Selective enrichment of antibodies
10894806 ยท 2021-01-19
Assignee
Inventors
- Dorothee AMBROSIUS (Laupheim, DE)
- Michael DIETERLE (Biberach an der Riss, DE)
- Philine DOBBERTHIEN (Warthausen, DE)
- Maria-Katharina WIEGESHOFF (Ludwigshafen am Rhein, DE)
Cpc classification
International classification
Abstract
The invention relates to a process for the selective concentration of immunoglobulins or other proteins that contain an Fc domain (target protein), comprising the following steps: a. preparing a solution that contains the target protein; b. incorporating an Fc-binding protein with precisely two binding sites under conditions that allow binding to occur; c. separating the precipitate from the liquid phase; d. undoing the binding of the target protein from the Fc-binding protein.
Claims
1. Process for the selective concentration of a target protein which is an immunoglobulin or another protein containing an Fc domain, comprising the following steps: a. preparing a solution that contains the target protein; b. incorporating an Fc-binding protein with precisely two binding sites under conditions that allow binding to occur; c. separating precipitate from liquid phase; d. separating the Fc-binding protein from the target protein; wherein the Fc-binding protein is a dimer of an Fc-binding domain that comprises one of the sequences represented by SEQ ID NO:1 to SEQ ID NO:11, wherein the Fc-binding protein is not conjugated to a polymer, and wherein the Fc-binding protein is not conjugated to protein A.
2. The process according to claim 1, wherein monomers of the dimer are linked together by a disulphide bridge.
3. The process according to claim 1, wherein the Fc-binding protein is used in a molar ratio of 0.5-20 in relation to the target protein.
4. The process according to claim 1, wherein the solution in step a. has a pH of 5.5-9.
5. The process according to claim 4, wherein the solution in step a. has a pH of 6-8.
6. The process according to claim 1, wherein the separating in step d. takes place at a pH of 2-4.5.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2) TABLE-US-00001 Trace Sample 1 recombinant Z-dimer mixed with 0.6 mol iodoacetamide 2 recombinant Z-dimer mixed with 0.3 mol DTT and iodoacetamide 3 pure recombinant Z-dimer 4 Kombi marker 5 recombinant Z-dimer mixed with 0.2 mol iodoacetamide 6 recombinant Z-dimer mixed with 0.1 mol DTT and 0.2 mol iodoacetamide 7 pure recombinant Z-dimer
(3)
(4)
(5)
(6) TABLE-US-00002 Trace Sample 1 purified antibody 2 protein Z dimer 3 supernatant after precipitation 4 supernatant after an optional washing step 5 resuspended pellet (antibody with Z-dimer) 6 peak 1 of the ion exchange chromatography at an acid pH (antibody) 7 peak 2 of the acid ion exchange chromatography at an acid pH (Z-dimer) 8 Kombi marker
DETAILED DESCRIPTION OF THE INVENTION
(7) The present invention relates to methods of depleting impurities, particularly host cell protein (HCP) and DNA, from protein compositions of the kind obtained from cell cultures in which proteins are expressed recombinantly or endogenously. In particular, the invention relates to methods of purifying or concentrating a protein (target protein) by binding an Fc-binding protein or multimer thereof with at least two binding sites. In further steps the precipitate is separated off and then the binding of the Fc-binding protein to the target protein is removed using suitable conditions.
(8) The present invention relates to a process for the selective concentration of immunoglobulins or other proteins that contain an Fc domain (target protein), comprising the following steps: a. preparing a solution that contains the target protein; b. incorporating an Fc-binding protein with precisely two binding sites under conditions that allow binding to occur; c. separating the precipitate from the liquid phase; d. undoing the binding of the target protein from the Fc-binding protein.
(9) The target protein may be in particular an immunoglobulin or a protein that contains the Fc domain of an immunoglobulin and can bind to protein A or fragments of protein A.
(10) Immunoglobulins consist of two heavy and two light chains. The heavy chains each have one variable and three to four constant domains depending on the immunoglobulin. These are referred to analogously as VH and CH1, CH2, CH3. The variable domains of a light and a heavy chain form the antigen binding site. The domain CH2 contains a carbohydrate chain which forms a binding site for the complement system. The CH3 domain contains the Fc-receptor binding site. Target proteins to which the process according to the invention can be applied are all proteins that have an Fc domain. Examples of proteins that contain CH2/CH3 regions are antibodies, immunoadhesins and fusion proteins in which the protein of interest is connected to a CH2/CH3 region. In one embodiment of the invention, the target protein is for example an antibody that has a CH2/CH3 region and is thus capable of binding to protein A. The term CH2/CH3 region refers to the amino acids in the Fc region of an antibody that interact with protein A.
(11) The Fc-binding protein comprises according to the invention precisely two binding sites for one Fc domain.
(12) In another aspect the invention relates to a process wherein the Fc-binding protein is a dimer of an Fc-binding domain of protein A or protein G. The two monomers of the dimer are preferably linked together by a disulphide bridge.
(13) By an Fc-binding protein are meant proteins or peptides which are capable of binding to the Fc region. Preferably, Fc-binding proteins bind with a dissociation constant (K.sub.D value) in the range from 10.sup.2-10.sup.13M.
(14) In preferred embodiments of the invention the Fc-binding protein is a homo- or heterodimer of Fc-binding domains which comprise or contain the sequences listed in Table 1:
(15) TABLE-US-00003 SEQ Sequence IDNO: Description 1 MVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPS Z-domainCystag QSANLLAEAKKLNDAQAPKSSACRRRRRRRRP 2 MVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPS Z-domainCys QSANLLAEAKKLNDAQAPKSSAC 3 DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQS Z-domain ANLLAEAKKLNDAQAPK 4 QQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEA Edomainof QKLNDSQAPK proteinA (SwissprotP02967) 5 QNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQS Ddomainof TNVLGEAKKLNESQAPK proteinA (SwissprotP02967) 6 DNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQS Cdomainof ANLLSEAKKLNESQAPK proteinA (SwissprotP02967) 7 DNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQS Bdomainof ANLLAEAKKLNDAQAPK proteinA (SwissprotP02967) 8 DNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVS Adomainof KEILAEAKKLNDAQAPK proteinA (SwissprotP02967) 9 TTYKLVINGKTLKGETTTKTVDAETAEKAFKQYANDNGVD proteinGFc- GVWTYDDATKTFTVT bindingdomain fromStreptococcusSp. (UniprotQ53337) 10 TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVD proteinGFc- GVWTYDDATKTFTVT bindingdomain fromStreptococcus dysgalactiae (YP_002997067) 11 TTYRLVIKGVTFSGETATKAVDAATAEQTFRQYANDNGIT IgGbindingdomain GEWAYDTATKTFTVTE fromStreptococcusequi (YP_002123072)
(16) By a homodimer is meant, in this context, an Fc-binding protein that is made up of two sub-units of the same sequence.
(17) By a heterodimer is meant, in this context, an Fc-binding protein that is made up of two sub-units of different sequences, each of which has a binding site for an Fc domain. Preferably, the sub-units contain sequences that are selected from the sequences in Table 1.
(18) In another aspect, the invention relates to a process in which the dimer is a homodimer the monomers of which have SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3 or a sequence that differs from SEQ ID NO. 1 in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids. The monomers that differ from SEQ ID NO. 1 in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids have the property of binding Fc-domains with a K.sub.D value in the range from 10.sup.2-10.sup.13M.
(19) Binding conditions are conditions in which binding to the target protein by the Fc-binding proteins takes place, preferably in a pH range of pH 5.5-9, preferably 6-8.
(20) The precipitation occurs spontaneously under binding conditions, such as those found for example in cell-free eukaryotic culture supernatant. There is no need to link the dimers according to the invention to polymers, e.g. polyethyleneglycols, in order to promote precipitation with polymers.
(21) In another aspect the Fc-binding protein is used in a molar ratio of 0.5-20 relative to the target protein.
(22) The separation of the precipitate may be carried out by centrifugation and subsequent removal of the supernatant, but also by filtration techniques.
(23) The undoing of the binding to the target protein is carried out under conditions that enable the Fc-binding protein to be separated from the target protein. Preferably, this can be done by adjusting the pH to a range between pH 2 and 4.5.
(24) In another aspect the invention relates to an Fc-binding protein that consists of 2 identical sub-units that have the sequence SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, or a sequence that differs from SEQ ID NO. 1 in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids, wherein the two sub-units are linked together by a covalent bond. Preferably, the covalent bond is a disulphide bond.
EXAMPLES
(25) Equipment and Methods:
(26) Preparation of the Dimerised Protein Z
(27) Protein Z was obtained as a recombinant protein from E. coli. The removal of impurities was carried out after separation of the cell debris by ion exchange chromatography.
(28) Protein sequence of the Z domain used:
(29) TABLE-US-00004 (SEQIDNO:1) Met-Val-Asp-Asn-Lys-Phe-Asn-Lys-Glu-Gln-Gln-Asn-Ala-Phe-Tyr-Glu-Ile-Leu-His-Leu- Pro-Asn-Leu-Asn-Glu-Glu-Gln-Arg-Asn-Ala-Phe-Ile-Gln-Ser-Leu-Lys-Asp-Asp-Pro-Ser- Gln-Ser-Ala-Asn-Leu-Leu-Ala-Glu-Ala-Lys-Lys-Leu-Asn-Asp-Ala-Gln-Ala-Pro-Lys-Ser- Ser-Ala-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Pro
(30) By inserting a non-native cysteine into the peptide chain of the Z domain it is possible to deliberately connect two protein Z molecules via a disulphide bridge. Directly after the purification of the recombinant protein Z the latter is obtained by oxidation as a dimerised protein.
(31) Cell-Free Eukaryotic Culture Supernatant
(32) The cell culture supernatant of CHO cells optimised to secretory production was obtained by filtration or centrifugation after several days' culture.
(33) SEC Analysis
(34) The analysis of protein impurities and the antibody content of the samples from Experiment 1 was carried out by analytical size exclusion chromatography (SEC). A TSK-GEL SW 3000 was used with the precolumn recommended by the manufacturer (TOSOH Bioscience). Analysis was carried out on a Dionex Ultimate apparatus with monitoring of the UV signal at 280 and 220 nm.
(35) Ion Exchange Chromatography for Separating the Z-Dimer from the Antibody
(36) The ion exchange chromatography was carried out on an KTA Explorer 10 apparatus (GE Healthcare) with observation of the UV absorption at 220 and 280 nm. The column material used was SP Sepharose FF (19 mL gel bed volume). After the application of the pellet resuspended at an acid pH, the column was equilibrated with 20 mM phosphate buffer at pH 3.3 and then the antibody and the Z-dimer were separated from one another over a 25 column volume long gradient. A 20 mM phosphate buffer with 3 M NaCl at pH 3.3 was used for the elution.
(37) Protein A HPLC
(38) Protein A HPLC on a Waters or Dionex apparatus (injector pumps and column oven W2790/5, UV detector W2489) was used to determine the antibody content of cell culture-free supernatant and purified antibody. The antibody content of the solutions was determined using the UV signal of the acidically eluting peak.
(39) Concentration
(40) The solutions obtained in the tests were partly concentrated for the analytical methods (Amicon Ultra, exclusion size 3 kD).
(41) SDS-PAGE:
(42) A 20% homogeneous SDS gel was used to test the individual fractions and supernatants. The protein bands were detected by silver staining according to Heukeshoven.
(43) Host Cell Protein Analysis by ELISA Assay
(44) In Experiment 3 the host cell protein analysis was carried out using an ELISA assay.
(45) DNA Analysis
(46) The DNA analysis was carried out after single strand production by an enzymatically catalysed detecting reaction.
(47) UF/DF
(48) A 50 kDa Centramate Sheet PES (polyethersulphone) made by Messrs Pall with a surface area of 180 cm.sup.2 was used for the UF/DF tests in Experiment 3. The UF/DF was carried out so that the antibody was initially concentrated six-fold and then diafiltered (exchanged for 6 volumes of the buffer) before being circulated for 10 min with the retentate valve fully open. The diafiltration was repeated twice. The total UF/DF was carried out with 50 mM acetate buffer+100 mM arginine+150 mM NaCl pH 3.0.
(49) Hydrophobic Interaction Chromatography (HIC)
(50) The hydrophobic interaction chromatography (Experiment 3) was carried out with a 27 mL column on an KTA apparatus. The column material used was Toyopearl Phenyl 650 M made by Tosoh. For this purpose, after the UF/DF, 3.5 M ammonium sulphate buffer was added to the retentate until a conductivity of 165 mS/cm was obtained. The column equilibrated with buffer (50 mM acetate+1.2 M ammonium sulphate pH 4) was charged with the retentate from the UF/DF and then a gradient was run over 40 bed volumes to the buffer 50 mM acetate, pH 4.
Experiments
(51) Detecting the Dimerisation of Protein Z by Cysteine
(52) Detection of the dimerisation of protein Z by cysteine was carried out by SDS-PAGE analysis (
(53) The SDS-PAGE analysis shows that the Z monomer is formed by the addition of the reducing agent DTT and the gel band of the Z dimer disappears.
(54) Selective Precipitation using a Z-Dimer
(55) The tests described below show that the selective precipitation of an antibody can be achieved with a Z-dimer (
Experiment 1
(56) Different ratios of protein Z to antibody that was present in cell-free eukaryotic culture supernatant were tested. In addition, the volume of the individual batches was varied. In test 1, 0.13 mol of Z-dimer were incubated, with shaking, with 0.065 mol of IgG4 contained in cell-free eukaryotic culture supernatant in a total volume of 5.47 mL for 2 h. In test 2, 16.25 nmol of Z-dimer were incubated, with shaking, with 16.25 nmol IgG1 contained in cell-free eukaryotic culture supernatant in a total volume of 5.2 mL, again for 2 h. Then the mixture was centrifuged for 10 min at 4000 rpm and the supernatant was separated from the pellet. The antibody content of the supernatant was determined by means of the UV signal of analytical SEC and by protein A chromatography (Equipment and Methods). The content of antibody in the pellet was determined by subtracting the antibody content of the supernatant from the total content of antibody used. A precipitation of up to 99% antibody was observed (test 1: 99%/test 2: 76%). Moreover, the culture supernatant was examined for protein impurities before and after the precipitation by analytical SEC. The chromatogram from the cell-free eukaryotic culture supernatant was compared directly with the supernatant after precipitation. Depletions of protein impurities ranging from 90-99% were observed (test 1 90%/test 2 99%). This means that 1% or 10% of the protein impurities had been co-precipitated. Protein impurities here may be both host cell proteins and fragments or aggregates of the target protein.
Experiment 2
(57) A cation exchanger (SP Sepharose FF) was used to separate the Z-dimer from the antibody. 0.2 mol of purified antibody were incubated with 0.2 mol of Z-dimer in a volume of 10.1 mL for 36 min. After subsequent centrifugation (4000 rpm, 10 min) the supernatant was removed. Then the pellet was dissolved batchwise in 10 mL phosphate buffer at pH 7.4 and centrifuged again (4000 rpm, 10 min). The pellet thus obtained was resuspended in 20 mL phosphate buffer (20 mM phosphate, pH 3.3) and purified using an ion exchanger. The Z-dimer could be separated from the antibody through a gradient over 25 bed volumes (
Experiment 3
(58) A multi-step antibody purification process was carried out with affinity precipitation as the capture step.
(59) 500 mg of antibody (3.3 mol) were used in a ratio of 1:2 to Z-dimer (6.6 mol) in the precipitation from cell-free culture supernatant. After one hour's incubation with gentle agitation, the entire suspension was added to a 0.22 m filter (Millipore) and in this way the supernatant of the precipitate was separated by filtration. The precipitate was then washed with buffer (231 mL of 50 mM phosphate buffer, pH 7.4) and in the next step resuspended in the filter with acetate buffer (179 mL 50 mM acetate buffer+100 mM arginine+150 mM NaCl pH 3.0). To separate the Z-dimer from the antibody, UF/DF was carried out with a 50 kDa membrane. The next step was HIC to separate off the Z-dimer and further impurities.
(60) The total yield of the antibody was 98% after the precipitation and decreased to 87% after UF/DF and to 64% after HIC. In addition to the good yields obtained with the selective precipitation of the antibody, DNA and host cell protein analysis showed that the DNA could be reduced by 99% by the precipitation step followed by UF/DF and the host cell protein content could be reduced by 99.9% compared with the initial value (cell-free culture supernatant).
LITERATURE
(61) 1) Labrou N, Clonis Y D. (1994) J Biotechnol. 36(2), 95-119.
(62) 2) Hilbrig F, Freitag R. (2003) J Chromatogr B Analyt Technol Biomed Life Sci. 790(1-2), 79-90.
(63) 3) Mattiasson B, Kumar A, Galaev I Yu. (1998) J Mol Recognit. 11(1-6), 211-6.
(64) 4) Vaidya A A, Lele B S, Kulkarni M G, Mashelkar R A. (1999) Biotechnol Bioeng. 64(4), 418-25.
(65) 5) Garret-Flaudy F, Freitag R. (2000-2001) Biotechnol Bioeng. 71(3), 223-34.
(66) 6) US 2006/0121519 A1 Compositions and Methods for purifying and crystallizing molecules of interest
(67) 7) H. Chmiel, Bioprozesstechnik, Spektrum Akademischer Verlag, 2nd edition 2006
(68) 8) EP1179014B1
(69) 9) Patchornik, G. and Albeck A. (2005), Bioconjugate Chem. 16, 1310-1315.
(70) 10) Wilchek, M. and Gorecki, M. (1973), FEBS Letters. 31, 1, 149-152.
(71) 11) WO2009062942 KYHSE-ANDERSEN JAN [DK] DUAL AFFINITY POLYPEPTIDES FOR PURIFICATION
(72) 12) Hoffman, Controlled release (1987) 6, 297-305.
(73) 13) Hoffmann (1997) Intelligent polymers. In: Park K, ed. Controlled drug delivery. Washington: ACS Publications 485-98.
(74) 14) Haiou Yang, Patrick V. Gurgel and Ruben G. Carbonell (2009) Journal of Chromatography A 1216, 910-918.
(75) 15) Chen and Hoffman (1990), Biomaterials 11 (9), 631-634.
(76) 16) Nilsson et al 1987. B. Nilsson, T. Moks, B. Jansson, L. Abrahmsen, A. Elmblad, E. Holmgren, C. Henrichson, T. A. Jones and M. Uhln, A synthetic IgG-binding domain based on staphylococcal protein A. protein Eng. 1 (1987), pp. 107-113
(77) 17) Tashiro, M., Tejero, R., Zimmerman, D. E., Celda, B., Nilsson, B., and Montelione, G. T. 1997. High-resolution solution NMR structure of the Z domain of staphylococcal protein A. J. Mol. Biol. 272: 573-590.