Hybrid nanoparticles containing boron-doped graphene quantum dots and applications thereof
10894020 ยท 2021-01-19
Assignee
Inventors
Cpc classification
A61K31/519
HUMAN NECESSITIES
B82Y40/00
PERFORMING OPERATIONS; TRANSPORTING
A61K9/0009
HUMAN NECESSITIES
A61K41/0028
HUMAN NECESSITIES
B82Y5/00
PERFORMING OPERATIONS; TRANSPORTING
B82Y30/00
PERFORMING OPERATIONS; TRANSPORTING
A61K47/6901
HUMAN NECESSITIES
A61K47/6929
HUMAN NECESSITIES
A61K47/6923
HUMAN NECESSITIES
International classification
A61K9/00
HUMAN NECESSITIES
A61K31/519
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Provided is a hybrid nanoparticle, including an aggregate assembled from a plurality of polymeric molecules, and a plurality of boron-doped graphene quantum dots localized in the aggregate. The polymeric molecule is preferably a pH-responsive dendrimer; the polymeric molecule and the boron-doped graphene quantum dot may be separately associated with different drugs; and hybrid nanoparticle may further include a targeting molecule, such as a rabies virus glycoprotein. Also provided is a method of controlling disassembly of a hybrid nanoparticle, including applying a high-frequency magnetic field to the hybrid nanoparticle to induce disassembly thereof. Also provided is an application of the hybrid nanoparticle for preparing a tumor-penetrating drug carrier.
Claims
1. A hybrid nanoparticle, comprising: an aggregate assembled from a plurality of polymeric molecules, and a plurality of boron-doped graphene quantum dots localized in the aggregate; wherein the polymeric molecule further binds to a hydrophilic drug or a first hydrophobic drug; wherein the boron-doped graphene quantum dot further binds to a second hydrophobic drug; wherein the hybrid nanoparticle is configured to be disassembled by applying a high-frequency magnetic field of 50 to 600 kHz; wherein the hybrid nanoparticle has a particle size of 160-450 nm; wherein each of the plurality of boron-doped graphene quantum dots has a particle size of 2-5 nm.
2. The hybrid nanoparticle of claim 1, wherein the polymeric molecule is a stimuli-responsive polymeric molecule.
3. The hybrid nanoparticle of claim 2, wherein the stimuli-responsive polymeric molecule is a pH-responsive dendrimer.
4. The hybrid nanoparticle of claim 1, further comprising a targeting molecule.
5. The hybrid nanoparticle of claim 4, wherein the targeting molecule is a rabies virus glycoprotein or a peptide fragment thereof.
6. A method of controlling disassembly of a hybrid nanoparticle, comprising the steps of (a) obtaining the hybrid nanoparticle of claim 1, and (b) applying a high-frequency magnetic field of 50 to 600 kHz to the hybrid nanoparticle to induce disassembly thereof.
7. The method of claim 6, wherein the polymeric molecule is a stimuli-responsive polymeric molecule.
8. The method of claim 7, wherein the stimuli-responsive polymeric molecule is a pH-responsive dendrimer.
9. The method of claim 6, wherein the polymeric molecule further binds to a hydrophilic drug or a hydrophobic drug.
10. The method of claim 6, wherein the boron-doped graphene quantum dot further binds to a hydrophobic drug.
11. The method of claim 9, wherein the boron-doped graphene quantum dot further binds to a hydrophobic drug.
12. The method of claim 6, wherein the hybrid nanoparticle further comprises a targeting molecule.
13. The method of claim 12, wherein the targeting molecule is a rabies virus glycoprotein or a peptide fragment thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
(17) The present invention provides a hybrid nanoparticle, including an aggregate assembled from a plurality of polymeric molecules, and a plurality of boron-doped graphene quantum dots (B-GQDs) localized in the aggregate. Each of the polymeric molecules and B-GQDs may carry different drugs. The present invention also provides a method of controlling disassembly of a hybrid nanoparticle, including the steps of obtaining the aforementioned hybrid nanoparticle, and applying a high-frequency magnetic field of 50 to 600 kHz to the hybrid nanoparticle to induce disassembly thereof. The following examples demonstrate the preparation methods of B-GQDs and self-assembly of the hybrid nanoparticle, which includes pH-responsive dendrimers as an exemplary polymeric molecule in one embodiment. The hybrid nanoparticle has been shown to have high stability in aqueous solutions, low drug leakage, and the ability to expand in size with decreasing environmental pH of tumors. Also, the hybrid nanoparticle is induced by the high-frequency magnetic field to disassemble into constituent units, leading to a large amount of drug-loaded constituent units penetrating the dense extracellular matrix and distributing uniformly throughout the tumors. Furthermore, when the hybrid nanoparticle is modified with a rabies virus glycoprotein fragment to form a rabies virus-like particle, the hybrid nanoparticle is able to penetrate the blood-brain barrier and enhance the accumulation of loaded drug in the brain tumor.
(18) In view of the characteristics mentioned above, the hybrid nanoparticle of the present invention is suitable for use in the preparation of tumor-penetrating drug carriers. When drug-loaded hybrid nanoparticles with a diameter of about 200 nm are administered to cancer patients for treatment, it is speculated that that they would circulate in the blood stream and then penetrate across slits of vascular walls in tumor (at a size of about a hundred to several hundred nanometers) and specifically accumulate in the tumor due to the enhanced permeability and retention (EPR) effect. In response to the slightly acidic environment of the tumor (pH 6.5-7.0), the hybrid nanoparticles containing the pH-responsive polymeric molecules expand to a diameter of about 450 nm and thus readily retain in the tumor, resulting in increased accumulation of the loaded-drug in the tumor. Thereafter, when exposed to the high-frequency magnetic field, the hybrid nanoparticles are induced to disassemble into constituent units of about 2-5 nm, thereby the loaded drugs are delivered to the whole tumor by said constituent units with better penetration, resulting in expanded distribution of drugs in the tumor and improved therapeutic effects.
Definition
(19) Numerical quantities provided herein are approximated, experimental values that may vary within 20 percent, preferably within 10 percent, and most preferably within 5 percent. Thus, the terms about and approximately refer to within 20 percent, preferably within 10 percent, and most preferably within 5 percent of a given value or range.
(20) The term polymeric molecule used herein refers to a macromolecule formed by polymerization of one or multiple types of molecules, such as dendrimers, polyethylene glycols, polysaccharides (i.e., hyaluronic acid), and lipids (i.e., phospholipids). The polymeric molecule can be chemically modified to become stimuli-responsive, and its molecular weight preferably ranges from 1,000 to 60,000 Da. The polymeric molecules can self-assemble into structurally stable particles in water or aqueous solutions.
(21) Materials and Methods
(22) Materials
(23) 4-vinylphenylboronic acid, boric acid, 4-(bromomethyl)phenylboronic acid, doxorubicin hydrochloride (a water-soluble salt of doxorubicin), ethanol, acetone, dimethyl sulfoxide (DMSO), and generation 2 (G2) polyamidoamine (PAMAM) dendrimer were purchased from Sigma-Aldrich (St. Louis, Mo., USA). Palbociclib hydrochloride (a water soluble salt of palbociclib) was purchased from MedChemExpress (Monmouth Junction, N.J., USA). Fluorescent dyes including cyanine 5.5 (Cy5.5) and rhodamine B isothiocyanate (RITC) were purchased from Molecular Probes (Eugene, Oreg., USA).
(24) Transmission Electron Microscopy (TEM)
(25) TEM images of hybrid nanoparticles and components thereof were obtained using transmission electron microscope JEOL JEM-2010 (200 kV, Tokyo, Japan). The TEM samples were prepared by dropping 5 l of a freshly prepared aqueous solution (2 mg/ml) of the sample onto a copper grid coated with polyvinyl formal resin (Formvar). After 30-second deposition, excess droplet was blotted away with filter paper. These steps were repeated 3 times, and then the TEM samples were dried overnight at room temperature.
(26) Cell Culture
(27) A mouse astrocytoma cell line ALTS1C1 (ATCC CRL-2541) was purchased from American Type Culture Collection (ATCC). The cells were cultured at 37 C. under 5% CO.sub.2 in DMEM medium (Gibco Dulbecco's modified Eagle's medium; Thermo Fisher Scientific) supplemented with 10% fetal bovine serum (FBS; Biological Industries, Cromwell, Conn., USA) and 1% penicillin and streptomycin (Gibco, Thermo Fisher Scientific).
(28) Animal Study
(29) C57BL/6 mice were inoculated intracranially with 2 L of ALTS1C1 tumor cells (510.sup.7 cells/mL) and randomized into groups (6 mice per group). At day 14 after the tumor inoculation, 100 L of a solution of the indicated hybrid nanoparticles (1 mg/mL) was administered intravenously through the tail vein. The hybrid nanoparticles were dissolved in phosphate buffered saline (PBS; 137 mM sodium chloride, 2.7 mM potassium chloride, 4.3 mM disodium hydrogen phosphate, 1.4 mM potassium dihydrogen phosphate, dissolved in deionized water, pH 7.4).
(30) Statistical Analysis
(31) Statistically significant difference among experimental data was determined by Student's t test.
Example 1
(32) Preparation of Boron-Doped Graphene Quantum Dots (B-GQDs)
(33) This example exemplifies the method of preparing one essential constituent molecule of the hybrid nanoparticle of the present invention, that is, the boron-doped graphene quantum dot (B-GQD). 75 mg of 4-vinylphenylboronic acid and 150 mg of boric acid were dissolved in a mixed solution of 2.5 mL of ethanol and 15 mL of acetone. After the solution was ultra-sonicated for 0.5 to 1 hour, 2.5 mL of 30% hydrogen peroxide was slowly added. The resulting mixed solution was ultra-sonicated for 10 minutes and heated at 150 to 400 C. for 2 to 48 hours to obtain a B-GQD crude product. The crude product was cooled and transferred into a dialysis membrane with a molecular weight cutoff of 1000 Da (OrDial D-Clean Dialysis Membranes MWCO:1000; Orange Scientific) in order for dialysis against deionized water at room temperature for three days, during which the water was changed once a day. Thereafter, B-GQD attached to the dialysis membrane were collected and dried to obtain B-GQD powder, which was stored at 20 C.
Example 2
(34) Preparation of Hybrid Nanoparticles
(35) 2.1 Preparation of pH-Responsive Dendrimers
(36) The hybrid nanoparticle of the present invention preferably includes stimuli-responsive polymeric molecules which allow the size of the hybrid nanoparticle to increase in the tumor environment, for example, in the weakly acidic tumor environment (with a pH value of about 6.5-7.0). In the present example, the method of preparing the stimuli-responsive polymeric molecules is exemplified by synthesis of a pH-responsive dendrimer (referred to as pH-Den) having a molecular weight ranging from 1,000 to 60,000 Da. 4.4 mg of 4-(bromomethyl)phenylboronic acid and 100 mg of G2 PAMAM dendrimers were dissolved in DMSO for reaction at 80 C. for 24 hours to obtain a crude product of PAMAM dendrimers modified with phenylboronic acid (PBA-PAMAM), which is an example of the pH-responsive dendrimer. The crude product was cooled and transferred into a dialysis membrane with a molecular weight cutoff of 1000 Da (OrDial D-Clean Dialysis Membranes MWCO:1000; Orange Scientific) in order for dialysis against deionized water at room temperature for three days, during which the water was changed once a day. The dialyzed PBA-PAMAM solution was lyophilized to yield pH-Den powder, which was stored at 20 C.
(37) 2.2 Preparation of B-GQD/pH-Den Hybrid Nanoparticles
(38) One embodiment of the hybrid nanoparticle of the present invention can be obtained by mixing the B-GQD described in Example 1 with the pH-Den described in Example 2.1. Prior to the mixing step, each of the two constituent units of the hybrid nanoparticle may be combined with a drug to become drug-loaded. In one example, 1 mg of palbociclib hydrochloride was dissolved in 10 L of ethanol and diluted with double deionized water to yield a palbociclib solution at 1 mg/mL; and 1 mg of doxorubicin hydrochloride was dissolved in 1 mL of double deionized water to obtain a doxorubicin solution at 1 mg/mL. Thereafter, 1 mg of B-GQD was dissolved in deionized water to reach 1 mg/mL, and then mixed with the doxorubicin solution. The resultant mixture was ultra-sonicated for 30 minutes to obtain a doxorubicin-bound B-GQD solution, wherein doxorubicin was loaded on B-GQD via 7E-7E stacking interaction. Also, 1 mg of pH-Den was dissolved in ethanol to reach 1 mg/mL, and then mixed with the palbociclib solution. The mixture was ultra-sonicated for 30 minutes, vacuum dried, and redissolved in deionized water to obtain a palbociclib-bound pH-Den solution at 1 mg/mL, wherein palbociclib was loaded on the hydrophobic core of pH-Den via hydrophobic interactions. Finally, the doxorubicin-loaded B-GQD solution and the palbociclib-bound pH-Den solution were mixed at a volume ratio ranging from 1:2 to 1:8 and ultra-sonicated for 10 to 30 minutes to yield a solution of B-GQD/pH-Den hybrid nanoparticles.
(39) 2.3 Modification with Rabies Virus Glycoprotein Fragments
(40) To improve the ability to target a particular tissue, the hybrid nanoparticle of the present invention may further include a targeting molecule on the surface. The targeting molecule may be nucleic acids, sugars, lipids, proteins, or combination thereof. For instance, surface modification with a rabies virus glycoprotein fragment (RVG; with the amino acid sequence of YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRR RRR, SEQ ID NO: 1) increases the ability of the B-GQD/pH-Den hybrid nanoparticles described in Example 2.2 to target the nervous system and to penetrate the blood-brain barrier. In one example, 10 L of a PBS solution containing 200 g/mL rabies virus glycoprotein fragments (a synthetic peptide purchased from Sigma-Aldrich) was added to a solution of 1 mg/mL B-GQD/pH-Den hybrid nanoparticle with vortexing for about 30 seconds. This step allows the positively charged rabies virus glycoprotein fragments to adsorb electrostatically to the negatively charged pH-sensitive dendrimers on the surface of the hybrid nanoparticles.
(41)
Example 3
(42) Structure and Characteristics of the Hybrid Nanoparticles
(43) In order to examine the structure and characteristics of the hybrid nanoparticle of the present invention, transmission electron microscopy (TEM) was used to monitor the morphology and behavior of B-GQD/pH-Den hybrid nanoparticles described in Example 2.2 and the constituent units thereof.
(44)
(45)
Example 4
(46) The Matrix-Penetrating Ability of the Hybrid Nanoparticles after Induced to Disassemble
(47) In order to evaluate the ability of each constituent units released from the hybrid nanoparticles of the present invention to penetrate the extracellular matrix when the hybrid nanoparticles are induced to disassemble, confocal laser scanning microscopy (ZEISS LSM 780; Germany) was used to image the three dimensional distribution of hybrid nanoparticles (prepared as 1% aqueous solution and added in an amount of 10 L) that were added to a solid collagen hydrogel (10 wt %) and then subjected to a high-frequency magnetic field (at frequency of 50 to 600 kHz) for 15 or 30 minutes. The hybrid nanoparticles were assembled from fluorophore-labeled B-GQDs (labeled with RITC, whose NCO group was bonded to the surface depression of quantum dots via covalent bonding) and pH-responsive dendrimers (labeled with Cy5.5, which was embedded in the dendrimers through hydrophobic interactions). RITC was excited at a wavelength of 420 nm and detected at a wavelength of 600 nm. Cy5.5 was excited at 640 nm and detected at 720 nm.
(48)
Example 5
(49) Distribution of the Hybrid Nanoparticles in the Tumor
(50) To examine the distribution of the hybrid nanoparticles of the present invention in the tumor before or after the induced disassembly, confocal laser scanning microscopy (ZEISS LSM 780; Germany) was used to image the fluorescence from the hybrid nanoparticles (prepared as 1% aqueous solution and added in an amount of 50 L) that were administered for 4 hours to tumor spheroids formed with the mouse astrocytoma cell line ALTS1C1 and then subjected to a high-frequency magnetic field (at frequency of 50 to 600 kHz) for 5 minutes. The hybrid nanoparticles were assembled from fluorophore-labeled B-GQDs (labeled with RITC) and pH-responsive dendrimers (labeled with Cy5.5). The MTSs were formed by injecting 10.sup.6 ALTST1 cells into a PDMS mold and incubating the cells at 37 C. under 5% CO.sub.2 for one day in DMEM medium supplemented with 10% FBS and 1% penicillin and streptomycin. The PDMS mold had a circular reservoir with a diameter of 300 m and a depth of 300 m.
(51) As shown in
Example 6
(52) Distribution of the Hybrid Nanoparticles Including Targeting Molecules in the Body
(53) To investigate the distribution of the hybrid nanoparticles of the present invention in animal body in the presence or absence of conjugated targeting molecules, 100 L of a PBS solution containing 1 mg/mL B-GQD/pH-Den hybrid nanoparticles with or without the rabies virus glycoprotein fragment (RVG) was administered via intravenous injection to mice that were inoculated with ALTS1C1 tumor cells in the brain. The distribution and accumulation of the two types of Cy5.5-labeled hybrid nanoparticles in mice were detected 72 hours after the injection by in vivo imaging system (IVIS; PerkinElmer). Cy5.5 was excited at 640 nm and detected at 720 nm. The control mice were only injected with PBS.
(54) As shown in
(55) In conclusion, the hybrid nanoparticle of the present invention exhibits high stability and low dug leakage in aqueous solution, and can carry different drugs simultaneously. The boron-doped graphene quantum dots included in the hybrid nanoparticle allows the hybrid nanoparticle to disassemble into constituent units under an applied high-frequency magnetic field, thereby making it much easier for the loaded drugs to penetrate the dense extracellular matrix and spread from the periphery to interior of a tumor. Moreover, when the hybrid nanoparticle includes pH-responsive polymeric molecules, both the particle size and retention in the weakly acidic tumor increase, thereby increasing the accumulation of loaded drug in the tumors. While further modified with the rabies virus glycoprotein fragment, the hybrid nanoparticles can penetrate the blood-brain barrier and accumulate more in brain tumors. Accordingly, the hybrid nanoparticle of the present invention may be utilized as a multi-drug delivery platform for penetrating tumors, particularly for treating the deep seated tumors.
(56) Although the present invention has been described with reference to the preferred embodiments, it will be apparent to those skilled in the art that a variety of modifications and changes in form and detail may be made without departing from the scope of the present invention defined by the appended claims.