PROGRAMMED CELL DEATH RECEPTOR 1 ANTIBODY FORMULATION AND USE THEREOF

Abstract

The present invention provides a pharmaceutical formulation containing an anti-PD-1 monoclonal antibody. The pharmaceutical formulation comprises an anti-PD-1 monoclonal antibody, a citrate-sodium citrate buffer solution, a protein protectant, a surfactant, and an isotonic regulator. The present invention also relates to an application of the pharmaceutical formulation in the preparation of a liquid formulation or lyophilized formulation for injection.

Claims

1. A pharmaceutical formulation of an anti-PD-1 monoclonal antibody, wherein the pharmaceutical formulation comprises an anti-PD-1 monoclonal antibody, a citrate-sodium citrate buffer solution, a protein protectant, and a surfactant, wherein the content of the citrate-sodium citrate buffer solution is 10-30 mM; the protein protectant is selected from one or more of sucrose, glycine and mannitol and the content thereof is 0.5%-5% by mass/volume, wherein the mass/volume used is in g/L; the surfactant is polysorbate 80 and the content thereof is 0.01%-0.05% by volume; and the anti-PD-1 monoclonal antibody has a heavy chain variable region shown in SEQ ID NO. 7 and a light chain variable region shown in SEQ ID NO. 8.

2. The pharmaceutical formulation according to claim 1, wherein the pharmaceutical formulation further contains sodium chloride as an isotonic regulator, and the content thereof is 0.1%-0.5% by mass/volume, wherein the mass/volume used is in g/L.

3. The pharmaceutical formulation according to claim 1, wherein the pH of the pharmaceutical formulation is 5.0-6.5.

4. The pharmaceutical formulation according to claim 1, wherein the protein protectant is mannitol or sucrose and the content thereof is 1%-5% by mass/volume, wherein the mass/volume used is in g/L.

5. The pharmaceutical formulation according claim 1, wherein the protein concentration of the anti-PD-1 monoclonal antibody is 5-50 mg/ml.

6. The pharmaceutical formulation according to claim 1, wherein the anti-PD-1 monoclonal antibody is an h1G4 antibody, which comprises a heavy chain shown in SEQ ID NO. 10 and a light chain shown in SEQ ID NO. 9.

7. The pharmaceutical formulation according to claim 1, wherein the pharmaceutical formulation contains 10 mg/ml of the anti-PD-1 monoclonal antibody, 20 mmol/L of the citrate-sodium citrate buffer solution, 3% of mannitol by mass/volume, 0.02% of polysorbate 80 by volume, and 0.3% of sodium chloride by mass/volume, pH 5.5, wherein the mass/volume used is in g/L.

8. The pharmaceutical formulation according to claim 1, wherein the pharmaceutical formulation contains 10 mg/ml of the anti-PD-1 monoclonal antibody, 20 mmol/L of the citrate-sodium citrate buffer solution, 1%-3% of sucrose by mass/volume, 0.02% of polysorbate 80 by volume, and 0.3% of sodium chloride by mass/volume, pH 5.5, wherein the mass/volume used is in g/L.

9. The pharmaceutical formulation according to claim 1, wherein the pharmaceutical formulation contains 10 mg/ml of the anti-PD-1 monoclonal antibody, 20 mmol/L of the citrate-sodium citrate buffer solution, 1% of glycine by mass/volume, 0.02% of polysorbate 80 by volume, and 0.3% of sodium chloride by mass/volume, pH 5.5, wherein the mass/volume used is in g/L.

10. A method of preparing a lyophilized formulation for injection, comprising lyophilizing the pharmaceutical formulation according to claim 1.

11. A method of preparing a liquid formulation for injection, comprising combining an anti-PD-1 monoclonal antibody, a citrate-sodium citrate buffer solution, a protein protectant, and a surfactant, wherein the content of the citrate-sodium citrate buffer solution is 10-30 mM; the protein protectant is selected from one or more of sucrose, glycine and mannitol and the content thereof is 0.5%-5% by mass/volume, wherein the mass/volume used is in g/L; the surfactant is polysorbate 80 and the content thereof is 0.01%-0.05% by volume; and the anti-PD-1 monoclonal antibody has a heavy chain variable region shown in SEQ ID NO. 7 and a light chain variable region shown in SEQ ID NO. 8.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0038] FIG. 1. Histogram of SEC fragment content (%) in accelerated stability test (40° C.) of the h1G4 antibody formulation buffer system screening study.

[0039] FIG. 2. Histogram of turbidity in accelerated stability test (40° C.) of the h1G4 antibody formulation buffer system screening study.

DETAILED DESCRIPTION OF EMBODIMENTS

[0040] The present invention will be further described in the following examples, which should not be construed as a limitation to the present invention.

[0041] Source of the reagents: the reagents involved in the experimental section of the present invention are all commercially available products.

Example 1. Method for Testing Samples

1.1. Osmolality Detection

[0042] 20 μl of the sample and two standards with osmolality of 290 mOsmol/kg are suctioned with a pipette, and the osmolality value of the sample and standards is determined by using the Advanced Model 2020 Osmometer.

1.2. Sec-HPLC

[0043] The sample is analyzed by using the Agilent 1260 high-performance liquid chromatography with the TOSOH TSK G3000 (300*7.8 mm) chromatographic column, wherein the column temperature is room temperature, the flow rate is 0.5 mL/min, and the detection wavelength is 280 nm. The composition of the mobile phase is as follows: 100 mM PB, 0.5% NaCl, pH 6.8. The test sample is diluted to about 1.0 mg/mL with the mobile phase, 50 μL of the sample is injected, and the stop time is set at 30 min.

1.3. Cex-HPLC

[0044] The sample is analyzed by using the Agilent 1260 high-performance liquid chromatography with the Thermo ProPac WCX-10 chromatographic column (4×250 mm), wherein the column temperature is 35° C., the flow rate is 1.0 mL/min, and the detection wavelength is 280 nm. The elution gradient of the mobile phase is shown in Table 1. The composition of mobile phase A is as follows: CX-1 Gradient buffer A, pH 5.6, and the composition of mobile phase B is CX-1 Gradient buffer B, pH 10.2. The test sample is diluted to about 1.0 mg/mL with mobile phase A, and 20 μL of the sample is injected.

TABLE-US-00001 TABLE 1 Elution gradient of the mobile phase Mobile Flow rate Time (min) phase B % (mL/min) 0.00 10.0 1.0 5.00 10.0 1.0 35.00 40.0 1.0 35.01 100.0 1.0 40.00 100.0 1.0 40.01 10.0 1.0 45.00 10.0 1.0

1.4. Dsc

[0045] The values of Tm onset, Tm1 and Tm2 of the test sample are tested by means of the differential scanning calorimetry. The sample is diluted to 1.0 mg/ml with placebo before scanning.

Example 2. Preparation of Antibodies

[0046] The PD-1 antibody, i.e., h1G4 is derived from the h1G4 disclosed in patent application WO 2018052818, and the preparation method therefor fully refers to that of WO 2018052818. The amino acid sequences of the PD-1 antibody, h1G4 are as follows:

TABLE-US-00002 TABLE 2 CDR sequences of h1G4 LCDR LCDR1 LCDR2 LCDR3 h1G4 KASQDVTTAVA WASTRHT QQHYTIPWT (SEQ ID NO: 1) (SEQ ID NO: 2) (SEQ ID NO: 3) HCDR HCDR1 HCDR2 HCDR3 h1G4 FTFSNYGMS TISGGGSNIY VSYYYGIDF (SEQ ID NO: 4) (SEQ ID NO: 5) (SEQ ID NO: 6) Heavy chain variable  Light chain variable h1G4 region (SEQ ID NO: 7) region (SEQ ID NO: 8) Antibody QVQLVESGGGLVKPGGSLRLS DIQMTQSPSSLSASVGDRVTITCKA variable CAASGFTFSNYGMSWIROAP SQDVTTAVAWYOOKPGKAPKLLI region GKGLEWVSTISGGGSNIYYA YWASTRHTGVPSRFSGSGSGTDFT sequences DSVKGRFTISRDNAKNSLYLQ LTISSLQPEDFATYYCQQHYTIPW MNSLRAEDTAVYYCVSYYYG TFGGGTKLEIK IDFWGOGTSVTVSS

TABLE-US-00003 Light chain (LC) of h1G4 antibody  SEQ ID NO: 9 DIQMTQSPSSLSASVGDRVTITCKASQDVTTAVAWYQQKPGKAPKLLIY WASTRHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYTIPWTF GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC Heavy chain (HC) of h1G4 antibody  SEQ ID NO: 10 QVQLVESGGGLVKPGGSLRLSCAASGFTFSNYGMSWIRQAPGKGLEWVS TISGGGSNIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVS YYYGIDFWGQGTSVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQ VYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSL GK

Example 3. Buffer System Screening Study

[0047] In this study, two groups of different formulation buffer systems are selected as alternative formulations (hereinafter referred to as B1-B6, respectively), and the concentration of the target drug, i.e., the h1G4 antibody is 10.0 mg/mL. B1-B3 are 20 mmol/L of citrate-sodium citrate buffer systems with the pH of 5.0, 5.5 and 6.0, respectively; B4-B6 are 20 mmol/L of histidine-histidine hydrochloride buffer systems with the pH of 5.0, 5.5 and 6.0, respectively; the above-mentioned buffer systems all contain 3% of mannitol, 0.02% of polysorbate 80 and 0.3% of sodium chloride as auxiliary materials, wherein the concentration percentages of the auxiliary materials refer to the mass/volume used (w/v, g/L). The information of alternative formulations of the h1G4 antibody formulation buffer system screening study is shown in Table 3.

TABLE-US-00004 TABLE 3 Composition of alternative buffer system of h1G4 antibody formulation Poly- Buffer solu- Man- Sodium sorbate tion type nitol chloride 80 Formula- Formula- and ionic content content content tion No. tion code strength pH (%) (%) (%) B1 C50 20 mmol/L 5.0 3 0.3 0.02 B2 C55 Citrate- 5.5 3 0.3 0.02 B3 C60 sodium 6.0 3 0.3 0.02 citrate B4 H50 20 mmol/L 5.0 3 0.3 0.02 B5 H55 histidine- 5.5 3 0.3 0.02 B6 H60 histidine 6.0 3 0.3 0.02 hydrochloride

[0048] An appropriate amount of the antibody stock solution is taken and subjected to ultrafiltration and medium exchange, auxiliary materials are added, and the concentration is adjusted to prepare the formulations as shown in Table 3. In a biosafety cabinet, the sample is filtered by using a 0.22 μm disposable sterile filter and then aseptically sub-packaged into 2 mL penicillin vials. The vials are capped with 13 mm rubber stoppers, and 13 mm aluminum-plastic composite caps are used to seal the stoppers. The sub-packaged samples are placed uprightly in a constant temperature medicinal storage box at 40° C. and 2° C.−8° C. for 2 weeks, the samples are taken at week 0, 1, and 2, respectively for detection and analysis, and the details of the test items can be seen in Table 4.

TABLE-US-00005 TABLE 4 Examination conditions of the h1G4 antibody buffer system screening study Detection time point Examination conditions Week 0 Week 1 Week 2 40° C. X, Y X X 2° C.-8° C. — X X = appearance, concentration, A.sub.350, SEC-HPLC, CEX-HPLC, and R-CE-SDS Y = osmolality, and DSC; — indicates that the sample is not detected at this time point.

Research Results

High-Temperature Accelerated Test Results

[0049] At week 0, particles appear in the 20 mmol/L pH 5.0 citrate system (C50); and the appearances of the other buffer systems are colorless and slightly opalescent liquid, without obvious visible particles. The concentration is within the range of 9-11 mg/mL, and the osmolality is 300-340 mOsmol/kg. The contents of SEC main peaks are all greater than 99.0%, and the content of the aggregates is 0.6%-0.7%. The contents of CEX main peaks are 47.0%-48.6%, the contents of the acid peaks are 11.0%-14.3%, the contents of the basic peaks are 38.6%-40.9%, and the purity of R-CE-SDS is 94.1%-96.9%. The basic physical and chemical detection results show that at week 0, the quality of each buffer system is good, showing no significant difference (see Table 5).

[0050] After being placed under accelerated conditions at 40° C. for 2 weeks, the concentrations of proteins in all citrate-sodium citrate buffer systems show no obvious change and are within the range of 9-11 mg/mL. However, the concentrations in the histidine-histidine hydrochloride buffer systems increase significantly, and protein precipitates appear in the C50, C60 and H55 buffer systems. The measurements of turbidity in the histidine-histidine hydrochloride buffer system (A350 is tested by using NanoDrop 2000C, 2.5 μL of sample is injected, and the absorbance value of the sample at the wavelength of 350 nm is measured. The measurement is repeated three times and the average value is taken as the final result.) increase obviously (see FIG. 1 and FIG. 2). Hence, the buffer systems are ranked from superiority to inferiority as C55>C60>C50, H60>H55>H50. After being placed at 40° C.±2° C. for 2 weeks, it is found by the CE-SDS determination that the content of the heavy chains is decreased by 5.4%-23.7%, and the systems are ranked from superiority to inferiority according to the purity as C55, H55, H50>H60>C50>C60.

[0051] After being placed under accelerated conditions at 40° C. for 2 weeks, the content of the SEC main peaks of the citrate-sodium citrate buffer system is decreased by 0.1%-2.5%, the content of the aggregates is increased by 0.1%-0.4%, and the content of the fragments is increased by 0%-2.1%. However, all the histidine-histidine hydrochloride buffer systems have obvious degradation reaction, and therefore, the citrate-sodium citrate buffer systems are better than the histidine-histidine hydrochloride systems, and the optimum pH is 5.5.

TABLE-US-00006 TABLE 5 Data summary table of accelerated stability test (40° C.) of the h1G4 antibody buffer system screening study SEC-HPLC CEX-HPLC R-CE-SDS Sampling Concen- Turbid- Main Aggre- Frag- Main Acid Basic Light Heavy Pur- Formula- Formula- time tration ity peak gate ment peak peak peak chain chain ity tion No. tion code point Appearance (mg/mL) A.sub.350 % % % % % % % % % B1 C50 0 Colorless and 9.8 0.008 99.3 0.7 0.0 47.0 13.8 39.2 31.1 65.8 96.9 slightly opalescent Week 1 Colorless and 9.7 0.048 99.0 0.9 0.1 43.5 26.7 29.8 N/A N/A N/A slightly opalescent, with particles Week 2 Colorless 9.8 0.036 98.3 0.8 0.9 34.7 43.9 21.4 31.7 43.4 75.1 emulsion, protein precipitates B2 C55 0 Colorless and 10.1 0.002 99.4 0.7 0.0 47.7 13.4 39.0 30.3 66.1 96.4 slightly opalescent Week 1 Colorless and 10.5 0.011 99.1 0.8 0.1 47.7 15.1 37.1 N/A N/A N/A slightly opalescent Week 2 Colorless 10.5 0.014 99.2 0.8 0.0 43.4 23.9 32.7 30.6 60.7 91.2 microemulsion B3 C60 0 Colorless and 9.9 0.002 99.4 0.7 0.0 47.1 14.3 38.6 30.4 63.7 94.1 slightly opalescent Week 1 Colorless and 10.0 0.012 99.0 0.9 0.1 41.2 33.1 25.7 N/A N/A N/A slightly opalescent Week 2 Colorless 10.2 0.030 96.9 1.0 2.1 30.9 50.5 18.7 31.7 40.0 71.7 emulsion, protein precipitates B4 H50 0 Colorless and 9.5 0.001 99.3 0.7 0.0 48.6 11.0 40.4 30.4 65.1 95.4 slightly opalescent Week 1 Colorless 17.8 0.056 87.9 1.2 10.9 48.7 13.3 38.0 N/A N/A N/A microemulsion Week 2 Colorless 43.0 0.081 17.8 0.1 82.1 47.8 11.7 40.5 39.3 52.0 91.3 emulsion, protein precipitates B5 H55 0 Colorless and 9.9 0.001 99.3 0.7 0.0 48.2 11.0 40.9 30.9 64.0 95.0 slightly opalescent Week 1 Colorless 14.4 0.043 94.0 1.0 5.0 47.3 14.2 38.5 N/A N/A N/A microemulsion Week 2 Colorless 22.7 0.039 39.0 0.4 60.5 45.7 17.4 37.0 34.3 56.8 91.1 microemulsion B6 H60 0 Colorless and 10.2 -0.002 99.4 0.7 0.0 47.6 11.5 40.9 29.9 64.8 94.7 slightly opalescent Week 1 Colorless 12.4 0.030 98.0 0.9 1.1 46.6 16.4 37.0 N/A N/A N/A microemulsion Week 2 Colorless 23.8 0.033 40.6 0.3 59.0 42.8 22.3 34.9 31.1 55.3 86.5 microemulsion Note: N/A indicates not applicable.

Example 4. Auxiliary Material Screening Study

[0052] In this round of study, there are 6 alternative formulations (hereinafter referred to as F1-F6, respectively), and the concentration of the target protein, i.e., the h1G4 antibody is 10.0 mg/mL. The buffer systems are all 20 mmol/L of citrate-sodium citrate solutions (pH 5.5). The formulation F3 does not contain sodium chloride, and the other formulations contain 0.3% of sodium chloride and 0.02% of polysorbate 80, wherein the content of mannitol in formulations F1, F2 and F4 is 1%, 3% and 5%, respectively. The effect of the content of mannitol on the protein stability is investigated by using a single factor test. Formulations F2 (0.3% of NaCl) and F3 (0% of NaCl) are compared to investigate whether sodium chloride facilitates protein stability. The formulations of F2, F5 and F6 respectively contain 3% of mannitol, 3% of sucrose, and 1% of glycine (the three of which are isotonic) for the purpose of screening the optimal auxiliary material system contributing to the long-term stability of the h1G4 antibody formulations. The information of alternative formulations of the h1G4 antibody formulation auxiliary material screening study can be seen in Table 6.

TABLE-US-00007 TABLE 6 The composition of alternative formulations of the h1G4 antibody formulation auxiliary material screening study Polysorbate Formulation Buffer solution type Sodium chloride 80 content No and ionic strength pH Stabilizer (%) content (%) (%) F1 20 mmol/L 5.5 1% of mannitol 0.3 0.02 F2 Citrate-sodium 3% of mannitol 0.3 0.02 F3 citrate 3% of mannitol 0.0 0.02 F4 5% of mannitol 0.3 0.02 F5 3% of sucrose 0.3 0.02 F6 1% of glycine 0.3 0.02

[0053] An appropriate amount of the stock solution is taken and subjected to ultrafiltration and medium exchange, auxiliary materials are added, and the concentration is adjusted to prepare the formulations as shown in Table 6. In a biosafety cabinet, the sample is filtered by using a 0.22 μm disposable sterile filter and then aseptically sub-packaged into 2 mL penicillin vials. The vials are capped with 13 mm rubber stoppers, and 13 mm aluminum-plastic composite caps are used to seal the stoppers. The sub-packaged samples are placed uprightly in a constant temperature medicinal storage box at 40° C. and 2° C.−8° C. for 8 weeks. The samples are taken and detected at week 0, 1, 2, 4, 6 and 8, respectively.

[0054] In the single-factor test for the h1G4 antibody formulation auxiliary material screening study, 6 formulations are designed. According to the 40° C. accelerated stability test results and the rank from superiority to inferiority of the auxiliary materials (see Table 7), the formulation without sodium chloride (F3) and the formulation containing 5% of mannitol (F4) have slightly poor stability, and there is no significant difference among the formulations containing 1% of mannitol (F1), 3% of mannitol (F2) and the formulation containing 3% of sucrose (F5).

TABLE-US-00008 TABLE 7 Data summary table of high-temperature accelerated test (40° C.) of the h1G4 antibody formulation auxiliary material screening study SEC-HPLC CEX-HPLC Sampling Main High Main Acid Basic Formulation time Concentration Osmolality peak polymer Fragment peak peak peak No. point Appearance mg/mL mOsm/kg A.sub.350 % % % % % % F1 0 Colorless and slightly opalescent 10.3 207 0.029 96.6 3.4 0.0 39.2 26.6 34.3 Week 1 Colorless and slightly opalescent 10.2 N/A 0.008 96.8 3.1 0.1 41.6 29.1 29.3 Week 2 Colorless and slightly opalescent 10.3 206 0.008 96.3 3.5 0.2 36.7 33.5 29.8 Week 4 Colorless and slightly opalescent 9.7 N/A 0.004 95.0 4.2 0.8 31.5 40.9 27.6 Week 6 Colorless and slightly opalescent 10.6 N/A 0.008 94.8 4.2 0.9 25.0 47.4 27.6 Week 8 Colorless and slightly opalescent 10.5 N/A 0.005 95.1 3.5 1.4 23.2 52.9 23.9 F2 0 Colorless and slightly opalescent 10.4 326 0.024 96.7 3.3 0.0 39.3 26.6 34.1 Week 1 Colorless and slightly opalescent 10.3 N/A 0.006 96.9 3.0 0.1 40.4 29.1 30.5 Week 2 Colorless and slightly opalescent 10.5 322 0.008 96.3 3.6 0.2 37.1 33.6 29.4 Week 4 Colorless and slightly opalescent 9.8 N/A 0.007 95.1 4.1 0.8 30.8 40.1 29.1 Week 6 Colorless and slightly opalescent 10.7 N/A 0.007 95.0 4.1 1.0 24.0 47.1 28.9 Week 8 Colorless and slightly opalescent 10.8 N/A 0.004 95.0 3.6 1.5 23.1 52.5 24.4 F3 0 Colorless and slightly opalescent 10.7 230 0.037 96.7 3.3 0.0 39.2 26.9 33.9 Week 1 Colorless and slightly opalescent 10.5 N/A 0.007 96.9 3.1 0.1 41.2 30.1 28.7 Week 2 Colorless and slightly opalescent 10.6 230 0.007 96.3 3.6 0.2 36.4 34.9 28.8 Week 4 Colorless and slightly opalescent 10.0 N/A 0.006 95.0 4.3 0.7 29.9 43.1 27.1 Week 6 Colorless and slightly opalescent 10.8 N/A 0.005 94.5 4.1 1.4 23.0 49.1 27.9 Week 8 Colorless and slightly opalescent 10.8 N/A 0.003 94.7 4.0 1.3 21.7 56.1 22.2 F4* 0 Colorless and slightly opalescent 10.3 442 0.027 96.7 3.3 0.0 38.7 26.7 34.6 Week 1 Colorless and slightly opalescent 10.0 N/A 0.006 97.0 3.0 0.1 41.5 29.1 29.4 Week 2 Colorless and slightly opalescent 10.1 431 0.009 96.5 3.4 0.1 36.0 33.7 30.3 Week 4 Colorless and slightly opalescent 9.5 N/A 0.006 95.2 4.0 0.8 31.1 40.6 28.3 Week 6 Colorless and slightly opalescent 10.3 N/A 0.005 95.1 3.9 1.0 24.9 48.7 26.4 Week 8 Colorless and slightly opalescent 10.4 N/A 0.008 94.5 3.8 1.7 22.1 55.5 22.4 F5 0 Colorless and slightly opalescent 10.7 251 0.025 96.7 3.3 0.0 38.4 26.7 34.9 Week 1 Colorless and slightly opalescent 10.4 N/A 0.007 96.9 3.0 0.1 41.9 29.2 28.9 Week 2 Colorless and slightly opalescent 10.3 245 0.008 96.4 3.4 0.2 36.5 33.9 29.6 Week 4 Colorless and slightly opalescent 9.8 N/A 0.005 95.4 4.0 0.5 30.9 41.0 28.1 Week 6 Colorless and slightly opalescent 10.6 N/A 0.004 95.0 4.0 1.0 24.7 49.0 26.4 Week 8 Colorless and slightly opalescent 10.4 N/A 0.005 94.8 3.8 1.4 22.9 53.3 23.8 F6 0 Colorless and slightly opalescent 10.6 284 0.005 96.7 3.3 0.0 38.1 27.3 34.7 Week 1 Colorless and slightly opalescent 10.4 N/A 0.006 97.2 2.7 0.1 41.5 28.9 29.6 Week 2 Colorless and slightly opalescent 10.6 276 0.006 96.6 3.2 0.2 37.1 33.0 30.0 Week 4 Colorless and slightly opalescent 9.7 N/A 0.004 94.9 4.2 0.9 32.0 38.4 29.5 Week 6 Colorless and slightly opalescent 10.5 N/A 0.007 94.4 4.2 1.5 24.9 44.2 30.9 Week 8 Colorless and slightly opalescent 10.5 N/A 0.005 94.3 3.8 1.8 24.6 49.3 26.1 Note: N/A indicates not applicable. *indicates that after being placed at 40° C. ± 2° C. for 2 weeks, the opalescent phenomenon of the F4 formulation is slightly more obvious than that of the other formulations.

Example 5. Screening of Stabilizer

[0055] In this round of study, the formulation formulations are screened by using a single-factor test, and a total of 9 alternative formulations (hereinafter referred to as F7-F15, respectively) are designed, and the concentration of the target drug, i.e., the h1G4 antibody is 10.0 mg/mL. The buffer systems are 20 mmol/L of citrate-sodium citrate (pH 5.5) in all the formulations of F7-F14, and 20 mmol/L of sodium citrate-disodium hydrogen phosphate in the formulation F15, and the information of the alternative formulations of the formulation auxiliary material screening study can be seen in Table 8.

TABLE-US-00009 TABLE 8 The composition of alternative formulations of the h1G4 antibody formulation auxiliary material screening study Non-reducing Polysorbate Formulation Buffer solution type sugar and Sodium chloride 80 content No and ionic strength pH content (%) content (%) 10 F7  20 mmol/L 5.5 1% of mannitol 0.3% 0.02% F8  Citrate-sodium citrate 3% of mannitol 0.3% 0.02% F9  1% of sucrose 0.3% 0.02% F10 3% of sucrose 0.3% 0.00% F11 3% of sucrose 0.3% 0.02% F12 3% of sucrose 0.3% 0.05% F13 1% of glycine 0.3% 0.02% F14 3% of glycine 0.3% 0.02% F15 20 mmol/L 5.5 1% of glycine 0.3% 0.02% Sodium citrate-disodium hydrogen phosphate

[0056] An appropriate amount of the stock solution is taken and subjected to ultrafiltration and medium exchange, auxiliary materials are added, and the concentration is adjusted to prepare the formulations of Table 8. In a biosafety cabinet, the sample is filtered by using a 0.22 μm disposable sterile filter and then aseptically sub-packaged into 2 mL penicillin vials. The vials are capped with 13 mm rubber stoppers, and 13 mm aluminum-plastic composite caps are used to seal the stoppers. The sub-packaged samples are placed in a constant temperature shaker, and shaken at 200 rpm for 4 weeks at 40° C. The samples are taken, detected and analyzed at week 0, 1, 2 and 4, respectively (see Table 9).

TABLE-US-00010 TABLE 9 Examination conditions of the h1G4 antibody formulation auxiliary material screening study Examination Detection time point conditions Week 0 Week 1 Week 2 Week 4 40° C., 200 rpm X, Y X X X X = appearance, concentration, turbidity (A.sub.350), pH, SEC-HPLC, and CEX-HPLC; Y = osmolality

Research Results

[0057] At week 0, all the formulations are colorless, in the form of clear liquid, with no obvious visible particles. The concentration is within the range of 9-11 mg/mL, the osmolality is 185-540 mOsmol/kg, and the turbidity (A350) is 0.006-0.009. The contents of SEC main peaks are 98.0%-98.2%, and the content of the aggregates is 1.7%-1.9%. The contents of CEX main peaks are 35.4%-39.1%, the contents of the acid peaks are 31.6%-33.8%, and the contents of the basic peaks are 27.5%-30.8% (see Table 10). The basic physical and chemical detection results show that at week 0, the quality of each formulation is good, showing no significant difference.

[0058] It can be seen after an accelerated treatment at 40° C. for up to 4 weeks that the sodium citrate-disodium hydrogen phosphate buffer system is not suitable for the stable storage of the h1G4 antibody.

TABLE-US-00011 TABLE 10 Shaking stability test (40° C., 200 rpm) of the h1G4 antibody formulation auxiliary material screening study Data summary table SEC-HPLC CEX-HPLC Sampling Main High Main Acid Basic Formulation time Concentration Osmolality peak polymer Fragment peak peak peak No. point Appearance (mg/mL) pH (mOsm/kg) A.sub.350 % % % % % % F7 0 Colorless and clear 10.2 5.5 204 0.007 98.0 1.9 0.1 39.1 31.6 29.3 Week 1 Colorless and clear 10.2 5.4 N/A 0.007 97.8 2.0 0.2 43.3 29.9 26.8 Week 2 Colorless and clear 10.3 N/A N/A 0.003 97.1 2.2 0.8 39.8 33.5 26.7 Week 4 Colorless and clear 10.6 5.5 N/A 0.008 96.5 2.6 0.9 36.4 38.1 25.5 F8 0 Colorless and clear 10.5 5.5 322 0.008 98.0 1.9 0.1 39.3 32.2 28.5 Week 1 Colorless and clear 10.3 5.5 N/A 0.005 97.8 2.0 0.1 44.3 28.5 27.2 Week 2 Colorless and clear 10.5 N/A N/A 0.004 97.6 2.2 0.2 40.8 32.0 27.2 Week 4 Colorless and clear 10.5 5.4 N/A 0.008 96.8 2.5 0.7 37.7 35.4 27.0 F9 0 Colorless and clear 10.4 5.5 185 0.006 98.1 1.9 0.0 39.6 32.9 27.5 Week 1 Colorless and clear 10.4 5.5 N/A 0.005 97.8 2.1 0.1 44.5 28.6 26.8 Week 2 Colorless and clear 10.4 N/A N/A 0.004 97.5 2.3 0.3 41.0 31.8 27.3 Week 4 Colorless and clear 10.6 5.5 N/A 0.012 96.7 2.6 0.7 37.7 35.7 26.7 F10 0 Colorless and clear 10.5 5.5 242 0.008 98.2 1.7 0.1 37.4 32.6 30.0 Week 1 Colorless and clear 10.3 5.5 N/A 0.004 97.9 2.0 0.2 44.5 28.4 27.0 Week 2 Colorless and clear, 10.4 N/A N/A 0.006 97.6 2.1 0.3 41.0 31.8 27.2 with particles Week 4 Colorless and clear, 11.0 5.6 N/A 0.010 97.0 2.4 0.6 38.6 35.7 25.7 with particles F11 0 Colorless and clear 10.3 5.5 246 0.009 98.0 1.9 0.1 35.4 33.9 30.8 Week 1 Colorless and clear 10.4 5.5 N/A 0.005 97.9 2.0 0.1 44.5 28.4 27.1 Week 2 Colorless and clear 10.5 N/A N/A 0.004 97.6 2.2 0.2 41.1 31.7 27.3 Week 4 Colorless and clear 10.6 5.5 N/A 0.006 96.8 2.5 0.7 38.7 35.5 25.9 F12 0 Colorless and clear 10.3 5.5 250 0.006 98.1 1.9 0.1 38.9 33.7 27.4 Week 1 Colorless and 10.3 5.6 N/A 0.007 97.5 2.3 0.1 44.5 28.2 27.3 slightly opalescent Week 2 Colorless and 10.4 N/A N/A 0.007 97.6 2.2 0.2 41.1 31.6 27.3 slightly opalescent Week 4 Colorless and 10.6 5.5 N/A 0.010 96.8 2.6 0.6 38.6 35.6 25.9 slightly opalescent F13 0 Colorless and clear 10.4 5.5 298 0.008 98.2 1.8 0.1 37.3 32.6 30.1 Week 1 Colorless and clear 10.4 5.5 N/A 0.006 98.2 1.6 0.2 44.3 28.9 26.8 Week 2 Colorless and clear 10.5 N/A N/A 0.006 98.0 1.7 0.2 41.3 31.4 27.3 Week 4 Colorless and clear 10.5 5.5 N/A 0.008 97.2 2.1 0.7 39.4 34.1 26.5 F14 0 Colorless and clear 10.2 5.5 540 0.008 98.2 1.8 0.1 38.7 33.1 28.2 Week 1 Colorless and 10.3 5.5 N/A 0.005 98.3 1.5 0.1 43.4 30.0 26.6 slightly opalescent Week 2 Colorless and 10.3 N/A N/A 0.009 98.2 1.6 0.3 40.7 33.0 26.4 slightly opalescent Week 4 Colorless and 10.3 5.5 N/A 0.007 97.3 2.0 0.8 37.3 36.1 26.5 slightly opalescent F15 0 Colorless and clear 10.0 5.6 272 0.006 98.1 1.8 0.1 36.7 33.6 29.8 Week 1 Colorless and clear 10.1 5.4 N/A 0.004 97.7 1.6 0.7 40.3 35.6 24.1 Week 2 Colorless and clear 10.2 N/A N/A 0.003 97.3 1.7 0.9 35.1 40.0 24.9 Week 4 Colorless and clear 10.3 5.6 N/A 0.005 96.2 2.1 1.7 30.3 45.6 24.2 Note: N/A indicates not applicable.

[0059] The results indicate that after the finished products of the h1G4 formulations of the present invention are stored at 40° C. for up to 4 weeks, no obvious changes can be seen in the appearance, visible particles, protein content, SEC, CEX, pH, and osmolality, all of which meet the requirements in the quality standard draft (currently in force) for the present product. It indicates that the formulations have a good stability.

[0060] It should be understood that after reading the above content of the present invention, a person skilled in the art can make various changes or modifications to the present invention, and these equivalent forms also fall within the scope defined by the appended claims of the present application.