWQ KVLELTSD Parallel Rattus A_helix1) VLELTSDN norvegicus C/EBPA(chain B_helix1) C/EBPA(chain Homodimer 1NWQ EQLSRELD Parallel Rattus A_helix2) QLSRELDT norvegicus C/EBPA(chain B_helix2) Erabutoxin(chain Homodimer 1QKD LSCCE Antiparallel Laticauda A_betasheet5) ECCSL semifasciata Erabutoxin(chain B_betasheet5) Max(chainA_helix Homodimer 1R05 SFHSLRDS Parallel Homosapiens 1 DKATEYIQ Max(chainB_helix 2) Max(chainA_helix Homodimer 1R05 VHTLQQDIDDLK Parallel Homosapiens 2) HTLQQDIDDLKR Max(chainB_helix 2) Max(chainA_helix Homodimer 1R05 LEQQVRAL Parallel Homosapiens 2) EQQVRALE Max(chainB_helix 2) Geminin(chain Homodimer 1T6F DNEIARLK Parallel Homosapiens A_helix1) NEIARLKK Geminin(chain B_helix1) Endothelin-1(chain Homodimer 1T7H RCSCS Antiparallel Homosapiens A_betasheet) SCSCR Endothelin-1(chain B_betasheet) Cenp-b(chain Homodimer 1UFI GEAMAYFA Antiparallel Homosapiens A_helix1) AFYAMAEG Cenp-b(chain B_helix1) Cenp-b(chain Homodimer 1UFI FPIDDRVQ Antiparallel Homosapiens A_helix2) KRTVHVLD Cenp-b(chain B_helix2) PALS-1-L27N Heterodimer 1VF6 LQVLDRLK Antiparallel Homosapiens (chainA_helix1) SIDEQSQS Musmusculus PATJ-L27(chain B_helix2) TarH(chain Homodimer 1VLT ELTSTWDLMLQTRINLSRSAARM Parallel Salmonella A_helix1) MMDA entericaserovar TarH(chain LTSTWDLMLQTRINLSRSAARMM Typhimurium B_helix1) MDAS TarH(chain Homodimer 1VLT SELTSTWDLMGLAEGLANQM Antiparallel Salmonella A_helix1) entericaserovar TarH(chain Typhimurium B_helix4) Gemin6(chain Heterodimer 1Y95 LTTDPVSA Parallel Homosapiens A_betasheet3) ALRERYLR Gemin7(chain B_Helix1) Gemin6(chain Heterodimer 1Y95 SMSVTGI Antiparallel Homosapiens A_betasheet5) KFTYSII Gemin7(chain B_betasheet7) Med7(chain Heterodimer 1YKH LKSLLLNY Antiparallel Saccharomyces A_helix1) IQRTKLII cerevisiae Srb7(chainB_ helix2) Med7(chain Heterodimer 1YKH IHHLLNEY Parallel Saccharomyces A_helix2) ETMQDLCI cerevisiae Srb7(chainB_ helix1) Med7(chain Heterodimer 1YKH LEEQLEYK Parallel Saccharomyces A_helix3) MLQKKLVE cerevisiae Srb7(chainB_ helix3) Lin-7(chain Heterodimer 1ZL8 QRILELMEHVQ Antiparallel Caenorhabditis A_helix1) LIRKLEKADNN elegans Lin-2(chain Homosapiens B_helix2) Lin-7(chain Heterodimer 1ZL8 NNAKLASL Antiparallel Caenorhabditis A_helix2) ELVEKARQ elegans Lin-2(chain Homosapiens B_helix1) DSX(chain Homodimer 1ZV1 MPLMYVIL Antiparallel Drosophila A_helix3) SAEEINAD melanogaster DSX(chain B_helix2) cGMP-dependent Homodimer 1ZXA EIQELKRK Parallel Homosapiens proteinkinase IQELKRKL (chainA_helix) Usp8(chain Homodimer 2A9U SVPKELYL Parallel Homosapiens A_coil)Usp8 LDRDEERA (chainB_helix2) Usp8(chain Homodimer 2A9U RDEERAYVLYELYLSSSLKD Parallel Homosapiens A_helix2) Usp8(chain B_coil) DP1(chainA_helix Heterodimer 2AZE QNLEVERQ Parallel Homosapiens 1) LEGLTQDL E2F1(chain B_helix1) DP1(chainA_helix Heterodimer 2AZE IAFKNLVQ Parallel Homosapiens 1) LRLLSEDT E2F1(chain B_helix1) DP1(chainA_beta Heterodimer 2AZE FIIVN Antiparallel Homosapiens sheet1) KIVMV E2F1(chainB_beta sheet1) Beta-myosinS2 Homodimer 2FXO EFTRLKEALEKSEARRKEL Parallel Homosapiens (chainA_helix1) FTRLKEALEKSEARRKELE Beta-myosinS2 (chainB_helix1) Beta-myosinS2 Homodimer 2FXO LQEKNDLQL Parallel Homosapiens (chainA_helix2) QEKNDLQLQ Beta-myosinS2 (chainB_helix2) Beta-myosinS2 Homodimer 2FXO KLEDECSELKRDIDDLE Parallel Homosapiens (chainA_helix3) LEDECSELKRDIDDLEL Beta-myosinS2 (chainB_helix3) Phe-14(chain Homo 2GUV KDDFARFNQRFNAFRSDFQA Parallel Escherichiacoli A_helix) pentamer Phe-14(chain B_helix) ROM(chain Homodimer 2IJK ADEQADICE Antiparallel Escherichiacoli A_helix2) RALCSRYLE ROM(chain B_helix2) Hi0947(chain Homodimer 2JUZ LEKHKAPVDLS Antiparallel Haemophilus A_helix1-2) ELVAIMDNVIA influenzae Hi0947(chain B_helix1) Hi0947(chain Homodimer 2JUZ SLIALGNMA Antiparallel Haemophilus A_helix2) AMNGLAILS influenzae Hi0947(chain B_helix2) Hi0947(chain Homodimer 2JUZ EALAQAFSNSL Antiparallel Haemophilus A_helix3) LSNSFAQALAE influenzae Hi0947(chain B_helix3) Arenicin-2(chain Homodimer 2L8X CVYAY Parallel Arenicolamarina A_betasheet1) VYAYV (lugworm) Arenicin-2(chain B_betasheet1) Erbb4(chain Homodimer 2LCX ARTPLIAA Parallel Homosapiens A_helix1) RTPLIAAG Erbb4(chain B_helix1) FGFR3(chain Homodimer 2LZL AGSVYAGI Parallel Homosapiens A_helix1) EAGSVYAG FGFR3(chain B_helix1) Xcl1(chainA_beta Homodimer 2N54 CVSLT Antiparallel Homosapiens sheet1) TLSVC Xcl1(chainB_beta sheet1) Xcl1(chainA_beta Homodimer 2N54 TYTIT Antiparallel Homosapiens sheet2) TITYT Xcl1(chainB_beta sheet2) CXCL12(chain Homodimer 2NWG VKHLKILN Antiparallel Homosapiens A_betasheet1) NLIKLHKV CXCL12(chain B_betasheet1) CXCL12(chain Homodimer 2NWG IQEYLEKALNNLAKELYEQI Antiparallel Homosapiens A_helix1) CXCL12(chain B_helix1) Ylan(chain Homodimer 2ODM EVLDTQMFGLQKEVDFAVK Parallel Staphylococcus A_helix2) LYEEVLDTQMFGLQKEVDF aureussubsp. Ylan(chain aureusMW2 B_helix2) Ylan(chain Homodimer 2ODM QLTKDADE Antiparallel Staphylococcus A_helix1) LKVAFDVE aureussubsp. Ylan(chain aureusMW2 B_helix2) Hy5(chain Homodimer 2OQQ GSAYLSEL Parallel Arabidopsis A_helix)Hy5 SAYLSELE thaliana (chainB_helix) Hy5(chain Homodimer 2OQQ LENKNSEL Parallel Arabidopsis A_helix)Hy5 ENKNSELE thaliana (chainB_helix) Hy5(chain Homodimer 2OQQ LEERLSTL Parallel Arabidopsis A_helix)Hy5 EERLSTLQ thaliana (chainB_helix) E47(helix2) Heterodimer 2QL2 QVILGLEQ Parallel Musmusculus NeuroD1(helix2) KNYIWALS E47(chainA_helix Heterodimer 2QL2 EAFRELGR Parallel Musmusculus 1) LAKNYIWA NeuroD1(chain B_helix2) E47(chainA_helix Heterodimer 2QL2 ILQQAVQV Parallel Musmusculu 2) NAALDNLR NeuroD1(chain B_helix1) c-Fos(chain Heterodimer 2WT7 LEDEKSALQ Parallel Musmusculus A_helix1) QLIQQVEQL MafB(chain B_helix1) Bst2(chain Homodimer 2XG7 HKLQDASA Parallel Homosapiens A_helix1) KLQDASAE Bst2(chain B_helix1) CHMP3(chain Heterodimer 2XZE SRLATLRS Antiparallel Homosapiens R_helix1) SGLQSLAR STAMBP(chain B_helix3) SCL(chainA_helix Heterodimer 2YPB AFAELRKL Parallel Homosapiens 2) LILQQAVQ E47(chainB_helix 2) SCL(chainA_helix Heterodimer 2YPB NEILRLAMK Parallel Homosapiens 2) DINEAFREL E47(chainB_helix 2) GCN4(chain Homodimer 2ZTA QLEDKVEE Parallel Saccharomyces A_helix2) LEDKVEEL cerevisiae GCN4(chain B_helix2) GCN4(chain Homodimer 2ZTA LENEVARLKKENEVARLKKL Parallel Saccharomyces A_helix2) cerevisiae GCN4(chain B_helix2) HV1(chain Homodimer 3A2A LKQMNVQL Parallel Homosapiens A_helix1) KQMNVQLA HV1(chain B_helix1) Cce_0567(chain Homodimer 3CSX KVRKLNSK Antiparallel Cyanobacterium A_helix1) LTEEWINL Cyanothece Cce_0567(chain B_helix1) Cce_0567(chain Homodimer 3CSX LHDLAEGL Antiparallel Cyanobacterium A_helix1) ERFIEYTK Cyanothece Cce_0567(chain B_helix1) HP0062(chain Homodimer 3FX7 EVREFVGHLERF Antiparallel Helicobacter A_helix1) LNHFHNSLSNVE pylori HP0062(chain B_helix1) HP0062(chain Homodimer 3FX7 RDKFSEVLDNL Antiparallel Helicobacter A_helix2) AIQEQAAEDFE pylori HP0062(chain B_helix2) C.esp1396i(chain Homodimer 3G5G VVFFEMLIKEIEKILMEFFV Antiparallel Enterobactersp. A_helix5) RFL1396 C.esp1396i(chain B_helix5) MAPRE1(chain Homodimer 3GJO ELMQQVNVLKLTVEDL Parallel Homosapiens A_helix1) LMQQVNVLKLTVEDLE MAPRE1(chain B_helix1) MAPRE1(chain Homodimer 3GJO FGKLRNIE Parallel Homosapiens A_helix1) GKLRNIEL MAPRE1(chain B_helix1) Gld1(chain Homodimer 3K6T EYLADLVK Antiparallel Caenorhabditis A_helix1) LREVNSFM elegans Gld1(chain B_helix2) Rev(chainA_helix Homodimer 3LPH DEDSLKAVRLIKFLY Antiparallel HIVtype1 1) YLFKILRVAKLSDED (HXB3 Rev(chainB_helix ISOLATE) 1) MinE(chain Homodimer 3MCD LKLIL Antiparallel Helicobacter A_betasheet1) ALILK Pylori MinE(chain B_betasheet1) Pkg1-Beta(chain Homodimer 3NMD IDELELELDQKDELIQML Parallel Homosapiens A_helix) DELELELDQKDELIQMLQ Pkg1-Beta(chain B_helix) Swi5(chain Homo 3VIR QDALAKLKNRDAKQTV Antiparallel Schizo- A_helix) tetramer LAIDRIENYTHLLDIH saccharomyces Swi5(chain pombe B_helix) Swi5(chain Homo 3VIR KEQLESSLQDALAKLK Antiparallel Schizo- A_helix) tetramer KLKALADQLSSELQEK saccharomyces Swi5(chain pombe C_helix) Swi5(chain Homo 3VIR VQKHIDLLHTYNE Parallel Schizo- B_helix) tetramer HLLEQQKEQLESS saccharomyces Swi5(chain pombe C_helix) Hv1(chainA_helix Homodimer 3VMX LKQINIQL Parallel Musmusculus 1) KQINIQLA Hv1(chainB_helix 1) Sgt2(chainA_helix Homo 3ZDM EIAALIVNYF Antiparallel Saccharomyces 1) tetramer FYNVILAAIE cerevisiae Sgt2(chainB_helix 1) Sgt2(chainA_helix Homo 3ZDM ADSLNVAMDCISEAFG Parallel Saccharomyces 2) tetramer GFAESICDMAVNLSDA cerevisiae Sgt2(chainB_helix 1) Cc2-LZ(chain Homodimer 4BWN QLEDLKQQL Parallel Homosapiens A_helix1) LEDLKQQLQ Cc2-LZ(chain B_helix1) Cc2-LZ(chain Homodimer 4BWN ELLQEQLEQLQREYSKL Parallel Homosapiens A_helix2) LLQEQLEQLQREYSKLK Cc2-LZ(chain B_helix2) Qua1(chain Homodimer 4DNN TPDYLXQL Antiparallel Musmusculus A_helix2) RSIEEDLL Qua1(chain B_helix2) DD_Ribeta_PKA Homodimer 4F9K KFLREHFEKLLKEFHERLKK Antiparallel Homosapiens (chainA_helix3) DD_Ribeta_PKA (chainB_helix3) Trim25(chain Homodimer 4LTB SADLEATLRHKLTVMY Antiparallel Homosapiens A_helix1) DRKTLSQEIEEKLTQI Trim25(chain B_helix1) Trim25(chain Homodimer 4LTB LDDVRNRQ Antiparallel Homosapiens A_helix1) YITDFKSN Trim25(chain B_helix1) Trim25(chain Homodimer 4LTB LRHKLTVMYSQIN Parallel Homosapiens A_helix1) KASKLRGISTKPV Trim25(chain B_helix2) Trim25(chain Homodimer 4LTB VRNRQQDV Parallel Homosapiens A_helix1) HKLIKGIH Trim25(chain B_helix2) Trim25(chain Homodimer 4LTB RKVEQLQQEYTEM Parallel Homosapiens A_helix1) LKNELKQCIGRLQ Trim25(chain B_helix2) Trim25(chain Homodimer 4LTB KNELKQCIGRGICQKLENKL Antiparallel Homosapiens A_helix2) Trim25(chain B_helix2) Mst1(chain Heterodimer 4OH8 LQKRLLAL Antiparallel Homosapiens A_helix) RLAEELKQ Rassf5 Sarah(chain B_helix) Naf1(chainA_beta Homodimer 4OO7 PLILK Parallel Homosapiens sheet2) VVNEI Naf1(chainB_coil) NEMO(chain Homodimer 4OWF QLEDLRQQL Parallel Musmusculus A_helix1) LEDLRQQLQ NEMO(chain B_helix1) NEMO(chain Homodimer 4OWF KQELIDKL Parallel Musmusculus A_helix1) QELIDKLK NEMO(chain B_helix1) NEMO(chain Homodimer 4OWF LKAQADIY Parallel Musmusculus A_helix2) KAQADIYK NEMO(chain B_helix2) NEMO(chain Homodimer 4OWF AREKLVEKKEY Parallel Musmusculus A_helix2-3) LQEQLEQLQREFNKL NEMO(chain REKLVEKKEYL B_helix2-3) QEQLEQLQREFNKLK GBR1(chain Heterodimer 4PAS KSRLLEKE Parallel Homosapiens A_helix1) SRLEGLQS GBR2(chain B_helix1) GBR1(chain Heterodimer 4PAS EERVSELRHQLQ Parallel Homosapiens A_helix1) LDKDLEEVTMQL GBR2(chain B_helix1) Jip3(chainA_helix Homodimer 4PXJ DLIAKVDQ Antiparallel Homosapiens 1) IRNELKVK Jip3(chainB_helix 1) Pkg1-Alpha(chain Homodimer 4R4M LKRKLHKLQ Parallel Homosapiens A_helix) ELKRKLHKL Pkg1-Alpha(chain B_helix) VBP(chain Homodimer 4U5T EIRAAFLE Parallel Homosapiens A_helix) LEIRAAFL VBP(chain B_helix) NBL1(chain Homodimer 4X1J GQCFS Antiparallel Homosapiens A_betasheet3) SFCQG NBL1(chain B_betasheet3) Gp7-Myh7-EB1 Homodimer 4XA1 KLEKEKSEFKLELDDVT Parallel Homosapiens (chainA_helix3) LEKEKSEFKLELDDVTS Gp7-Myh7-EB1 (chainB_helix3) Gp7-Myh7-EB1 Homodimer 4XA1 ELGEQIDNL Parallel Homosapiens (chainA_helix3) LGEQIDNLQ Gp7-Myh7-EB1 (chainB_helix3) Gp7-Myh7-EB1 Homodimer 4XA1 LQQLRVNYGQQLRVNYGS Parallel Homosapiens (chainA_helix2) Gp7-Myh7-EB1 (chainB_helix2) Gp7-Myh7-EB1 Homodimer 4XA1 TEALQQLR Antiparallel Homosapiens (chainA_helix2) LIDEHEEP Gp7-Myh7-EB1 (chainB_helix1) SialostatinL Homodimer 4ZM8 VETQVVAGTNYRLT Antiparallel Ixodesscapularis (chainA_coil+ TLRYNTGAVVQTEV betasheet1&2) Norrin(chain Homodimer 5BQB ASRSE Antiparallel Homosapiens A_betasheet3) GECRA Norrin(chain B_betasheet2) Kinesin-like Homodimer 5DJN LKEKLEESEKLIKEL Parallel Musmusculus Protein(chain ELKEKLEESEKLIKE A_helix1)Kinesin- likeProtein(chain B_helix1) Kinesin-like Homodimer 5DJN LESMGISLETSG Parallel Musmusculus Protein(chain QLESMGISLETS A_helix1)Kinesin- likeProtein(chain B_helix1) Cc1-fha(chain Homodimer 5DJO LKEKLEES Parallel Musmusculus A_helix1) ELKEKLEE Cc1-fha(chain B_helix1) Phenylalanine-4- Homodimer 5FII ALAKVLRL Antiparallel Homosapiens hydroxylase(chain FLRLVKAL A_helix1) PhageCoatProtein Homodimer 5FS4 IRTVI Antiparallel Acinetobacter (chainA_betasheet VTRIS phageAP205 5) MyosinX(chain Homodimer 5HMO SLQKLQQL Parallel Bostaurus A_helix2) VEEILRLE MyosinX(chain C_helix3) MyosinX(chain Homodimer 5HMO LEKEIEDLQ Antiparallel Bostaurus A_helix2) QLDEIEKEL MyosinX(chain C_helix2) BLMHelicase Homodimer 5LUS EQQLYAVMDDICKLVDA Antiparallel Pelecanuscrispus (chainA_helix1) ALLKRRLGRQLLLEKAC Bruch,1832 BLMHelicase (chainA_helix2) Ncd(chain Homodimer 5W3D AELETCKEQLELETCKEQLF Parallel Drosophila A_helix1) melanogaster Ncd(chain B_helix1) .sup.aCAAP interactions underlined
Designing Synthetic Antibodies (sAbs) Using the CCAAP Principle
[0099] We assessed the composition of all amino acid pairings in the CCAAP boxes (Table 8) to obtain information on pairing preference and how the CAAPs were spaced out in the CCAAP box, which may be important factors for binding affinity, specificity, and stability. The raw abundance numbers are shown in Table 9 and summarized in
TABLE-US-00009 TABLE 9 % CAAP interactions In PPI In non-PPI Interacting Proteins region region Saccharomyces cerevisiae 24 0 GCN4 Homodimer [PDB_2ZTA] Mus musculus NF-k-B essential modulator 33 0 (NEMO) Homodimer [PDB_4OWF] Homo sapiens 33 5 c-Jun/c-Fos Heterodimer [PDB_1FOS] Rattus norvegicus 18 7 C/EBPA Homodimer [PDB_1NWQ] Saccharomyces cerevisiae 25 6 Put3 Homodimer [PDB_lAJY] Salmonella enterica serovar 30 8 Typhimurium TarH Homodimer [PDB_1VLT] Mus musculus 26 6 E47-NeuroD1 Heterodimer [PDB_2QL2] Arenicola marina (lugworm) 20 0 Arenicin-2 Homodimer [PDB_2L8X] Laticauda semifasciata Erabutoxin 29 0 Homodimer [PDB_1QKD]
CAAP-Based sAbs can Interact Specifically with Preselected Peptide Sequence in the Target Protein
[0100] To test the sAb design tool based on the CCAAP principle, we selected a target sequence in the HNH domain of the Staphylococcus pyogenes Cas9 protein [PDB_5B2R]. S. pyogenes CRISPR-Cas9 system has been broadly applied to edit the genome of bacterial and eukaryotic cells. The target sequence for the Cas9 is nEKLYLYYLQc (Helix: E813 to Q821). We designed two different types of synthetic antibody (sAb) molecules, sAb monomer (PTD13, Table 6) and sAb dimer (PTD14, Table 6), to detect the target protein sequences. As shown in the dot blot experiment (
[0101] To verify these results, we first produced three recombinant antibody (rAb) constructs, C9-813-92P (monomer, parallel), C9-813-93P (monomer, antiparallel), and C9-813-CAA2 (dimer, antiparallel and parallel). As shown in
[0102] Finally, we further examined the performance of the CCAAP oligopeptides to detect the whole Cas9 protein in both non-denatured (dot blot) and denatured (western blot) conditions (
[0103] To generalize the CCAAP principle for protein targeting, we have designed a synthetic antibody (sAb) construct and 6 recombinant antibody (rAb) constructs to detect 7 additional clinically important proteins: Anti-PDGF sAb (PTD18, Table 1) for Human Platelet-Derived Growth Factor B (PDGF-B) [PDB_3 MJG]; Anti-Bace1 rAb for Human Bace1 [PDB_4B05]; Anti-Brca1 rAb for Human Brca1 [PDB_3PXE]; Anti-Hsp90 rAb for Human Hsp90 [PDB_2VCI]; Anti-EstR rAb for Human Estrogen Receptor [PDB_1A52]; Anti-Xiap rAb for Human Xiap [PDB_2KNA]; and Anti-PDGFR rAb for PDGF Receptor (PDGFR) [PDB_3 MJG] (
[0104] In the present study, we have developed a novel CCAAP principle and obtained experimental evidence that CCAAP box is a critical driving force for PPI. Therefore, we conclude that the CCAAP concept can be applied to design sAb or rAb that can specifically interact with a preselected oligopeptide sequence (8-10 amino acids) in the target protein.
[0105] With respect to the use of substantially any plural and/or singular terms herein, those having skill in the art can translate from the plural to the singular and/or from the singular to plural as is appropriate to the context and/or application. The various singular/plural permutations can be expressly set forth herein for sake of clarity.
[0106] It will be understood by those within the art that, in general, terms used herein, and especially in the appended claims (for example, bodies of the appended claims) are generally intended as open terms (for example, the term including should be interpreted as including but not limited to, the term having should be interpreted as having at least, the term includes should be interpreted as includes but is not limited to, etc.). It will be further understood by those within the art that if a specific number of an introduced claim recitation is intended, such an intent will be explicitly recited in the claim, and in the absence of such recitation no such intent is present. For example, as an aid to understanding, the following appended claims can contain usage of the introductory phrases at least one and one or more to introduce claim recitations. However, the use of such phrases should not be construed to imply that the introduction of a claim recitation by the indefinite articles a or an limits any particular claim containing such introduced claim recitation to embodiments containing only one such recitation, even when the same claim includes the introductory phrases one or more or at least one and indefinite articles such as a or an (for example, a and/or an should be interpreted to mean at least one or one or more); the same holds true for the use of definite articles used to introduce claim recitations. In addition, even if a specific number of an introduced claim recitation is explicitly recited, those skilled in the art will recognize that such recitation should be interpreted to mean at least the recited number (for example, the bare recitation of two recitations, without other modifiers, means at least two recitations, or two or more recitations). Furthermore, in those instances where a convention analogous to at least one of A, B, and C, etc. is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (for example, a system having at least one of A, B, and C would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). In those instances where a convention analogous to at least one of A, B, or C, etc. is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (for example, a system having at least one of A, B, or C would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). It will be further understood by those within the art that virtually any disjunctive word and/or phrase presenting two or more alternative terms, whether in the description, claims, or drawings, should be understood to contemplate the possibilities of including one of the terms, either of the terms, or both terms. For example, the phrase A or B will be understood to include the possibilities of A or B or A and B.
[0107] In addition, where features or aspects of the disclosure are described in terms of Markush groups, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the Markush group.
[0108] As will be understood by one skilled in the art, for any and all purposes, such as in terms of providing a written description, all ranges disclosed herein also encompass any and all possible sub-ranges and combinations of sub-ranges thereof. Any listed range can be easily recognized as sufficiently describing and enabling the same range being broken down into at least equal halves, thirds, quarters, fifths, tenths, etc. As a non-limiting example, each range discussed herein can be readily broken down into a lower third, middle third and upper third, etc. As will also be understood by one skilled in the art all language such as up to, at least, greater than, less than, and the like include the number recited and refer to ranges which can be subsequently broken down into sub-ranges as discussed herein. Finally, as will be understood by one skilled in the art, a range includes each individual member. Thus, for example, a group having 1-3 articles refers to groups having 1, 2, or 3 articles. Similarly, a group having 1-5 articles refers to groups having 1, 2, 3, 4, or 5 articles, and so forth.
[0109] While various aspects and embodiments have been disclosed herein, other aspects and embodiments will be apparent to those skilled in the art. The various aspects and embodiments disclosed herein are for purposes of illustration and are not intended to be limiting, with the true scope and spirit being indicated by the following claims which are incorporated herein by reference.