Skin Probiotics
20240000863 ยท 2024-01-04
Assignee
Inventors
Cpc classification
A61K9/0014
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
International classification
A61K9/00
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
Abstract
A topical, skin probiotic formulation comprises a living population of Corynebacterium glutamicum bacteria genetically-engineered to produce a skin-bioactive agent, and a nutrient source for the bacteria.
Claims
1. A topical, skin probiotic formulation comprising a living population of Corynebacterium glittamicum bacteria genetically-engineered to produce a skin-bioactive agent, and a nutrient source for the bacteria.
2. The formulation of claim 1, disposed on the skin of a person.
3. The formulation of claim 1, wherein the bacteria are producing the agent.
4. The formulation of claim 1, further comprising a skin moisturizer.
5. The formulation of claim 1, further comprising a humectant, such as glycerin, hyaluronic acid, and propylene glycol, or an emollient, such as shea butter, cocoa butter, and octyldodecanol, or an occlusive, such as petrolatum, cetyl alcohol (hexadecan-1-ol), and lanolin.
6. The formulation of claim 1, wherein the nutrient source comprises one or more sugars.
7. The formulation of claim 1, wherein the bioactive agent is selected from a cosmetic, anti-aging, anti-oxidant, sun-screen, anti-inflammatory, antimicrobial, analgesic, and therapeutic compound.
8. The formulation of claim 1, wherein the bioactive agent is selected from signal peptides, carrier peptides, neurotransmitter inhibitor peptides, and enzyme inhibitor peptides.
9. The formulation of claim 1, wherein the bioactive agent is selected from lysine, arginine, cysteine, histidine, alanine, serine, theronine, isoleucine, aspartic acid, valine, citrulline, GHK-Cu, GSH-Cu, mangenese tripeptide, Peptamide-6, carnosine, N-acetyl carnosine, tripeptide-10-citrulline, palmitoyl-tripeptides, palmitoyl-tetrapeptides, palmitoyl-pentapeptides, acetyl-tetrapeptide, hexapeptide-11, tetrapeptide PKEK, hexapeptide-14, silk protein, aquaporin, alpha interferon, Hsp70, transforming growth factors, rice peptides, and soybean peptides.
10. The formulation of claim 1, wherein the bioactive agent is a serine protease inhibitor, such as LEKTI-D6, LEKTI-D5, elafin and secretory leukocyte protease inhibitor for treating Netherton Syndrome, atopic dermatitis, psoriasis, and acne rosacea.
11. The formulation of claim 1, wherein the bioactive agent is a serine protease inhibitor, that is LEKTI-D6, LEKTI-D5, elafin or secretory leukocyte protease inhibitor, for treating Netherton Syndrome, atopic dermatitis, psoriasis, and acne rosacea.
12. The formulation of claim 1, wherein the bioactive agent is an anti-inflammatory compound, such as IL-10 to treat diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, acne rosacea, and chronic wound infection.
13. The formulation of claim 1, wherein the bioactive agent is an anti-inflammatory compound, that is IL-10 to treat diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, acne rosacea, and chronic wound infection.
14. The formulation of claim 1, wherein the bioactive agent is an anti-microbial peptide, such as pediocin and nisin to treat diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, acne rosacea, and chronic wound infection.
15. The formulation of claim 1, wherein the bioactive agent is an anti-microbial peptide, that is pediocin or nisin to treat diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, acne rosacea, and chronic wound infection.
16. The formulation of claim 1, wherein the bioactive agent is an antibody, antibody fragment or nanobody, such as single chain variable fragment anti-tumor necrosis factor alpha to treat diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, acne rosacea, and chronic wound infection.
17. The formulation of claim 1, wherein the bioactive agent is an antibody, antibody fragment or nanobody, that is a single chain variable fragment anti-tumor necrosis factor alpha to treat diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, acne rosacea, and chronic wound infection.
18. A method of using the formulation of claim 1, comprising applying the formulation to the skin of a person in need thereof under conditions wherein the bacteria produce an effective amount of the agent on the skin over a predetermined time range.
19. The method of claim 18 wherein the time range is selected from 4, 8, 12, 24, and 48 hours.
20. The method of claim 18, further comprising adjusting the concentration of the nutrient source to adjust bioproduction and colonization time, such as wherein the concentration of glucose and glycerol is varied from 2 to 20% of the moisturizer for increasingly longer colonization times.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029]
[0030]
[0031]
[0032]
DESCRIPTION OF PARTICULAR EMBODIMENTS AND DELIVERY METHODS OF THE INVENTION
[0033] Unless contraindicated or noted otherwise, in these descriptions and throughout this specification, the terms a and an mean one or more, the term or means and/or. The examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein, including citations therein, are hereby incorporated by reference in their entirety for all purposes.
[0034] We disclose genetically engineering innocuous bacterium Corynebacterium glutamicum to temporarily populate the skin microbiome and deliver molecules and proteins that treat disease as well as improve cosmetic appearance. While Corynebacterium is one of the three most abundant bacterial genera on human skin, the Generally Recognized as Safe (GRAS) organism C. glutamicum is not native to the skin microbiome. Temporary colonization of C. glutamicum, a well-studied organism for protein production, provides an added safety control feature. This platform for continuous production of enzymes and small molecules to the skin surface is a transformative advance in skin therapies.
[0035] While manipulation of the skin microbiome through modulation of native bacteria has been conceived in both academia and industry (MatriSys, Azitra, Xycrobe), we take a radically different approach to skin therapy. 9 While the abundance of Corynebacteria in the skin microbiome portends the compatibility of C. glutamicum, our approach is based on engineering a non-native microbe to temporarily colonize the skin. This is achieved through formulation engineering to manipulate the residence time on the skin, akin to media optimization in traditional fermentations. This approach provides increased safety as C. glutamicum cannot colonize the skin environment long-term, and unlike S. epidermidis or C. acnes, is not associated with any skin diseases. The benefits of this approach include slow, stable, consistent and effective release of therapies, at the level of the target cell in the skin. With adaptive laboratory evolution (ALE), we also use an engineered strain of C. glutamicum especially suited to grow and produce bioproducts in the acidic and lipidic environment of the skin.
Example 1. Safety and Feasibility: Applying Model Skin a Probiotic Moisturizer Comprising the Soil Bacterium C. glutamicum Producing Lysine
[0036] While C. glutamicum is a GRAS (Generally Recognized as Safe), we tested its safety in a human equivalent tissue (EpiDerm). EpiDerm is a highly differentiated 3D tissue model consisting of human-derived epidermal keratinocytes. In a mixture of components common to moisturizers (glycerol, glucose, LB and biotin), we dosed C. glutamicum (10.sup.7 CFUs/cm.sup.2) and media alone on the apical surface of EpiDerm. Tissue cell viability assays showed a similar tissue viability, compared to the cell death caused by soap (
[0037] As a proof-of-concept, we dosed the EpiDerm system with a C. glutamicum strain that overproduces lysine, a common moisturizer component. We showed the production of approximately 20 mM more of lysine, thereby illustrating our overall goal of longer effective peptide concentrations through continuous microbial production (
[0038] We have also shown that C. glutamicum is active when mixed in with common moisturizer ingredients (water, glycerol, stearic acid, Span60, xanthan gum, dimethicone) in an emulsion for over 28 days (
[0039] Additional examples below demonstrate, inter alia, stable temporary colonization of the human skin by providing nutrients in a moisturizer, the continuous production of glutamate on the skin surface, and the heterologous production of bioactive LEKTI to treat skin diseases such as Netherton Syndrome, atopic dermatitis, psoriasis, and acne rosacea
Example 2. Safety and Efficacy of Applying to Skin a Probiotic Moisturizer Comprising the Soil Bacterium C. glutamicum Producing Glutamate
[0040] Corynebacterium glutamicum is a common soil bacterium and cannot survive on the skin surface. As C. glutamicum consumes sugars and fatty acids, it cannot use the lipids and proteins on the skin surface to produce bioproducts. We have shown that by adding the components for growth to common moisturizer ingredients, we can adjust the environment of the skin where C. glutamicum cannot only stably colonize the skin, but produce bioproducts.
[0041] We used common moisturizer ingredients (paraffin oil, water, Span60, dimethicone, and stearic acid) with the needed components for C. glutamicum to grow (glucose, glycerol, yeast extract and biotin) so that C. glutamicum could produce nutrients on the skin surface. The moisturizer is combined in a 1:1 mixture with Corynebacterium glutamicum resuspended at a concentration of 10.sup.10 CFU/mL. Human testing was performed to determine both skin colonization of the soil bacterium and production of glutamate, an amino acid secreted and produced C. glutamicum. We used a control of moisturizer alone to determine local microbiome conditions. After 0, 2, 4, 8 and 24 hours we used a skin swab and determine the colony forming units in a 16 cm.sup.2 portion on the skin. We determined that C. glutamicum stably colonizes the surface of the skin for 8 hours before dropping back to control conditions after 24 hours. We also found increasing and continuous production of C. glutamicum over 8 hours before dropping back to control conditions after 24 hours. Highlighting the power of C. glutamicum continuous production, a topical glutamate formula of 0.1% glutamate was added to the skin, and was undetectable after 15 minutes likely because of absorption and degradation on the skin surface, demonstrating the utility of bacterial produced compounds continuously on the surface. Our safety data from human trials also demonstrate that applying this organism on human skin is non-irritating and non-allergenic, confirming both safety and efficacy; see, e.g.
[0042] This example uses glutamate, a common moisturizer ingredient, as a proof-of-concept for the production of other therapeutic and aesthetic proteins. Notably, the nutrients in the moisturizer enable the bacterium to colonize the skin, and adjusting the concentration of the nutrient source adjusts the bioproduction and colonization time. We can vary the concentration of glucose and glycerol from 20% of the moisturizer for the longest level of colonization to lacking it completely where the bacterium would die off very quickly.
Example 3. C. glutamicum Production and Secretion of Bioactive Therapeutic Proteins
[0043] Netherton Syndrome is a disease driven by mutations in the SPINK5 gene that encodes lymphoepithelial Kazal-Type-related protease inhibitor (LEKTI) serine protease inhibitors. These mutations cause insufficient inhibition of kallikreins on the surface of the skin, particularly KLK5. Kallikreins are proteases that break down the structural proteins of the epidermis, and insufficient inhibition results in uncontrolled protease activity leading to loss of skin barrier function. Other diseases such as atopic dermatitis, psoriasis, and acne rosacea also have been implicated to have insufficient inhibition of kallikriens by LEKTI.
[0044] We engineered C. glutamicum to continuously produce LEKTI proteins, and apply them topically to the lesional skin surface of NS patients, thereby inhibiting KLK5 and restoring the skin surface. The active drug is a modified version LEKTI protein that is known to inhibit KLK5. It has been modified with an N-terminal secretion amino acid signal so that C. glutamicum can secrete the protein out of the cell.
[0045] We genetically inserted the LEKTI-D6 and LEKTI-D5 protein into the genome of Corynebacterium glutamicum. The coding sequence is driven from the pH36 promoter and includes an N-terminus secretion tag (porB). The secretion tag improves secretion of the protein into the extracellular environment of C. glutamicum and the secretion tag cleaves the amino acid sequence, resulting in the mature protein secreted to the extracellular environment. The strain was then fermented, and the protein was purified. An SDS page gel of the purified protein shows a clear band at the molecular weights of the encoded proteins (
TABLE-US-00001 LEKTI-D6: (SEQIDNO:01) MKLSHRIAAMAATAGITVAAFAAPASAMESGKATSYAELCNEYRKLVRNG KLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGESRNKR LEKTI-D5: (SEQIDNO:02) MKLSHRIAAMAATAGITVAAFAAPASAMEIVKLCSQYQNQAKNGILFCTR ENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEARARN
[0046] *Bold font is secretion tag' **Underlined font is active moiety
[0047] We showed a correctly folded and bioactive protein by the microbial secretion of LEKTI by C. glutamicum using a KLK5 bioassay. The KLK5 inhibition assay is the foremost method to determine inhibition of KLK5. In the assay, KLK5 is incubated with the substrate Acetyl-YASR-paranitroanilide Uninhibited, KLK5 cleaves the substrate Acetyl-YASR at the arginine position (P4), releasing para-nitroanilide, a chromophore with absorbance 405 nm, resulting in increased absorption at that wavelength. When inhibited, the substrate Acetyl-YASR-paranitroanilide remains intact, and there is no increase in absorption at 405 nm. As a positive control, we used the absence of any inhibitor and the addition of purified Red Fluorescent Protein (RFP). As negative controls, we used a substrate only addition (no KLK5 is added) as well as a 100 uM addition of purified leupeptin, which is known to inhibit KLK5 at high concentrations. Our results showed that RFP and no inhibitor resulted in steadily increasing absorbance over 30 minutes. On the other hand, substrate only or the addition of leupeptin resulted in very little increasing absorbance in that time period. Increasing concentration of LEKTI-D6 showed a dose-dependent quenching of KLK5 with an IC50 of 89 nM.
Example 4. DNA Cassettes and Validation with Representative Therapeutic Proteins: Antimicrobial Peptides
[0048] Continuous production of antimicrobial peptides can treat skin infections and ameliorate bacterial dysbiosis. Current topical approaches often result in recalcitrant re-emergence of the harmful bacteria. By applying C. glutamicum topically, we use competitive inhibition and the continuous production of antimicrobials to permanently eliminate harmful bacteria such as Staphylococcus aureus. Pediocin is a narrow-range antibiotic, and we show that continuous on-site production can be used to treat and prevent S. aureus infections and colonization. In one embodiment, using the native sequence and transporter, we express pediocin as a three gene member family where pedC is the transporter, pedA is the precursor, and pedD cleaves pedA to provide the active pediocin in the supernatant.
[0049] Pediocin (Expressed Through 3 Proteins)
TABLE-US-00002 >pedA (SEQIDNO:03) MKKIEKLTEKEMANIIGGKYYGNGVTCGKHSCSVDWGKATTCIINNGAMA WATGGHQGNHKC >pedC (SEQIDNO:04) MSKKFWSNIFLALGVFLAFAGVATISVSADSSATIESNTSSKIIDGATYE ENIRGVIPITLTQYLHKAQTGEKFIVFVGFKECVHCRKFSPVMKQYLQQS QHPIYYLDYGNNGSFSMASQKQITDFYSTFATPMSFMGTPTVALLDNGKV VSMTAGDDTTLSDLQQITADYNNQ >pedD (SEQIDNO:05) MWTQKWHKYYTAQVDENDCGLAALNMILKYYGSDYMLAHLRQLAKTTADG TTVLGLVKAAKHLNLNAEAVRADMDALTASQLPLPVIVHVFKKNKLPHYY VVYQVTENDLIIGDPDPTVKTTKISKSQFAKEWTQIAIIIAPTVKYKPIK ESRHTLIDLVPLLIKQKRLIGLIITAAAITTLISIAGAYFFQLIIDTYLP HLMTNRLSLVAIGLIVAYAFQAIINYIQSFFTIVLGQRLMIDIVLKYVHH LFDLPMNFFTTRHVGEMTSRFSDASKIIDALGSTTLTLFLDMWILLAVGL FLAYQNINLFLCSLVVVPIYISIVWLFKKTFNRLNQDTMESNAVLNSAII ESLSGIETIKSLTGEATTKKKIDTLFSDLLHKNLAYQKADQGQQAIKAAT KLILTIVILWWGTFFVMRHQLSLGQLLTYNALLAYFLTPLENIINLQPKL QAARVANNRLNEVYLVESEFSKSREITALEQLNGDIEVNHVSFNYGYCSN ILEDVSLTIPHHQKITIVGMSGSGKTTLAKLLVGFFEPQEQHGEIQINHH NISDISRTILRQYINYVPQEPFIFSGSVLENLLLGSRPGVTQQMIDQACS FAEIKTDIENLPQGYHTRLSESGFNLSGGQKQRLSIARALLSPAQCFIFD ESTSNLDTITEHKIVSKLLFMKDKTIIFVAHRLNIASQTDKVVVLDHGKI VEQGSHRQLLNYNGYYARLIHNQE
[0050] In another embodiment, we use C. glutamicum secretion tags to secrete the active compound directly.
[0051] Pediocin (Expressed Through a Single Protein)
TABLE-US-00003 (SEQIDNO:06) MKLSHRIAAMAATAGITVAAFAAPASAKYYGNGVTCGKHSCSVDWGKATT CIINNGAMAWATGGHQGNHKC
[0052] We use the same protocol to deliver alternative antimicrobial peptides, including nisin, a polycyclic antibacterial peptide produced by the bacterium Lactococcus lactis.
Example 5. Validation with Representative Therapeutic Proteins: Antibodies
[0053] We constructed cassettes for on-site production of anti-inflammatory antibodies, antibody fragments, and nanobodies to treat a immunological disorders such as Netherton Syndrome, atopic dermatitis, psoriasis and acne rosacea; the protocols are readily extended to other antibodies targeting IgG, CD20 and other immune targets.
[0054] Single Chain Variable Fragment Anti-Tumor Necrosis Factor Alpha
TABLE-US-00004 (SEQIDNO:07) MKLSHRIAAMAATAGITVAAFAAPASAEVKLEESGGGLVQPGGSMKLSCV ASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTIS RDDSKSAVYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSGGGG SGGGGSGGGGSDILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQR TNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVESEDIADYYCQ QSHSWPFTFGSGTNLEVK
Example 6. Validation with Representative Therapeutic Proteins: Anti-Inflammatories
[0055] We constructed cassettes for on-site production of interleukins, including IL-10, to treat immune hypersensitivity responses on the skin.
[0056] IL-10
TABLE-US-00005 (SEQIDNO:08) MKLSHRIAAMAATAGITVAAFAAPASASPGQGTQSENSCTHFPGNLPNML RDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYL EEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQ VKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
[0057] In addition to LEKTI, other protease inhibitors can be used to inhibit skin diseases by continuous production by C. glutamicum, including Secretory leukocyte protease inhibitor and elafin.
TABLE-US-00006 Secretoryleukocyteproteaseinhibitor (SEQIDNO:09) MKLSHRIAAMAATAGITVAAFAAPASASGKSFKAGVCPPKKSAQCLRYKK PECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLM LNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA Elafin (SEQIDNO:10) MKLSHRIAAMAATAGITVAAFAAPASAMGSSAVTGVPVKGQDTVKGRVPF NGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNR CLKDTDCPGIKKCCEGSCGMACFVPQ*
Example 7. Validation with Representative Aesthetic Proteins
[0058] We also validated the invention with representative short peptide sequences that are beneficial to aesthetics by upregulating the production of collagen or relaxing facial muscles to reduce wrinkling. Continuous production by bacteria greatly increases their residence time, as normally they are absorbed and broken down by the skin. Examples include (encoded aesthetic peptide sequences are underscored):
TABLE-US-00007 1.GHK-Cu(complexedwithtracecopper) (SEQIDNO:11) MKLSHRIAAMAATAGITVAAFAAPASAGHK 2.GEKG (SEQIDNO:12) MKLSHRIAAMAATAGITVAAFAAPASAGEKG 3.PKEK (SEQIDNO:13) MKLSHRIAAMAATAGITVAAFAAPASAPKEK 4.GPRPA (SEQIDNO:14) MKLSHRIAAMAATAGITVAAFAAPASAGPRPA 5.YAGFL (SEQIDNO:15) MKLSHRIAAMAATAGITVAAFAAPASAYAGFL