ANTIBODY AGAINST HUMAN TGF-B LAP DEGRADATE, AND USE THEREOF

Abstract

Disclosed is an isolated monoclonal antibody against a human TGF- LAP degradate, the isolated monoclonal being capable of recognizing an integrin binding site in the human TGF- LAP degradate.

Claims

1. An isolated monoclonal antibody against a human TGF- LAP degradate, the isolated monoclonal being capable of recognizing an integrin binding site in the human TGF- LAP degradate.

2. The isolated monoclonal antibody according to claim 1, wherein the integrin binding site comprises an RGD sequence.

3. The isolated monoclonal antibody according to claim 1, wherein the isolated monoclonal antibody recognizes a region comprising amino acid residues at position-215 to position-217 in the amino acid sequence of SEQ ID NO: 2.

4. The isolated monoclonal antibody according to claim 1, wherein the isolated monoclonal antibody competes with a reference antibody which comprises: a light chain comprising CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 4, 5 and 6; and a heavy chain comprising CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 7, 8 and 9.

5. The isolated monoclonal antibody according to claim 4, wherein an Rmax value of binding between the isolated monoclonal antibody and the LAP degradate is decreased by at least 70% in presence of the reference antibody, the Rmax value being measured using a surface plasmon resonance analysis device.

6. The isolated monoclonal antibody according to claim 1, wherein the isolated monoclonal antibody comprises: a light chain comprising CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 12, 13 and 14; and a heavy chain comprising CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 15, 16 and 17.

7. The isolated monoclonal antibody according to claim 1, wherein the isolated monoclonal antibody comprises: a light chain comprising a variable region consisting of the amino acid sequence of SEQ ID NO: 18; and a heavy chain comprising a variable region consisting of the amino acid sequence of SEQ ID NO: 19.

8. The isolated monoclonal antibody according to claim 1, wherein the isolated monoclonal antibody comprises: a light chain comprising the amino acid sequence of SEQ ID NO: 20; and a heavy chain comprising the amino acid sequence of SEQ ID NO: 21.

9. A reagent for use in detection of a LAP degradate, the reagent comprising the monoclonal antibody according to claim 1.

10. A reagent kit for use in detection of a LAP degradate, the reagent kit comprising: a first reagent which comprises the monoclonal antibody according to claim 1; and a second reagent which comprises an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 3.

11. The reagent kit according to claim 10, wherein the antibody in the second reagent is an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 22.

12. A method for measuring a human TGF- LAP degradate, comprising measuring a TGF- LAP degradate in a biological sample collected from a subject using the monoclonal antibody according to claim 1.

13. The method according to claim 12, wherein the integrin binding site comprises an RGD sequence.

14. The method according to claim 12, wherein, in the measurement of the TGF- LAP degradate, an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 3 is further used.

15. The method according to claim 14, wherein, in the measurement of the TGF- LAP degradate, an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 22 is used.

16. A method for monitoring a measurement value for a human TGF- LAP degradate, comprising: measuring a TGF- LAP degradate in a first biological sample collected from a subject using the monoclonal antibody according to claim 1; and measuring the TGF- LAP degradate in a second biological sample collected from the subject using the isolated monoclonal antibody, wherein the first biological sample is a biological sample collected from the subject at a first point of time and the second biological sample is a biological sample collected from the subject at a second point of time that is different from the first point of time.

17. The method according to claim 16, wherein, in the measurement of the TGF- LAP degradate in the first biological sample, an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 3 is further used.

18. The method according to claim 17, wherein, in the measurement of the TGF- LAP degradate, an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 22 is used.

19. The method according to claim 16, wherein, in the measurement of the TGF- LAP degradate in the second biological sample, an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 3 is further used.

20. The method according to claim 19, wherein, in the measurement of the TGF- LAP degradate, an antibody specifically recognizing a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 22 is used.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0010] FIG. 1 is a schematic diagram showing the activation reaction of a latent complex of TGF- with PLK;

[0011] FIG. 2 is a diagrammatic illustration showing one example of the reagent of the present embodiment;

[0012] FIG. 3 is a diagrammatic illustration showing one example of the reagent kit of the present embodiment;

[0013] FIG. 4A shows a calibration curve produced by measuring a dilution series of a LAP-D using the isolated monoclonal antibody of the present embodiment as a detection antibody;

[0014] FIG. 4B shows a calibration curve produced by measuring a dilution series of a LAP-D using a commercially available anti-LAP antibody (141402, manufactured by BioLegend) as a detection antibody;

[0015] FIG. 4C shows a calibration curve produced by measuring a dilution series of a LAP-D using a commercially available anti-LAP antibody (349702, manufactured by BioLegend) as a detection antibody;

[0016] FIG. 4D shows a calibration curve produced by measuring a dilution series of a LAP-D using a commercially available anti-LAP antibody (MA5-17186, manufactured by Thermo Fisher Scientific) as a detection antibody;

[0017] FIG. 5A shows a calibration curve produced by measuring a dilution series of a LAP-D using the isolated monoclonal antibody of the present embodiment as a detection antibody;

[0018] FIG. 5B shows a calibration curve produced by measuring a dilution series of a LAP-D using a commercially available anti-human LAP TGF-1 antibody (BAM2462, manufactured by R&D Systems) as a detection antibody;

[0019] FIG. 6A is a graph showing the concentration of a LAP-D in a plasma specimen, which is produced by the measurement using the isolated monoclonal antibody of the present embodiment and an anti-human LAP TGF-1 antibody (BAM2462, manufactured by R&D Systems) as detection antibodies;

[0020] FIG. 6B is a graph showing the concentration of a LAP-D in a plasma specimen, which is produced by the measurement using the isolated monoclonal antibody of the present embodiment and an anti-human LAP TGF-1 antibody (BAM2462, manufactured by R&D Systems) as detection antibodies;

[0021] FIG. 7A is a sensorgram showing the reactivity of a commercially available anti-human LAP TGF-1 antibody (BAM2462, manufactured by R&D Systems), which is produced by the measurement using Biacore (registered trademark); and

[0022] FIG. 7B is a sensorgram showing the reactivity of the isolated monoclonal antibody of the present embodiment, which is produced by the measurement using Biacore (registered trademark).

DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[1. Isolated Monoclonal Antibody Against Human TGF- LAP Degradate]

[0023] The isolated monoclonal antibody (also simply referred to as antibody, hereinafter) against a human TGF- LAP degradate according to the present embodiment recognizes an integrin binding site in the human TGF- LAP degradate and can bind specifically to the human TGF- LAP degradate.

[0024] The term LAP as used herein refers to a dimeric prepeptide moiety that is associated with activated TGF- in a latent complex of human TGF- through hydrophobic bonding. The term human TGF- LAP degradate (or LAP degradate of human TGF-) as used herein refers to a degradation product of LAP which is produced by cutting out LAP in the latent complex of human TGF- (wherein the LAP is also referred to as human TGF- LAP or LAP of human TGF-, hereinafter) with a protease. The human TGF- LAP degradate (or LAP degradate of human TGF-) is also simply referred to as LAP-D or LAP degradate, hereinafter. The term isolated monoclonal antibody as used herein refers to a monoclonal antibody which is isolated and/or collected from a component occurring in a natural environment and does not substantially contain another antibody having different antigen specificity.

[0025] Human TGF- includes three isoforms, i.e., TGF-1, TGF-2 and TGF-3. The antibody of the present embodiment may bind to a LAP-D of any human TGF- isoform, and preferably binds to a LAP-D of human TGF-1. Each of the TGF- isoforms is originally synthesized in the form of a precursor polypeptide composed of a moiety that serves as activated TGF- and LAP that is a prepeptide moiety. The amino acid sequence for the precursor polypeptide of human TGF-1 is shown in SEQ ID NO: 1. The precursor polypeptide of human TGF-1 is composed of 390 amino acid residues. In the amino acid sequence of SEQ ID NO: 1, a moiety lying between an amino acid residue at position-30 and an amino acid residue at position-278 is human TGF-1 LAP (monomer) and a moiety lying between an amino acid residue at position-279 and an amino acid residue at position-390 is a moiety that serves as activated TGF-1 (a monomer of activated TGF-1). The amino acid sequence for human TGF-1 LAP (monomer) is shown in SEQ ID NO: 2.

[0026] The precursor polypeptide of TGF- is cut in a golgi body and is separated into a moiety that serves as activated TGF- and LAP. The separated LAP moieties together form a dimer through a disulfide bond. The separated moieties each serving as activated TGF- also together form a dimer, thereby forming activated TGF-. However, activated TGF- is trapped by the dimeric LAP and is secreted in the form of a latent complex as shown in FIG. 1. By cutting the LAP dimer with a protease, activated TGF- is released and, as a result, LAP-D is produced. It is considered that the LAP-D immediately after the production thereof occurs in the form of a dimer. However, the LAP-D may be converted to a monomer in vivo thereafter. The antibody of the present embodiment may bind to either one of a dimeric LAP-D or a monomeric LAP-D.

[0027] The LAP-D to which the antibody of the present embodiment can bind may be produced from LAP using any protease, as long as the LAP-D has an integrin binding site. It is preferred that the LAP-D is produced using a protease capable of cutting human TGF- LAP to release activated TGF-. As the protease, for example, plasma kallikrein (PLK), plasmin, matrix metalloproteinase (MMP) 3 and MMP9 are known. Among these proteases, PLK is particularly preferred. It is known that PLK can cut LAP at a site located between an arginine residue at position-58 and a leucine residue at position-59 in the amino acid sequence of SEQ ID NO: 1. In the case where human TGF-1 LAP is cut with PLK, the amino acid sequence for a monomeric LAP-D is a sequence of SEQ ID NO: 3.

[0028] The term integrin binding site as used herein refers to a region which lies on human TGF- LAP and includes a site capable of being recognized by integrin. It is known that the structure of LAP is changed upon the binding of LAP in the latent complex to integrin to release activated TGF-. A LAP-D produced by the TGF- activation reaction also has an integrin binding site. In the present embodiment, it does not matter whether or not the LAP-D can bind to integrin through the integrin binding site. In the present embodiment, it is preferred that the integrin binding site in the LAP-D includes an RGD sequence (i.e., a sequence composed of an arginine residue, a glycine residue and an aspartic acid residue). It is particularly preferred that the integrin binding site in the LAP-D is a region which is included in LAP-D and composed of 4 to 10 amino acid residues including an RGD sequence or a region consisting of an RGD sequence.

[0029] It is preferred that the antibody of the present embodiment recognizes, as an integrin binding site of LAP-D, a region which is included in a human TGF-1 LAP-D and includes the amino acid residues at position-215 to position-217 (i.e., an RGD sequence) in the amino acid sequence of SEQ ID NO: 2. It is particularly preferred that the antibody of the present embodiment recognizes a region which is included in a human TGF-1 LAP-D and is composed of 4 to 10 amino acid residues including the amino acid residues at position-215 to position-217 (i.e., an RGD sequence) in the amino acid sequence of SEQ ID NO: 2, or a region which is composed of the amino acid residues lying between the amino acid residue at position-215 and the amino acid residue at position-217 in the amino acid sequence of SEQ ID NO: 2.

[0030] The antibody of the present embodiment may be a monoclonal antibody originated from any mammal such as mouse, rat, hamster, rabbit, goat and horse, and is preferably a monoclonal antibody originated from mouse. The class of the antibody of the present embodiment may be any one selected from IgG, IgA, IgM, IgD and IgE, and is preferably IgG. The subclass of the IgG is not particularly limited, and may be any one selected from IgG1, IgG2, IgG3 and IgG4. The antibody of the present embodiment may be in the form of an immunoglobulin as well as an antibody fragment. Examples of the antibody fragment include Fab, F(ab)2, Fab, Fv, Fd, a domain antibody (dAb), a single-chain antibody (scFv) and a diabody. Among these antibody fragments, Fab is preferred.

[0031] It is preferred that the antibody of the present embodiment may compete with a specific reference antibody for the binding to human TGF- LAP-D, preferably the binding to human TGF-1 LAP-D. In the reference antibody, there are three complementarity determining regions (CDRs) in each of a heavy chain variable region and a light chain variable region. The three CDRs are named CDR1, CDR2 and CDR3 arranged from the amino terminal of the antibody chain. In the present embodiment, the reference antibody comprises: a light chain comprising CDR1, CDR2 and CDR3 respectively consisting of the below-mentioned amino acid sequences (SEQ ID NOs: 4, 5 and 6); and a heavy chain comprising CDR1, CDR2 and CDR3 respectively consisting of the below-mentioned amino acid sequences (SEQ ID NOs: 7, 8 and 9). The amino acid sequences for these CDRs are sequences in accordance with the Kabat classification (Wu T T. and Kabat E A., 1970, J. Exp. Med. 132:211-250). The reference antibody is an isolated monoclonal antibody capable of binding to an integrin binding site in a human TGF-1 LAP-D, but is not included within the scope of the antibody of the present embodiment.

[Amino Acid Sequences for CDRs of Reference Antibody]

[0032]

TABLE-US-00001 LightchainCDR1: (SEQIDNO:4) SASSSVSYMH LightchainCDR2: (SEQIDNO:5) STSNLAS LightchainCDR3: (SEQIDNO:6) QQRSSYPFT HeavychainCDR1: (SEQIDNO:7) SYWMN HeavychainCDR2: (SEQIDNO:8) MIDPSDSETHYNQMFKD HeavychainCDR3: (SEQIDNO:9) WPYALDY

[0033] It is preferred that the reference antibody comprises: a light chain comprising a variable region consisting of the amino acid sequence (SEQ ID NO: 10) shown below; and a heavy chain comprising a variable region consisting of the amino acid sequence (SEQ ID NO: 11) shown below. The reference antibody having these variable regions is a mouse-originated monoclonal antibody.

[Amino Acid Sequences for Variable Regions of Reference Antibody]

[0034]

TABLE-US-00002 Lightchainvariableregion (SEQIDNO:10) QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWFQQKPGTSPKLWIYS TSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPFTFGS GTKLEIKRA Heavychainvariableregion (SEQIDNO:11) EVQLQQSGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLE WIGMIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYC VNWPYALDYWGQGTSVTVSS

[0035] The wording the antibody of the present embodiment competes with the reference antibody for the binding to a LAP-D refers to the matter that a binding site for the antibody of the present embodiment on the LAP-D and a binding site for the reference antibody on the LAP-D are identical to each other or the matter that the antibody of the present embodiment can bind to a site on the LAP-D which is a steric hindrance to the binding between the reference antibody and the LAP-D. In other words, the antibody of the present embodiment recognizes an epitope that is completely or partially identical to an epitope of the reference antibody.

[0036] The competition between the antibody of the present embodiment and the reference antibody for the binding to a LAP-D can be evaluated by a surface plasmon resonance (SPR) analysis. The SPR analysis can be carried out using, for example, an SPR analysis device. An example of the analysis device is Biacore (registered trademark) device. In the analysis, the reference antibody may be in the form of an antibody fragment such as Fab. For example, with respect to the binding of the antibody of the present embodiment to a LAP-D, the maximal binding response value (also referred to as Rmax value, hereinafter) measured using Biacore (registered trademark) device is decreased by at least 70%, preferably at least 75%, due to the presence of a reference antibody. In other words, the Rmax value of binding between the antibody of the present embodiment and a LAP-D in the presence of a reference antibody is decreased by at least 70%, preferably at least 75%, compared with the Rmax value of binding between the antibody of the present embodiment and the LAP-D in the absence of the reference antibody. The Rmax value is a maximum value of the response measured using Biacore (registered trademark) device, and is a value that is not adjusted with taking the molecular weight of an antigen (analyte) immobilized on a sensor chip into consideration. The conditions for the measurement using Biacore (registered trademark) device are those mentioned in Example 4. In the measurement using Biacore (registered trademark) device, the value of response is expressed in RU (Resonance Unit).

[0037] In the antibody of the present embodiment, there are three CDRs in each of the heavy chain and light chain variable regions. It is preferred that the antibody of the present embodiment comprises a light chain comprising CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences (SEQ ID NOs: 12, 13 and 14) shown below. It is preferred that the antibody of the present embodiment comprises a heavy chain comprising CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences (SEQ ID NOs: 15, 16 and 17) shown below. The amino acid sequences for these CDRs are sequences according to the Kabat classification. The antibody of the present embodiment which has these CDRs can bind specifically to a human TGF-1 LAP-D.

[Amino Acid Sequences for CDRs of Antibody of the Present Embodiment]

[0038]

TABLE-US-00003 LightchainCDR1: (SEQIDNO:12) RASHEISGYLG LightchainCDR2: (SEQIDNO:13) AASTLDS LightchainCDR3: (SEQIDNO:14) LQYASYPFT HeavychainCDR1: (SEQIDNO:15) RFWMN HeavychainCDR2: (SEQIDNO:16) MIHSSDSITRLNQKFKD HeavychainCDR3: (SEQIDNO:17) GYDEYSAMDY

[0039] In the case where the antibody of the present embodiment is a monoclonal antibody originated from mouse, it is preferred that the antibody comprises a light chain comprising a variable region consisting of the amino acid sequence (SEQ ID NO: 18) shown below. It is also referred that the antibody comprises a heavy chain comprising a variable region consisting of the amino acid sequence (SEQ ID NO: 19) shown below. The antibody of the present embodiment which has these variable regions can bind specifically to a human TGF-1 LAP-D.

[Amino Acid Sequences for Variable Regions of Antibody of the Present Embodiment]

[0040]

TABLE-US-00004 Lightchainvariableregion (SEQIDNO:18) DIQMTQSPSSLSASLGERVSLTCRASHEISGYLGWLQRQPDGTIKRLIYA ASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASYPFTFGS GTKLEVKRA Heavychainvariableregion (SEQIDNO:19) QVQLQQPGAELVRPGASVKLSCKTSGYSFTRFWMNWVRQRPGQGLE WIGMIHSSDSITRLNQKFKDKATLTLDYSSSTAYMQLSSPTSEDSAVYYC ARGYDEYSAMDYWGQGTSVPVSS

[0041] In the case where the antibody of the present embodiment is a monoclonal antibody originated from mouse, it is preferred that the antibody comprises a light chain comprising the amino acid sequence (SEQ ID NO: 20) shown below. It is also referred that the antibody comprises a heavy chain comprising the amino acid sequence (SEQ ID NO: 21) shown below. The antibody of the present embodiment which has these variable regions can bind specifically to a human TGF-1 LAP-D.

[Amino Acid Sequences for Light Chain and Heavy Chain of Antibody of the Present Embodiment]

[0042]

TABLE-US-00005 Lightchain (SEQIDNO:20) MDMRVPAHVFGLLLLWFPGTRCDIQMTQSPSSLSASLGERVSLTCRAS HEISGYLGWLQRQPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTIS SLESEDFADYYCLQYASYPFTFGSGTKLEVKRADAAPTVSIFPPSSEQLT SGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS STLTLTKDEVERHNSYTCEATHKTSTSPIVKSFNRNEC Heavychain (SEQIDNO:21) MGWSSIILFLVATATGVHSQVQLQQPGAELVRPGASVKLSCKTSGYSF TRFWMNWVRQRPGQGLEWIGMIHSSDSITRLNQKFKDKATLTLDYSSSTA YMQLSSPTSEDSAVYYCARGYDEYSAMDYWGQGTSVPVSSAKTTPPSVYP LAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICT VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVE VHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIE KTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQW NGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLH NHHTEKSLSHSPGK

[0043] The antibody of the present embodiment may be a chimeric antibody having variable regions respectively of SEQ ID NOs: 18 and 19. The term chimeric antibody as used herein refers to an antibody in which variable regions of an antibody originated from a specific species and constant regions of an antibody originated from a species heterogeneous to the antibody are linked to one another. The antibody of the present embodiment may be a humanized antibody which has light chain CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 12, 13 and 14; and heavy chain CDR1, CDR2 and CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 15, 16 and 17. The term humanized antibody as used herein refers to an antibody produced by grafting gene sequences for CDRs of an antibody originated from a non-human animal into a gene for a human antibody (CDR grafting).

[0044] The antibody of the present embodiment includes, within the scope thereof, an antibody for which the amino acid sequence is modified without decreasing its activity to bind to a human TGF-1 LAP-D. Examples of the modification of the amino acid sequence include the substitution, deletion, addition and/or insertion of an amino acid residue. The modification site in the amino acid sequence for the antibody may be a constant region or a variable region of a heavy chain or a light chain. In the case where it is intended to modify a variable region, it is preferred to modify a framework region (FR). The term FR refers to a region which occurs in a variable region of each of light chains and heavy chains of an antibody and is other than CDRs. An FR plays a roll of a scaffold for linking three CDRs to one another and contributes to the stabilization of the structures of the CDRs. The modification of the amino acid sequence for the antibody can be carried out by introducing a mutation into a gene for the antibody by a known method such as a DNA recombination technique and other molecular biological techniques.

[0045] The number of amino acid residues to be modified is generally 10 or less, preferably 5 or less, more preferably 3 or less. The modification of the amino acid sequence for the antibody is preferably conservative substitution. The term conservative substitution as used herein refers to the substitution of an amino acid residue with an amino acid residue that has a side chain having the same chemical property as that of a side chain of the aforementioned amino acid residue. The conservative substitution of an amino acid sequence is known in the art. Alternatively, the amino acid sequence for the antibody may be modified by the method disclosed in U.S. Patent Application Publication No. 2018/0179298 and comprises modifying an amino acid residue in FR3 in the antibody and can control the affinity of the antibody for an antigen.

[0046] The antibody of the present embodiment may be modified with a labeling substance that is known in the art. The labeling substance is not particularly limited, as long as a detectable signal can be generated. For example, the labeling substance may be a substance which can generate a signal by itself (wherein the substance is also referred to a signal generating substance, hereinafter), or may be a substance which can catalyze the reaction with another substance to generate a signal. Examples of the signal generating substance include a fluorescent substance and a radioactive isotope. An example of the substance capable of catalyzing the reaction with another substance to generate a detectable signal is an enzyme. Examples of the enzyme include alkaline phosphatase, peroxidase, -galactosidase, and luciferase. Examples of the fluorescent substance include: a fluorescent dye such as fluorescein isothiocyanate (FITC), rhodamine and Alexa Fluor (registered trademark); and a fluorescent protein such as green fluorescent protein (GFP). Examples of the radioactive isotope include .sup.125I, .sup.14C and .sup.32P.

[0047] Another embodiment includes an isolated and purified polynucleotide encoding the antibody of the present embodiment or a fragment thereof. Still another embodiment includes a vector carrying the polynucleotide. The vector is a polynucleotide construct that is designed for transduction or transfection. The type of the vector is not particularly limited, and can be selected appropriately from vectors known in the art, such as an expression vector, a cloning vector and a viral vector. Still another embodiment includes a host cell harboring the vector. The type of the host cell is not particularly limited, and can be selected appropriately from a eukaryotic cell, a prokaryotic cell and a mammal cell.

[0048] The antibody of the present embodiment can be produced by a known monoclonal antibody production method such as a hybridoma method and a phage display method. In the case where it is intended to produce a hybridoma capable of producing the antibody of the present embodiment by a hybridoma method, a polypeptide comprising a part or the whole of the amino acid sequence for TGF-1-LAP can be used as an immunogen. It is preferred that the polypeptide includes an integrin binding site of LAP-D. A specific example of the polypeptide is TGF-1-LAP (amino acid residues at position-30 to position-390). The polypeptide may have a mutation at a cutting site located between the amino acid sequence for activated TGF- and the amino acid sequence for LAP, for the purpose of avoiding the cutting of the polypeptide with a protease. For example, when the amino acid residue arginine at position-278 is substituted with a non-arginine amino acid residue such as alanine in the polypeptide, the polypeptide cannot be recognized by a protease and therefore cannot be cut with the protease. The method for synthesizing the polypeptide is known, and an example of the method is a Fmoc solid-phase synthesis method. Because the synthesized polypeptide has poor immunogenicity, it is preferred to link the polypeptide to a carrier protein such as keyhole limpet hemocyanin (KLH) and albumin. In the case where the carrier protein and the synthesized peptide are linked to each other by crosslinking, it is preferred to add a cysteine residue to the N-terminal or the C-terminal of the sequence for the polypeptide in the synthesis of the polypeptide. Alternatively, the immunogen may be produced in the form of a recombinant protein. Recombinant TGF- can be produced by inserting a polynucleotide encoding the amino acid sequence for TGF- into a known expression vector, then transforming a host cell with the vector to express the recombinant TGF-, and then purifying the recombinant TGF- by a known method. The purified recombinant TGF- can be used as an immunogen.

[0049] Subsequently, a proper animal (e.g., mouse, rat, hamster, rabbit) is immunized with the polypeptide thus produced, and an antibody-producing cell such as a spleen cell is obtained from the immunized animal. The antibody-producing cell thus obtained is fused to a proper myeloma cell by a known hybridoma production method such as a method disclosed in Kohler and Milstein, Nature, vol. 256, p. 495-497, 1975, thereby producing a hybridoma. For the screening of the hybridoma, a synthesized polypeptide that is used as the immunogen can be used. The antibody of the present embodiment can be obtained from a culture supernatant of the hybridoma or an ascitic fluid from a mammal who has received the intraperitoneal administered of the hybridoma. The antibody thus obtained may be purified by a known method such as salting out, affinity chromatography and gel filtration.

[0050] When a phage display method is employed, a Fab fragment of the antibody of the present embodiment can be produced, for example. Firstly, an animal such as mouse is immunized with the synthesized polypeptide, then mRNA is obtained from the spleen of the animal, and then cDNA is synthesized using the mRNA. The cDNA thus obtained is amplified using a known primer for cloning an antibody gene to produce a Fab phage library. A Fab clone of the antibody of the present embodiment can be produced using the library by a Fab phage display method and biopanning (see Philippa M. O'Brien and Robert Aitken, Antibody Phage Display, (2002) Methods in Molecular Biology Volume No. 178) that are known.

[0051] In the case where there is a hybridoma capable of producing the antibody of the present embodiment, the amino acid sequence for the antibody of the present embodiment can be analyzed in the manner mentioned in Example 3 below. Firstly, a polynucleotide encoding the antibody of the present embodiment is synthesized using RNA extracted from the hybridoma by a reverse transcription reaction and a Rapid Amplification of cDNA ends (RACE) method. Subsequently, the nucleotide sequence for the synthesized polynucleotide is analyzing by sequencing, and the amino acid sequence for the antibody is determined on the basis of the nucleotide sequence.

[0052] As demonstrated in Examples mentioned below, when the antibody of the present embodiment is used in a sandwich ELISA method, it becomes possible to achieve a high-detectability measurement of a recombinant LAP-D as well as a LAP-D in a biological sample (e.g., plasma) collected from a subject. Therefore, the antibody of the present embodiment is useful for the measurement of a LAP-D in a biological sample. In recent years, it is found that the PLK-induced activation and release of TGF- can accelerate liver fibrosis. It is considered that a LAP-D produced by the cut out of LAP with PLK is released in blood. Therefore, the antibody of the present embodiment is useful for, for example, the study for elucidating the relationship between the blood level of a LAP-D and the progression of liver fibrosis.

[2. Reagent for Detecting LAP Degradate]

[0053] The reagent for detecting a LAP degradate of the present embodiment (also simply referred to as a reagent, hereinafter) is a reagent comprising an isolated monoclonal antibody against a human TGF- LAP degradate of the above-mentioned embodiment.

[0054] As mentioned above, the antibody of the present embodiment exhibits high LAP-D detectability when used in a sandwich ELISA method, and therefore the reagent of the present embodiment can be used suitably in a sandwich ELISA method. In the reagent of the present embodiment, the antibody may be modified with a labeling substance that is known in the art. The details about the labeling substance are the same as those mentioned with respect to the antibody of the present embodiment.

[0055] The form of the reagent of the present embodiment is not particularly limited, and may be a solid form (e.g., a powder, a crystal, a freeze-dried product) or a liquid form (e.g., a solution, a suspension, an emulsion). In the case where the reagent has a liquid form, the solvent to be used is not particularly limited, as long as the antibody of the present embodiment can be dissolved and stored in the solvent. Examples of the solvent include water, physiological saline, phosphate-buffered saline (PBS), tris-buffered saline (TBS) and Good's buffer. Specific examples of the Good's buffer include MES, Bis-Tris, ADA, PIPES, Bis-Tris-Propane, ACES, MOPS, MOPSO, BES, TES, HEPES, HEPPS, Tricine, Tris, Bicine and TAPS.

[0056] The reagent of the present embodiment may contain a known additive. Examples of the additive include: a protein stabilizer such as bovine serum albumin (BSA); a preservative agent such as sodium azide; and an inorganic salt such as sodium chloride.

[0057] In the present embodiment, it is possible to pack a container including the reagent therein in a box and to provide the box to a user. In the box, a package insert may also be included. On the package insert, the composition, the instruction of usage, the storage method and the like of the reagent of the present embodiment may be written. One example of the reagent of the present embodiment is shown in FIG. 2. In FIG. 2, 11 represents the reagent of the present embodiment, 12 represents a first container in which the antibody of the present embodiment is enclosed, 13 represents a package box, and 14 represents a package insert.

[3. Reagent Kit for Detecting LAP Degradate]

[0058] The reagent kit for detecting a LAP degradate of the present embodiment (also simply referred to as reagent kit, hereinafter) is a reagent kit comprising: a first reagent which contains the above-mentioned isolated monoclonal antibody against a human TGF- LAP degradate according to the present invention; and a second reagent which contains an antibody specifically recognizing a region comprising a leucine residue at the N-terminal of the amino acid sequence of SEQ ID NO: 3.

[0059] The amino acid sequence of SEQ ID NO: 3 is the amino acid sequence for a LAP-D produced by the cutting out of human TGF-1 LAP with PLK (i.e., a sequence composed of amino acid residues at position-59 to position-278 in the amino acid sequence of SEQ ID NO: 1). The N-terminal leucine residue in this amino acid sequence is a cutting site of LAP with PLK. Namely, the antibody in the second reagent is an antibody specifically recognizing a cut face of LAP with PLK. The antibody itself is known, and is disclosed in U.S. Patent Application Publication No. 2011/0071278 (wherein U.S. Patent Application Publication No. 2011/0071278 is incorporated by reference herein). In a preferred embodiment, the antibody in the second reagent is an antibody specifically recognizing a region comprising a leucine residue at the N-terminal of the amino acid sequence of SEQ ID NO: 22. The amino acid sequence of SEQ ID NO: 22 is a sequence composed of amino acid residues at position-59 to position-68 in the amino acid sequence of SEQ ID NO: 1.

[0060] In the present embodiment, each of the reagents may contain a known additive. The details about the additive are the same as those mentioned with respect to the reagent of the present embodiment. The form of the antibody in each of the reagents is not particularly limited, and may be a solid form (e.g., a powder, a crystal, a freeze-dried product) or a liquid form (e.g., a solution, a suspension, an emulsion).

[0061] The reagent kit of the present embodiment can be used suitably in a sandwich ELISA method. In the reagent kit of the present embodiment, it is preferred that the antibody of the present embodiment which is contained in the first reagent is used as a detection antibody in a sandwich ELISA method. It is preferred that the antibody contained in the second reagent is used as a capture antibody in a sandwich ELISA method. The term detection antibody as used herein refers to an antibody which can bind specifically to a substance to be tested, and which can provide a detectable signal through a labeling substance when the antibody is bound to the labeling substance. It is preferred for the detection antibody is not immobilized on a solid phase. The term capture antibody as used herein refers to an antibody which can specifically bind to a substance to be tested that is the analyte and can be immobilized on a solid phase to capture the substance to be tested onto the solid phase.

[0062] The reagent kit of the present embodiment may further include a solid phase on which the capture antibody is to be immobilized. The solid phase may be an insoluble support on which the capture antibody can be immobilized. The mode of the immobilization of the capture antibody on the solid phase is not particularly limited. For example, the capture antibody and the solid phase may bind directly or may bind indirectly with another substance intercalated therebetween. An example of the direct binding is physical adsorption. An example of the indirect binding is a binding through a combination of a biotin-type compound (including biotin and a biotin analog such as desthiobiotin) and an avidin-type compound (including avidin and an avidin analog such as streptavidin and Tamavidin (registered trademark)). In this case, by modifying the capture antibody with a biotin-type compound in advance and binding an avidin-type compound to the solid phase in advance, the capture antibody and the solid phase can bind to each other indirectly through the binding between the biotin-type compound and the avidin-type compound.

[0063] The material for the solid phase is not particularly limited, and can be selected from, for example, an organic polymeric compound, an inorganic compound, a biological polymer and others. Examples of the organic polymeric compound include latex, polystyrene and polypropylene. Examples of the inorganic compound include a magnetic material (e.g., iron oxide, chromium oxide, ferrite), silica, alumina and a glass. Examples of the biological polymer include insoluble agarose, insoluble dextran, gelatin and cellulose. It is possible to use two or more of these substances in combination. The form of the solid phase is not particularly limited, and examples of the form include a micro plate, a micro tube, a test tube, a particle and a film. Among these forms, a micro plate and a particle (particularly a magnetic particle) is preferred.

[0064] In the present embodiment, the antibody to be contained in each of the reagents may be modified with a labeling substance that is known in the art. It is particularly preferred that the antibody to be contained in the first reagent is modified with a labeling substance. The details about the labeling substance are the same as those mentioned with respect to the antibody of the present embodiment. In the case where the labeling substance is an enzyme, the reagent kit may include a substrate for the enzyme. The substrate can be selected appropriately depending on the type of the enzyme.

[0065] In the present embodiment, it is possible to pack containers respectively including the first and second reagents in a box and provide the box to a user. In the box, a package insert may also be included. On the package insert, the constitution, the instruction of usage, the storage method and the like of the reagent kit of the present embodiment may be written. One example of the reagent kit of the present embodiment is shown in FIG. 3. In FIG. 3, 21 represents the reagent kit of the present embodiment, 22 represents a first container in which the antibody of the present embodiment is enclosed, 23 represents a second container in which the capture antibody of the present embodiment is enclosed, 24 represents a package box, and 25 represents a package insert. In this example, the reagent kit may further include a solid phase on which the capture antibody is to be immobilized.

[0066] In the present embodiment, the reagent kit may include a calibrator for a LAP-D. One example of the calibrator is a calibrator for LAP-D quantification use. For example, this calibrator may be provided with a buffer solution containing no LAP-D (i.e., negative control) and a buffer solution containing a LAP-D at a known concentration. The LAP-D to be contained in the calibrator may be a recombinant LAP-D or a synthetic peptide consisting of the amino acid sequence for a LAP-D. The recombinant LAP-D can be produced by the limited proteolysis of a recombinant human TGF- LAP protein with a protease such as PLK.

[4. Method for Measuring Human TGF- LAP Degradate]

[0067] The method for measuring a human TGF- LAP degradate (also simply referred to as measurement method, hereinafter) of the present embodiment includes measuring a human TGF- LAP degradate in a biological sample collected from a subject using the antibody.

[0068] The subject is not particularly limited, and an example of the subject is a patient who carries a clinical condition or disease associated with the abnormality in TGF-. An example of the clinical condition is the fibrosis of liver, lung, kidney or the like. Examples of the disease include viral hepatitis (particularly hepatitis C), hepatic cirrhosis and cancer. An example of the biological sample is a clinical specimen collected from a subject. Examples of the clinical specimen include blood (whole blood, plasma, serum), a tissue fluid, a cerebrospinal fluid, an ascitic fluid and urine.

[0069] In the case where insoluble contaminants such as cells are contained in the biological sample, the contaminants may be removed from the biological sample by a known means such as centrifugation and filtration. The biological sample may be diluted with a proper water-based medium, if necessary. The water-based medium is not particularly limited, as long as the below-mentioned measurements are not interfered. Examples of the water-based medium include water, physiological saline and a buffer solution. The buffer solution is not particularly limited, as long as the buffer solution can exhibit a buffering activity at an almost neutral pH value (e.g., a pH value of 6 to 8 inclusive). Examples of the buffer solution include: Good's buffer such as HEPES, MES and PIPES; TBS; and PBS.

[0070] The wording measure a human TGF- LAP degradate as used herein includes the determination of the value of the quantity or concentration of a human TGF- LAP-D and the acquisition of information that reflects the quantity or concentration of a human TGF- LAP-D. The term information that reflects the quantity or concentration of a human TGF- LAP-D as used herein refers to an indicator that varies depending on the quantity or concentration of a human TGF- LAP-D in a biological sample or a measurement sample prepared from the biological sample. The indicator is preferably an indicator for a visibly-detectable or mechanically-measurable optical change. Examples of the indicator for the optical change include an emission intensity, a fluorescence intensity, an absorbance, a turbidity and a color optical density.

[0071] The method for measuring a LAP-D using the antibody of the present embodiment is not particularly limited, and can be selected appropriately from the known immunological measurement methods. Examples of the measurement method include an ELISA method and a western blot method. Alternatively, the immune complex transfer immunoassay disclosed in Japanese Laid-Open Patent Publication No. 1-254868 may also be employed. Among these methods, an ELISA method is preferred. The type of the ELISA method may be anyone selected from a sandwich method, a competition method, a direct method, an indirect method and the like, and a sandwich method is particularly preferred. As one example, a case where the measurement is carried out by a sandwich ELISA method will be described hereinbelow. In this example, the antibody of the present embodiment is used as a detection antibody.

[0072] Firstly, a complex comprising a LAP-D, a capture antibody against the LAP-D, and the antibody of the present embodiment (i.e., detection antibody) is formed on a solid phase. The complex can be formed by mixing a biological sample that may contain a biomarker, the capture antibody and the detection antibody together. The solution containing the complex is contacted with a solid phase on which the capture antibody can be captured, thereby forming the complex on the solid phase. Alternatively, it is also possible to use a solid phase having a capture antibody immobilized previously thereon. Namely, a solid phase having a capture antibody immobilized thereon, a biological sample and a detection antibody may contact together to form the complex on the solid phase.

[0073] The capture antibody is not particularly limited, as long as the capture antibody can bind specifically to a LAP-D. In the case where the capture antibody is a monoclonal antibody, it is preferred that the epitope of the capture antibody is a site different from an integrin binding site. In a preferred embodiment, the capture antibody is an antibody capable of recognizing specifically a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 3. More preferably, the capture antibody is an antibody capable of recognizing specifically a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 22.

[0074] A biomarker contained in the biological sample can be measured by detecting the complex formed on the solid phase by a method known in the art. For example, in the case where the antibody of the present embodiment which is labeled with a labeling substance is used as a detection antibody, the human TGF-1 LAP-D in the biological sample can be measured by detecting a signal generated from the labeling substance. Alternatively, in the case where a labeling secondary antibody against the detection antibody is used, the human TGF-1 LAP-D in the biological sample can also be measured in the same manner. The details about the labeling substance are the same as those mentioned with respect to the antibody of the present embodiment.

[0075] In the present embodiment, it is also possible to carry out a B/F (Bound/Free) separation procedure for removing an unreacted free component that is not involved in the formation of the complex between the formation of the complex and the detection of the complex. The term unreacted free component as used herein refers to a component which is not involved in the formation of the complex. Examples of the unreacted free component include a capture antibody and a detection antibody each of which does not bind to a human TGF-1 LAP-D. The means for the B/F separation is not particularly limited. In the case where the solid phase comprises particles, the B/F separation can be achieved by collecting only the complex-captured solid phase by centrifugation. In the case where the solid phase is a container such as a micro plate and a micro tube, the B/F separation can be achieved by removing a solution containing the unreacted free component. In the case where the solid phase comprises magnetic particles, the B/F separation can be achieved by removing a solution containing the unreacted free component by suction using a nozzle while magnetically constraining the magnetic particles with a magnet. This is preferred from the viewpoint of automatization. Subsequent to the removal of the unreacted free component, the solid phase having the complex immobilized thereon may be washed with a proper water-based medium such as PBS.

[0076] The wording detect a signal as used herein includes, within the scope thereof, the detection of the presence or absence of a signal, the quantification of the intensity of a signal, and the semi-quantitative detection of the intensity of a signal. The term semi-quantitative detection as used herein refers to the matter that the level of the intensity of a signal is rated in stages, such as no signal is observed, signal is weak, signal is moderate and signal is intense. In the present embodiment, it is preferred to detect the intensity of a signal quantitatively or semi-quantitatively.

[0077] The method for measuring the signal is known in the art. In the present embodiment, the measurement method may be selected appropriately depending on the type of the signal coming from the labeling substance. For example, in the case where the labeling substance is an enzyme, it is possible to measure a signal, e.g., light and color, generated upon the reaction of the enzyme with a substrate for the enzyme using a known device such as a spectrophotometer.

[0078] The substrate for the enzyme can be selected appropriately from known substrates depending on the type of the enzyme to be used. For example, in the case where alkaline phosphatase is used as the enzyme, examples of the substrate for the enzyme include: a chemiluminescent substrate such as CDP-Star (registered trademark) (disodium 4-chloro-3-(methoxyspiro[1,2-dioxetane-3,2-(5-chloro)tricyclo[3.3.1.13,7]decan]-4-yl)phenylphosphate) and CSPD (registered trademark) (disodium 3-(4-methoxyspiro[1,2-dioxetane-3,2-(5-chloro)tricyclo[3.3.1.13,7]decan]-4-yl)phenylphosphate); and a luminescent substrate such as 5-bromo-4-chloro-3-indolyl phosphoric acid (BCIP), disodium 5-bromo-6-chloro-indolylphosphate and p-nitrophenylphosphoric acid. In the case where peroxidase is used as the enzyme, examples of the substrate include: a chemiluminescent substrate such as luminol and a derivative thereof; and a chromogenic substrate such as 2,2-azinobis(3-ethylbenzothiazoline-6-sulfonic acid ammonium salt) (ABTS), 1,2-phenylenediamine (OPD) and 3,3,5,5-tetramethylbenzidine (TMB).

[0079] In the case where the labeling substance is a radioactive isotope, radioactive ray that is a signal can be measured using a known device such as a scintillation counter. In the case where the labeling substance is a fluorescent substance, fluorescent light that is a signal can be measured using a known device such as a fluorescence microplate reader. An excitation wavelength and a fluorescence wavelength can be determined appropriately depending on the type of the fluorescent substance to be used.

[0080] The result of the detection of the signal can be employed as the result of the measurement of a human TGF-1 LAP-D. For example, in the case where it is intended to quantify the intensity of a signal, a measurement value of the signal intensity or a value acquired from the measurement value can be employed as a measurement result for the human TGF-1 LAP-D. An example of the value acquired from a measurement value of the signal intensity is a value determined by subtracting a measurement value of a negative control sample or a background value from the measurement value. It is also possible to assign the measurement value of the signal intensity to a calibration curve to determine the value of the quantity or concentration of the human TGF-1 LAP-D. The negative control sample can be selected appropriately, and an example of the negative control sample is a biological sample collected from a normal person.

[0081] In the present embodiment, a human TGF-1 LAP-D in a biological sample may be measured by a sandwich ELISA method using a capture antibody immobilized on magnetic particles and the antibody of the present embodiment (detection antibody) labeled with a labeling substance. In this case, the measurement may be carried out using a commercially available automated immunoassay device such as HISCL series systems (manufactured by Sysmex corporation).

[5. Method for Monitoring Measurement Value of Human TGF- LAP Degradate]

[0082] In the method for monitoring a measurement value of a human TGF- LAP degradate according to the present embodiment (wherein the method is also simply referred to as monitoring method, hereinafter), a step of measuring a TGF- LAP-D in a first biological sample collected from a subject using the antibody of the present embodiment and a step of measuring the TGF- LAP-D in a second biological sample collected from the subject. The first biological sample is a biological sample collected from a subject at a first point of time. The second biological sample is a biological sample collected from the same subject at a second point of time that is different from the first point of time. In the monitoring method of the present embodiment, the change in the measurement value of LAP degradate in a subject can be monitored by comparing the measurement values for a TGF- LAP degradate in the first and second biological samples with each other.

[0083] An example of each of the first and second biological samples is a clinical specimen collected from a subject. The details about the clinical specimen are the same as those mentioned with respect to the measurement method of the present embodiment. It is preferred that the first biological sample and the second biological sample are of the same type. The subject is not particularly limited, and an example of the subject is a patient who carries a clinical condition or disease associated with the abnormality in TGF-. The details about the clinical condition and the disease are the same as those mentioned with respect to the measurement method of the present embodiment. Alternatively, the subject may be a patient who has received a treatment for a clinical condition or disease associated with the abnormality of TGF- or a patient who is scheduled to receive the treatment.

[0084] The first point of time is not particularly limited, and may be an arbitrary point of time. The second point of time is not particularly limited, as long as the second point of time is different from the first point of time. The second point of time may be a point of time at which a period selected from the range of 1 day to 6 months has passed since the first point of time. More specifically, the period between the first point of time and the second point of time may be about 3 months. For example, it is possible to collect a biological sample from a subject and measure the biological sample every about 3 months. In the case where the subject has received a treatment for a clinical condition or disease associated with the abnormality in TGF-, it is possible to employ a point of time at which the subject receives the treatment as the first point of time and employ a point of time at which the subject receives next treatment as the second point of time. In the case where the subject is a patient who is scheduled to receive a treatment for a clinical condition or disease associated with the abnormality in TGF-, it is possible to employ a point of time before the start of the treatment or the point of time of the start of the treatment as the first point of time and employ a point of time at which a predetermined period has passed since the start of the treatment as the second point of time. In the case where the clinical condition or disease associated with the abnormality in TGF- closely relates to a measurement value for a TGF- LAP degradate, the efficacy of the treatment can be monitored by comparing the measurement values for the TGF- LAP degradate in the first and second biological samples with each other.

[0085] The details about the method for measuring a TGF- LAP-D in each of the first and second biological samples are the same as those mentioned with respect to the measurement method of the present embodiment. The measurement of the first biological sample and the measurement of the second biological sample may be carried out substantially simultaneously or sequentially. In the case where the first biological sample and the second biological sample are measured substantially simultaneously, it is preferred to store the first biological sample properly until the measurement is started. If necessary, the second biological sample may also be stored properly until the measurement is started.

[0086] Hereinafter, the present invention will be described in more detail with reference to examples. However, the present invention is not limited to these examples.

EXAMPLES

[Production Example] Production of Monoclonal Antibody Capable of Recognizing Integrin Binding Site of Human TGF- LAP Degradate

(1) Production of Antigen

[0087] A polypeptide having a mutation R278A inserted to TGF-1-LAP (amino acid residues at position-30 to position-390) was produced. A polynucleotide, which had a sequence in which a His tag was added to a gene sequence encoding the polypeptide, was linked to the downstream of lgk signal, and the resultant polynucleotide was expressed in a HEK293F cell using a pOrip vector. A TGF-1-LAP was purified from a soluble fraction using HisTrap (manufactured by GE healthcare) in accordance with the manufacturer's written usage instructions. The His tag was cut out with TEV protease, and the resultant TGF-1-LAP was loaded onto the HisTrap column again, and a fraction passing through the column was collected. The fraction was purified by a known method using a gel filtration column (Superdex 200 Increase 10/300 GL, manufactured by GE Healthcare), and a low-molecular-weight fraction was collected. The low-molecular-weight fraction thus collected was used as an antigen.

(2) Production and Screening of Hybridoma

[0088] A female Balb/c mouse was immunized with the antigen, and a hybridoma capable of producing an antibody against a human TGF- LAP degradate is produced by the method disclosed in Kohler and Milstein, Nature, vol. 256, p. 495-497, 1975. With respect to the hybridoma thus produced, a cell line capable of producing an antibody exhibiting reactivity to the antigen was selected by an ELISA method. The selected hybridoma was cloned by a limiting dilution method to further select a cell line capable of producing an antibody against the human TGF- LAP degradate stably.

(3) Purification of Monoclonal Antibody

[0089] A culture supernatant of the hybridoma (100 mL) was filtrated through a 0.22-m filter to remove insoluble matters. A filtrated culture supernatant was passed through a column having 1 mL of Protein G-sepharose 4B (manufactured by GE Healthcare) packed therein to adsorb the antibody onto the column. A non-specific adsorption matter is removed from the column, and then the column was placed under an acidic condition to liberate a monoclonal antibody. The collected monoclonal antibody was dialyzed with 100-fold volume of phosphate-buffered saline (PBS) to produce a purified monoclonal antibody. The monoclonal antibody thus produced was also called an anti-LAP-D antibody (A10) hereinafter, and was used in the following examples.

[Example 1] Comparison Between Anti-LAP-D Antibody (A10) and Commercially Available Anti-LAP Antibody

[0090] In order to evaluate the sensitivity of a sandwich ELISA method using the anti-LAP-D antibody (A10) as a detection antibody, a comparison test between the anti-LAP-D antibody (A10) and three commercially available anti-LAP antibodies was carried out.

(1) Conditions for Test

(1.1) Preparation of Detection Antibodies

[0091] Each of the anti-LAP-D antibody (A10), an anti-LAP antibody (141402, manufactured by BioLegend), an anti-LAP antibody (349702, manufactured by BioLegend) and an anti-LAP antibody (MA5-17186, manufactured by Thermo Fisher Scientific) was labeled with biotin using Biotin Labeling Kit-NH.sub.2 (Cat #LK03, manufactured by Dojindo Molecular Technologies, Inc.) to produce a detection antibody. Each of the detection antibodies thus produced was diluted with an antibody dilution solution (HEPES containing 10 g/mL of mouse IgG) to produce a solution of each of the detection antibodies (5 g/mL each).

(1.2) Preparation of Calibration Curve Standard Substance (LAP-D)

[0092] Human recombinant LAP (20 g/mL, manufactured by R&D) (7.0 L), PLK (59.3 g/mL, manufactured by Sigma-Aldrich) (9.4 L) and PBS (83.6 L) were mixed together, and the resultant mixed solution was incubated at 37 C. for 1 hour to obtain a LAP-D solution. The molecular weight of LAP was determined as 27 kDa, and the concentration of the LAP-D solution was 52 nM. The LAP-D solution was diluted 800 folds with 1% BSA/TBS, and the upper limit of a calibration curve was preset to 65 pM. The diluted LAP-D solution was further diluted to prepare a dilution series (32.5 pM, 16.3 pM, 8.1 pM, 4.1 pM, 2.0 pM, 1.0 pM and 0 pM).

(1.3) Preparation of Capture Antibody

[0093] As a capture antibody, an antibody against a LAP-D, which is disclosed in U.S. Patent Application Publication No. 2011/0071278 (also referred to as anti-L59 LAP-D antibody, hereinafter) was used. The antibody recognizes specifically a cut face of LAP that is cut with PLK, i.e., a region comprising a leucine residue located at the N-terminal of the amino acid sequence of SEQ ID NO: 3. The anti-L59 LAP-D antibody was diluted with TBS to produce a capture antibody solution (20 g/mL).

(2) Test Method

[0094] The capture antibody solution was dispensed in a plate in which six NN modules F8 MaxiSorp (manufactured by NUNC) were set in one frame at a volume of 50 L per well, and the plate was incubated at 4 C. overnight. The plate was washed three times with a wash solution (TBS containing 0.05% of Tween20) at a volume of 200 L per well. A blocking solution (TBS containing 1% of BSA) was dispensed at a volume of 350 L per well, and the plate was incubated at 4 C. overnight. The blocking solution was removed, and a calibration curve standard substance which was diluted to eight different levels was dispended at a volume of 50 L per well (n=3), and the plate was incubated at 4 C. overnight. The plate was washed three times with the wash solution as mentioned above, then the solution of each of the detection antibodies was dispensed at a volume of 50 L per well, and then the plate was incubated at 4 C. for three hours. The plate was washed three times with the wash solution as mentioned above, then an alkaline phosphatase-streptavidin solution (0.05 g/mL) was dispensed at a volume of 50 L per well, and then the plate was incubated at room temperature for three hours. The plate was washed three times with the wash solution as mentioned above, then a chromogenic substrate solution (4-nitrophenylphosphate) was dispensed at a volume of 100 L per well, and then the plate was incubated at 4 C. overnight. The plate was warmed to room temperature, and then an absorbance at 405 nm was measured. The absorbance measurement values were plotted against the LAP-D concentrations of the calibration curve standard substance to produce a calibration curve.

(3) Results

[0095] The calibration curves for the detection antibodies are shown in FIGS. 4A to 4D, respectively. As apparent from these drawings, a calibration curve showing quantitativeness was produced only when the anti-LAP-D antibody (A10) was used as a detection antibody. It was demonstrated that the anti-LAP-D antibody (A10) had high sensitivity to a LAP-D produced using PLK and was useful as a detection antibody for an ELISA method for detecting a LAP-D.

[Example 2] Evaluation of Usefulness of Anti-LAP-D Antibody (A10)

[0096] In order to evaluate the usefulness of the anti-LAP-D antibody (A10), a LAP-D in a human plasma specimen was measured by employing an ELISA method. For comparison, the measurement of an anti-LAP-D antibody in a commercially available LAP-D detection ELISA kit was carried out under the same conditions.

(1) Conditions for Test

(1.1) Biological Samples

[0097] Blood was collected several multiple times at certain intervals from each of six patients who had been infected with hepatitis C virus and had received the administration of a direct-acting antiviral agent (DAA) to obtain plasma specimens (48 specimens). Each of the plasma specimens was diluted 20-fold with a blocking solution (TBS containing 1% of BSA) and was then used for the measurement. With respect to these plasma specimens, a LAP-D was measured in advance using a commercially available LAP-D detection ELISA kit (manufactured by R&D Systems), and specimens for which the measurement was impossible and specimens which showed very small measurement values were selected. The measurement was carried out in accordance with the manual included in the kit. In Example 2, the selected specimens were used.

(1.2) Detection Antibody, Capture Antibody and Calibration Curve Standard Substance

[0098] As a detection antibody, a biotin-labeled anti-LAP-D antibody (A10) which was prepared in the same manner as in Example 1 was used. As a detection antibody for comparison purpose, a biotin-labeled anti-human LAP TGF-1 antibody (BAM2462, manufactured by R&D Systems) (also referred to as an BAM2462 antibody, hereinafter) in the above-mentioned LAP-D detection ELISA kit was used. Each of the detection antibodies was diluted with an antibody dilution solution (HEPES containing 10 g/mL of mouse IgG) to produce a solution of each of the detection antibodies (2.5 g/mL each). A calibration curve standard substance and a capture antibody were prepared in the same manner as in Example 1.

(2) Test Method

[0099] The capture antibody solution was dispensed in plates in which eight NN modules F8 MaxiSorp (manufactured by NUNC) were set in four frames (two platestwo types of antibodies) at a volume of 50 L per well, and the plates were incubated at 4 C. overnight. The plates were washed and blocked in the same manner as in Example 1. The blocking solution was removed, and each of the calibration curve standard substance which was diluted to eight different levels and a 20-fold-diluted plasma specimen was dispended at a volume of 50 L per well (n=3), and the plates were incubated at 4 C. overnight. The plates were washed in the same manner as in Example 1, then the solution of each of the detection antibodies was dispensed in each well, and then the plates were incubated at 4 C. for three hours. The plates were washed, then a chromogenic substrate solution was dispensed to each well, and then the plates were incubated, and then the absorbance at 405 nm was measured, in the same manner as in Example 1.

(3) Processing of Data

[0100] A calibration curve was produced for each of the plates. One example of the calibration curve for each of the detection antibodies is shown in each of FIGS. 5A and 5B. The value for a LAP-D in each of the 20-fold-diluted plasma specimens was obtained from each of the calibration curves. A value obtained by multiplying the value for the LAP-D by 20 was employed as a value of the concentration of the LAP-D in each of the plasma specimens. When a value obtained from the calibration curve is a negative value, the value was deemed as 0 pM. The graphs of the concentrations of LAP-D in the individual plasma specimens which were measured for five patients are shown in FIGS. 6A and 6B.

(4) Results

[0101] As shown in FIGS. 5A and 5B, the slope of the calibration curve which was produced using the anti-LAP-D antibody (A10) was larger. The quantitativeness of a LAP-D in the measurement using the anti-LAP-D antibody (A10) was equivalent to or more than that in the measurement using the BAM2462 antibody. As apparent from FIGS. 6A and 6B, many specimens in which the LAP-D was detected were confirmed only when the anti-LAP-D antibody (A10) was used as a detection antibody. From these results, it was demonstrated that, when it was intended to measure a LAP-D in a biological sample such as a plasma specimen, an ELISA method using the anti-LAP-D antibody (A10) was useful.

[Example 3] Analysis of Amino Acid Sequence for Anti-LAP-D Antibody (A10)

[0102] (1) Preparation of RACE-Ready cDNA Library

[0103] A frozen stock of an anti-LAP-D antibody (A10)-producing hybridoma (110.sup.7 cells/vial, one bottle) was thawed, and the resultant solution was centrifuged at 500 g for 5 minutes to remove a supernatant from the solution, thereby obtaining cells. mRNA was prepared from the cells using GenElute Direct mRNA Miniprep Kit (manufactured by Sigma-Aldrich). The mRNA thus produced was measured using a nucleic acid quantification apparatus Nano Drop 2000 (manufactured by Thermo Fisher Scientific) to quantify the concentration of the mRNA. RACE-Ready cDNA was prepared from 100 g of the mRNA using SMARTer RACE5/3Kit (manufactured by Clontech). As a primer, a 5-CDR primer included in the kit was used.

(2) Amplification of Antibody Gene

[0104] An antibody gene (heavy chains and light chains) was amplified using 200 ng of the RACE-Ready cDNA as a template and using a DNA polymerase KOD Plus neo (manufactured by TOYOBO) on a scale of 50 L. As a forward primer, a 1/10 volume of Universal Primier Mix included in SMARTer RACE5/3Kit was used. As reverse primers, three primers for light chains and three primers for heavy chains were respectively used. The composition of a reaction solution was prepared in accordance with the manual included in the kit. The reaction conditions were as follows: a denaturation procedure at 94 C. for 2 minutes was carried out, and then a two-step procedure including at 96 C. for 10 seconds and 68 C. for 80 seconds was carried out 35 cycles.

(3) Analysis of Sequence for Antibody Gene

[0105] An amplification product of the PCR was electrophoresed at 100 V for 30 minutes in a 2% agarose gel (containing 1/20000 GelGreen Nucleic Acid Gel Stain (manufactured by Biotium)). After the electrophoresis, a band of an amplification product corresponding to each of the reverse primers was excised from the gel under the irradiation with a green LED. DNA was extracted from the gel containing the band using Wizard SV Gel and Clean-Up System (manufactured by Promega). The analysis of the nucleotide sequence for the DNA was outsources to Eurofins Genomics K.K. Three pieces of sequence information on the light chain and three pieces of sequence information on the heavy chain were analyzed using an analysis software Genetyx Ver.14.1 (Genetyx Corporation), and the pieces of sequence information on the light chain and the pieces of sequence information on the heavy chain each were automatically integrated.

(4) Results

[0106] The amino acid sequences for the light chain and the heavy chain in the anti-LAP-D antibody (A10) are as follows.

TABLE-US-00006 Lightchain (SEQIDNO:20) MDMRVPAHVFGLLLLWFPGTRCDIQMTQSPSSLSASLGERVSLTCRAS HEISGYLGWLQRQPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTIS SLESEDFADYYCLQYASYPFTFGSGTKLEVKRADAAPTVSIFPPSSEQLT SGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS STLTLTKDEVERHNSYTCEATHKTSTSPIVKSFNRNEC Heavychain (SEQIDNO:21) MGWSSIILFLVATATGVHSQVQLQQPGAELVRPGASVKLSCKTSGYSF TRFWMNWVRQRPGQGLEWIGMIHSSDSITRLNQKFKDKATLTLDYSSSTA YMQLSSPTSEDSAVYYCARGYDEYSAMDYWGQGTSVPVSSAKTTPPSVYP LAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICT VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVE VHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIE KTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQW NGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLH NHHTEKSLSHSPGK

[0107] The amino acid sequences for the light chain variable region and the heavy chain variable region in the anti-LAP-D antibody (A10) are as follows.

TABLE-US-00007 Lightchainvariableregion (SEQIDNO:18) DIQMTQSPSSLSASLGERVSLTCRASHEISGYLGWLQRQPDGTIKRLIYA ASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASYPFTFGS GTKLEVKRA Heavychainvariableregion (SEQIDNO:19) QVQLQQPGAELVRPGASVKLSCKTSGYSFTRFWMNWVRQRPGQGLE WIGMIHSSDSITRLNQKFKDKATLTLDYSSSTAYMQLSSPTSEDSAVYYCA RGYDEYSAMDYWGQGTSVPVSS

[0108] The amino acid sequences for CDR1, CDR2 and CDR3 in the light chain and CDR1, CDR2 and CDR3 in the heavy chain in the anti-LAP-D antibody (A10) are as follows. The amino acid sequences for these CDRs are sequences based on the Kabat classification.

TABLE-US-00008 LightchainCDR1: (SEQIDNO:12) RASHEISGYLG LightchainCDR2: (SEQIDNO:13) AASTLDS LightchainCDR3: (SEQIDNO:14) LQYASYPFT HeavychainCDR1: (SEQIDNO:15) RFWMN HeavychainCDR2: (SEQIDNO:16) MIHSSDSITRLNQKFKD HeavychainCDR3: (SEQIDNO:17) GYDEYSAMDY

[Example 4] Evaluation of Reactivity of Anti-LAP-D Antibody (A10)

[0109] The present inventors produced an anti-LAP-D monoclonal antibody (referred to as A2D109 antibody, hereinafter) that is different from the anti-LAP-D antibody (A10), and have clearly demonstrated that the A2D109 antibody can bind to an integrin binding site of a LAP-D by the X-ray crystal structure analysis of the antibody (see the below-mentioned Reference Example). The A2D109 antibody has light chain CDR1 to CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 4 to 6; and heavy chain CDR1 to CDR3 respectively consisting of the amino acid sequences of SEQ ID NOs: 7 to 9. The A2D109 antibody comprises: alight chain comprising a variable region consisting of the amino acid sequence of SEQ ID NO: 10; and a heavy chain including a variable region consisting of the amino acid sequence of SEQ ID NO: 11. In order to evaluate the reactivity of the anti-LAP-D antibody (A10), it was examined as to whether or not the anti-LAP-D antibody (A10) competed with A2D109 for the binding to a LAP-D by an SPR analysis using Biacore (registered trademark) device. For comparison, the same analysis was also carried out using the BAM2462 antibody.

(1) Conditions for Test

(1.1) Preparation of Antigen (Analyte)

[0110] Preparation of Human TGF-1 LAP-D

[0111] A polynucleotide comprising a sequence in which a linker sequence capable of being cut with TEV protease and a His tag were added to a gene sequence encoding TGF-1-LAP (amino acid residues position-30 to position-390) was linked to the downstream of an lgk signal, and the resultant polynucleotide was expressed in a HEK293F cell using a pOrip vector. TGF-1-LAP was purified from a soluble fraction using HisTrap (manufactured by GE healthcare) in accordance with the manufacturer's written usage instructions. The His tag was cut out with TEV protease, and the resultant TGF-1-LAP was loaded onto the HisTrap column again, and a fraction passing through the column was collected. The fraction was purified in the conventional manner through a cation exchange column (HiTrap SPHP, manufactured by GE Healthcare) to prepare a human TGF-1 LAP-D. The molecular weight of the human TGF-1 LAP-D was 41653 Da.

[0112] Preparation of Complex of Human TGF-1 LAP-D and A2D109 Antibody Fab Fragment

[0113] A Fab fragment (A2D109 Fab) was prepared from the A2D109 antibody using Pierce (trademark) Mouse IgG1 Fab and F(ab)2 Preparation Kit (manufactured by Thermo Fisher). The concrete operation of the procedure was carried out in accordance with the manual included in the kit. A reaction solution produced by the procedure was purified by gel filtration using Superdex 200 Increase 10/300 GL (manufactured by GE Healthcare). A 50-kDa elution fraction was collected, and the fraction was used as A2D109 Fab. Purified recombinant TGF-1-LAP and purified A2D109 Fab were mixed together at a molar mixing ratio of 1:1. A complex thus produced was purified by gel filtration chromatography (HiLoad 16/600 Superdex 200 pg, manufactured by GE Healthcare) using a column equilibrated with a buffer composed of 20 mM Tris-HCl (pH 8.0), 150 mM NaCl and 10% glycerol. The complex had a molecular weight of 89514 Da.

(1.2) Measurement Using Biacore (Registered Trademark)

[0114] Each of the anti-LAP-D antibody (A10) and the BAM2462 antibody was immobilized on a Biacore (registered trademark) sensor chip Series S Sensor Chip CM5 (manufactured by GE Healthcare). The amounts of these antibodies immobilized were 2027 RU and 310 RU, respectively. Each of a solution of human TGF-1 LAP and a solution of a complex of human TGF-1 LAP and A2D109 Fab was diluted with a buffer composed of 10 mM of HEPES-NaOH (pH 7.5), 150 mM of NaCl, 3 mM of EDTA and 0.005% of Surfactant P-20 to prepare solutions having various concentrations. Each of these solutions was fed to Biacore (registered trademark) T200 (manufactured by GE Healthcare). The analyte concentration in each of the solutions and the measurement conditions are shown below. Measurement data were analyzed using Biacore (registered trademark) Evaluation software to acquire date on the affinity of each of the antibodies. Sensorgrams are shown in FIGS. 7A and 7B. Parameters are shown in Table 1.

[Analyte Concentrations]

[0115] 1.56 nM, 3.13 nM, 6.25 nM, 12.5 nM and 25 nM

[Measurement Conditions]

[0116] Association: 30 L/min, 60 sec

[0117] Dissociation: 30 L/min, 60 sec

[0118] Regeneration: Gly-HCl (pH 1.5)/60 L/min, 60 sec

TABLE-US-00009 TABLE 1 Rmax Chi.sup.2 Ligand Analyte ka (1/Ms) kd (1/s) KD (M) (RU) (RU.sup.2) U-value BAM2462 TGF- LAP 1.40E+06 2.34E05 1.67E11 174.2 0.373 20 TGF- LAP-A2D109Fab 4.47E+05 1.54E04 3.45E10 150.5 0.916 7 A10 TGF- LAP 1.95E+05 4.17E05 2.14E10 178.4 0.631 15 TGF- LAP-A2D109Fab 3.04E+05 2.01E04 5.64E10 43.53 0.171 3

[0119] An Rmax residual ratio (%) was calculated from an Rmax value of binding of each of the anti-LAP-D antibody (A10) and the BAM2462 antibody to each of the antigens (analytes) in accordance with the formula shown below. An Rmax residual ratio (%) with taking the antigen:antibody molecular weight ratio into consideration was also calculated. The results are shown in Table 2.

[0120] (Rmax residual ratio)=[(Rmax value of binding between antibody and complex of LAP-D and A2D109 Fab)/(Rmax value of binding between antibody and LAP-D)]100

[0121] (Rmax residual ratio with taking molecular weight ratio into consideration)=[(Rmax value of binding between antibody and complex of LAP-D and A2D109 Fab)/(molecular weight of complex of LAP-D and A2D109 Fab)]/[(Rmax value of binding between antibody and LAP-D)/(molecular weight of LAP-D)]100

TABLE-US-00010 TABLE 2 Rmax residual ratio Rmax (Rmax residual ratio with Rmax residual taking molecular weight Ligand Analyte (RU) ratio ratio into consideration) BAM2462 TGF- LAP 174.2 ` TGF- LAP-A2D109Fab 150.5 86.4% 40.2% A10 TGF- LAP 178.4 TGF- LAP-A2D109Fab 43.53 24.4% 11.4%

[0122] As shown in Table 2, the reactivity of the BAM2462 antibody in the presence of the A2D109 antibody (reference antibody) was remained by 86.4% relative to that in the absence of the reference antibody, while the reactivity of the anti-LAP-D antibody (A10) was decreased to 24.4% due to the presence of the A2D109 antibody. Namely, the Rmax value of binding between the anti-LAP-D antibody (A10) and the LAP-D in the presence of the reference antibody was decreased by 75.6% compared with that in the absence of the reference antibody. As shown in FIG. 7A, in the sensorgram for the binding of the BAM2462 antibody to the LAP-D, the response was increased both in the presence of the A2D109 antibody and the absence of the A2D109 antibody. In contrast, as shown in FIG. 7B, in the sensorgram for the binding of the anti-LAP-D antibody (A10) to the LAP-D, the response was not increased so greatly due to the presence of the A2D109 antibody. From these results, it was suggested that the epitope of the anti-LAP-D antibody (A10) was the same as the epitope of the A2D109 antibody or was located in the vicinity of the epitope of the A2D109 antibody.

[Reference Example] X-Ray Crystal Structure Analysis of Complex of A2D109 Antibody Fv Fragment and TGF-1-LAP (C33S/N176Q)

(1) Conditions for Test

(1.1) Expression and Purification of TGF-1-LAP (C33S/N176Q)

[0123] A TGF-1-LAP (amino acid residues at position-30 to position-390) which was fused to a His tag through a linker capable of being cut with TEV protease and to which a mutation (C33S/N176Q) was introduced into two sites was linked to the downstream of an lgk signal, and the resultant product was expressed in a HEK293F cell using a pOrip vector. The TGF-1-LAP was purified from a soluble fraction using HisTrap (manufactured by GE healthcare) in accordance with the manufacturer's written usage instructions. The His tag was cut with TEV protease, then the resultant TGF-1-LAP was loaded onto the HisTrap column again, then a fraction passing through the column was collected, and then the TGF-1-LAP was prepared in the conventional manner using a cation exchange column (HiTrap SP HP, manufactured by GE Healthcare).

(1.2) Expression and Purification of A2D109 Antibody Fv Fragment (A2D109 Fv)

[0124] An A2D109 Fv (heavy chain and light chain) which was fused to a His tag through a linker capable of being cut with TEV protease was expressed in an E. coli cell-free system using a pCR.2.1 vector. A soluble fraction was passed through a HisTrap column (manufactured by GE healthcare) to purify A2D109 Fv. The His tag was cut out with TEV protease, then the resultant A2D109 Fv was loaded onto the HisTrap column again, then a fraction passing through the column was collected, and the A2D109 Fv was further purified using an anion exchange column (HiTrap Q HP, manufactured by GE Healthcare). A fraction containing the Fv was pooled and was stored at 80 C.

(1.3) Preparation of Complex of A2D109 Fv and TGF-1-LAP (C33S/N176Q)

[0125] The purified recombinant TGF-1-LAP and the purified Fv were mixed together at a molar mixing ratio of 1:1.2. A complex thus produced was purified by gel filtration chromatography (HiLoad 16/600 Superdex 200 pg, manufactured by GE Healthcare) using a column equilibrated with a buffer composed of 20 mM of Tris-HCl (pH 8.0), 150 mM of NaCl and 10% of glycerol.

(1.4) Crystallization

[0126] The purified complex was concentrated to about 6 mg/mL, and was then crystallized by a sitting drop vapor diffusion crystallization method combined with a seeding method at 25 C. A reservoir solution used was composed of 25% w/v of polyethylene glycol 3350 and 0.1 M of HEPES (pH 7.5). In this manner, a plate-like crystal was obtained successfully in about 1 week. The crystal was immersed in a solution composed of 25% w/v of polyethylene glycol 3350, 0.1 M of HEPES (pH 7.5) and 5% of glycerol.

(1.5) Collection of Data and Determination of Structure

[0127] X-ray diffraction data was measured by employing BL32XU in SPring-8. During the measurement, the crystal was placed under the nitrogen stream at 178 C. at all time to keep the frozen state of the crystal, and X-ray diffraction images (1800 images in total) were collected using a PAD (EIGER-9M) detector connected to a beam line while rotating the crystal at an angle of 0.1 per one rotation. The determination of a cell parameter, the indexing of a diffraction spot and the processing of diffraction data acquired from the diffraction images were carried out using a XDS package (Acta. Cryst. D66:125-132 (2010)). In this manner, diffraction intensity data at a resolution of 2.93 were acquired eventually. The crystallographic data statistic values are shown in Table 3.

[0128] The structure was determined by molecular replacement using a program Phaser (J. Appl. Cryst. 40:658-674 (2007)). The search model for TGF-1 was derived from a disclosed pro-TGF-1 crystal structure (PDB code: 3RJR), and the search model for the Fv was derived from an Fv region of a disclosed norovirus crystal structure (PDB code: 4NCC). Each of these models was constructed using Coot program (Acta Cryst. D66:486-501(2010)) and was then refined using a program Phenix (Acta Cryst. D66:213-221 (2010)). The crystallographic reliability factor (R) of the diffraction intensity data at 46.71-2.93 was 22.14%, and the Free R value was 29.76%. The structure refinement statistic values are shown in Table 3.

TABLE-US-00011 TABLE 3 Collection of X-ray data and refinement statistic values Collection of data Space group P2.sub.1 Unit cell a, b, c (custom-character ) 86.85, 160.58, 95.76 , , () 90, 92.97, 90 Resolution (custom-character ) 46.71-2.93 Number of total reflections 195841 Number of independent reflections 55631 Completeness (outermost shell) (%) 98.73 (97.38) R.sub.merge .sup.a(outermost shell) (%) 10.5 (96.2) Refinement Resolution (custom-character ) 46.71-2.93 Number of reflections 54068 R factor.sup.b (R.sub.free.sup.c) (%) 22.14 (29.76) rms deviation from desired value Bond distance (custom-character ) 0.011 Bond angle () 1.394 .sup.a; R.sub.merge = hkl j | IJ (hkl)-<I (hk1) >I | / hkl j | Ij (hkl), wherein Ij (hki) and <I (hk1)> respectively represent the intensity of a measurement j having an index hkl and the average intensities of reflections of the measurement j. .sup.b; R factor = hkl | F.sub.calc, (hkl) |-| F.sub.obs (hkl) | / hkl | F.sub.obs (hkl) |, wherein F.sub.obs and F.sub.calc, respectively represent a found amplitude and a calculated amplitude of the structure factor. .sup.c; R.sub.free is calculated using a value corresponding to 3.6% of the reflection that is randomly excluded.

(2) Results

[0129] As the results of the above-mentioned structure determination, it was found that the A2D109 antibody binding site was an RGD sequence that was an integrin binding site of a human TGF-1 LAP-D.

SEQUENCE LISTING

[0130] Japanese Patent Application No. 19-009JP2019-133839_3.app