BCMA-TARGETED CHIMERIC ANTIGEN RECEPTORS
20240000839 ยท 2024-01-04
Inventors
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
A61K39/464417
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
International classification
A61K35/17
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present disclosure provides BCMA-targeted chimeric antigen receptors (CARs) as well as preparation methods and applications thereof. The CARs of the present disclosure targets BCMA-positive cells, and can be used for treating BCMA-positive B-cell lymphoma, multiple myeloma and plasma cell leukemia.
Claims
1. A chimeric antigen receptor (CAR), comprising: an anti-BCMA antigen-binding region which comprises a light chain variable region (V.sub.L) and a heavy chain variable region (V.sub.H), V.sub.L comprising three complementarity determining regions (CDRs), LCDR1, LCDR2 and LCDR3, V.sub.H comprising three CDRs, HCDR1, HCDR2 and HCDR3, (a) wherein LCDR1, LCDR2 and LCDR3 have amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, respectively, wherein HCDR1, HCDR2 and HCDR3 have amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 28, respectively; (b) wherein LCDR1, LCDR2 and LCDR3 have amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, respectively, wherein HCDR1, HCDR2 and HCDR3 have amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 42, respectively; or (c) wherein LCDR1, LCDR2 and LCDR3 have amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, respectively, wherein HCDR1, HCDR2 and HCDR3 have amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 52, SEQ ID NO: 54, SEQ ID NO: 56, respectively.
2. The CAR of claim 1, wherein V.sub.L is located at the N-terminus of V.sub.H.
3. The CAR of claim 1, wherein V.sub.L and V.sub.H have amino acid sequences about 80% to about 100% identical to amino acid sequences set forth in (a) SEQ ID NO: 1 and SEQ ID NO: 2, respectively; (a) SEQ ID NO: 3 and SEQ ID NO: 4, respectively; or (a) SEQ ID NO: 5 and SEQ ID NO: 6, respectively.
4. The CAR of claim 1, wherein the anti-BCMA antigen-binding region is a single-chain variable fragment (scFv) that specifically binds BCMA.
5. The CAR of claim 1, wherein the CAR further comprises one or more of the following: (a) a signal peptide, (b) a hinge region, (c) a transmembrane domain, (d) a co-stimulatory region, and (e) a cytoplasmic signaling domain.
6. The CAR of claim 5, wherein the co-stimulatory region comprises a co-stimulatory region of 4-1BB (CD137), CD28, OX40, CD2, CD7, CD27, CD30, CD40, CD70, CD134, PD1, Dap10, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), NKG2D, GITR, TLR2, or combinations thereof.
7. The CAR of claim 5, wherein the cytoplasmic signaling domain comprises a cytoplasmic signaling domain of CD3 .
8. The CAR of claim 5, wherein the hinge region comprises a hinge region of CD8, CD28, CD137, Ig4, or combinations thereof.
9. The CAR of claim 5, wherein the transmembrane domain comprises a transmembrane domain of CD8, CD28, CD3c, CD45, CD4, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, or combinations thereof.
10. An immune cell expressing the CAR of claim 1.
11. The immune cell of claim 10, wherein the immune cell is a T cell or a natural killer (NK) cell.
12. A nucleic acid encoding the CAR of claim 1.
13. A vector comprising the nucleic acid of claim 12.
14. A method of treating cancer, the method comprising administering the immune cell of claim 10 to a subject in need thereof.
15. The method of claim 14, wherein the cancer is a hematologic cancer.
16. The method of claim 14, wherein the cancer is a plasma-cell malignancy.
17. The method of claim 14, wherein the cancer is a BCMA-positive malignancy.
18. The method of claim 14, wherein the cancer is multiple myeloma (MM), or plasma cell leukemia.
19. The method of claim 14, wherein the immune cell is administered by infusion, injection, transfusion, implantation, and/or transplantation.
20. The method of claim 14, wherein the immune cell is administered intravenously, subcutaneously, intradermally, intranodally, intratumorally, intramedullary, intramuscularly, or intraperitoneally.
21. (canceled)
22. The method of claim 14, wherein the immune cell is allogeneic or autologous.
23. The method of claim 14, wherein the subject is a human.
24-33. (canceled)
34. The CAR of claim 1, comprising an amino acid sequence about 80% to about 100% identical to the amino acid sequence set forth in SEQ ID NO: 59, SEQ ID NO: 61, or SEQ ID NO: 63.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
DETAILED DESCRIPTION
[0139] The present disclosure provides for chimeric antigen receptors (CARs) targeting BCMA. In certain embodiments, the CARs are based on four monoclonal antibodies: BCMA-1, BCMA-20, BCMA-CA8, and BCMA-MO6. The present disclosure also provides for the analysis and identification of the expression levels of the CARs in primary T cells, in vitro activation ability and tumor cell killing efficacy of these chimeric antigen receptors. Studies have shown that the chimeric antigen receptors of the present disclosure target BCMA positive cells and can be used to treat BCMA positive B cell lymphoma, multiple myeloma, plasma cell leukemia or other diseases.
[0140] Specifically, the present disclosure identifies the correlation between the expression time and the expression intensity of different CAR structures on the surface of the cell membrane after virus infection, and further identifies the difference in expression of different CAR structural proteins. This finding suggests that different CAR structures exist a difference in the expression level of CAR protein on the membrane surface and the persistence of CART in vivo activity under same infection condition. After extensive screening, the CAR structure of the present disclosure was obtained. The results show that the protein encoded by the CAR structure of the present disclosure can be fully expressed and membrane-localized.
[0141] In the present disclosure, the preparation process of CAR-modified T cell targeting BCMA antigen is improved. In one embodiment, GT-551 serum-free medium supplemented with 1% human albumin is used to culture lymphocytes in vitro.
[0142] Term
[0143] The term about may refer to a value or composition within an acceptable error range for a particular value or composition as determined by those skilled in the art, which will depend in part on how the value or composition is measured or determined. The term about in reference to a numeric value may refer to 10% of the stated numeric value. In other words, the numeric value can be in a range of 90% of the stated value to 110% of the stated value.
[0144] The term administering refers to the physical introduction of a product of the disclosure into a subject using any one of various methods and delivery systems known to those skilled in the art, including, but not limited to, intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral administration, such as by injection or infusion.
[0145] The term antibody (Ab) may include, but is not limited to, an immunoglobulin that specifically binds an antigen and contains at least two heavy (H) chains and two light (L) chains linked by disulfide bonds, or an antigen binding parts thereof. Each H chain contains a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region contains three constant domains, CH1, CH2, and CH3. Each light chain contains a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant region. The light chain constant region contains a constant domain CL. The V.sub.H and V.sub.L regions can be further subdivided into hypervariable regions called complementarity determining regions (CDR), which are interspersed within more conservative regions called framework regions (FR). Each V.sub.H and V.sub.L contains three CDRs and four FRs, which are arranged from amino terminal to carboxy terminal in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
[0146] Chimeric Antigen Receptors (CARs)
[0147] The chimeric antigen receptors (CARs) of the present disclosure may comprise an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain comprises a target-specific binding element (also known as an antigen binding domain). The intracellular domain includes a co-stimulatory signaling region and a chain. The co-stimulatory signaling region refers to a part of the intracellular domain that includes a co-stimulatory molecule. The co-stimulatory molecule is a cell surface molecule required for efficient response of lymphocytes to antigens, rather than an antigen receptor or its ligand.
[0148] A linker can be incorporated between the extracellular domain and the transmembrane domain of the CAR, or between the cytoplasmic domain and the transmembrane domain of the CAR. As used herein, the term linker generally refers to any oligopeptide or polypeptide that plays a role of linking the transmembrane domain to the extracellular domain or the cytoplasmic domain in a polypeptide chain. The linker may comprise 0-300 amino acids, 2-100 amino acids, or 3-50 amino acids.
[0149] In one embodiment, the extracellular domain of the CAR comprises an antigen binding domain targeting BCMA. When the CAR of the present disclosure is expressed in T cell, antigen recognition can be performed based on antigen binding specificity. When the CAR binds to its associated antigen, it affects tumor cell, causing tumor cell to fail to grow, to death or to be affected otherwise, causing the patient's tumor burden to shrink or eliminate. The antigen binding domain may be fused to the intracellular domain from one or more of the co-stimulatory molecules and the chain. The antigen binding domain may be fused with an intracellular domain of a combination of a 4-1BB signaling domain and a CD3 signaling domain.
[0150] As used herein, the antigen binding domain and single-chain antibody fragment may refer to a Fab fragment, a Fab fragment, a F (ab) 2 fragment, or a single Fv fragment that has antigen-binding activity. The Fv antibody contains the heavy chain variable region and the light chain variable region of the antibody, but has no constant region. The Fv antibody has the smallest antibody fragment with all antigen-binding sites. Generally, Fv antibodies also include a polypeptide linker between the VH and VL domains, and can form the structure required for antigen binding. The antigen binding domain is usually a scFv (single-chain variable fragment). The size of scFv is typically of a complete antibody. The single-chain antibody may be an amino acid chain sequence encoded by a nucleotide chain. In certain embodiments, the scFv may comprise an antibody which specifically recognizes the extracellular region of BCMA, such as amino acid residues at positions 24 to 41 of the BCMA sequence. The antibody may be a single chain antibody.
[0151] As for the hinge region and the transmembrane region (transmembrane domain), the CAR can be designed to comprise a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, a transmembrane domain that is naturally associated with one of the domains in the CAR is used. In some embodiments, transmembrane domains may be selected or modified by amino acid substitutions to avoid binding such domains to the transmembrane domain of the same or different surface membrane proteins, thereby minimizing the interaction with other members of the receptor complexes.
[0152] The intracellular domain in the CAR comprises the signaling domain of 4-1BB and the signaling domain of CD3.
[0153] In certain embodiments, the CAR structure of the present disclosure comprises a signal peptide, an antigen recognition sequence (antigen-binding domain), a linker region, a transmembrane region, a co-stimulatory factor signal region, and a CD3zeta signaling region ( chain portion). The order of connection is as follows:
[CD8S]-[VL-Linker-VH]-[hinge-CD8TM[-]4-1BB]-[CD3zeta]
[0154] In certain embodiments, the sequence selected in the present disclosure is as follows: [0155] (1) The signal peptide is a signal peptide sequence derived from CD8:
TABLE-US-00001 (SEQIDNO:9) MALPVTALLLPLALLLHAARP [0156] (2) light chain (VL) sequence of single-chain variable region derived from BCMA-1 antibody:
TABLE-US-00002 (SEQIDNO:7) DIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHW YQQKPGQPPTLLIQLASNVQTGVPARFSGSGSRTDFTL TIDPVEEDDVAVYYCLQSRTIPRTFGGGTKLEIK [0157] (3) heavy chain (VH) sequence of single-chain variable region derived from BCMA-1 antibody:
TABLE-US-00003 (SEQIDNO:8) QIQLVQSGPELKKPGETVKISCKASGYTFTDYSINWVKR APGKGLKWMGWINTETREPAYAYDFRGRFAFSLETSAST AYLQINNLKYEDTATYFCALDYSYAMDYWGQGTSVTVSS
[0158] Among them, BCMA-1 is an antibody sequence contained in a published Car-T sequence, and is used as a control in the present application. [0159] (4) light chain (VL) sequence of single-chain variable region derived from BCMA-20 antibody:
TABLE-US-00004 (SEQIDNO:1) DIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQK PGKAPKPLIYYTSNLQSGVPSRFSGSGSGTDYTLTISS LQPEDFATYYCMGQTISSYTFGQGTKLEI
TABLE-US-00005 Length Residues (numberof VL ofSEQ aminoacid Region Sequence IDNO:1 residues) LFR1 DIQMTQSPSSLSASV 1-23 23 GDRVTITC (SEQIDNO:16) CDR-L1 RASQGISNYLN 24-34 11 (SEQIDNO:17) LFR2 WYQQKPGKAPKPLIY 35-49 15 (SEQIDNO:18) CDR-L2 YTSNLQS 50-56 7 (SEQIDNO:19) LFR3 GVPSRFSGSGSGTDYT 57-88 32 LTISSLQPEDFATYYC (SEQIDNO:20) CDR-L3 MGQTISSYT 89-97 9 (SEQIDNO:21) LFR4 FGQGTKLEI 98-106 9 (SEQIDNO:22) [0160] (5) heavy chain (VH) sequence of single-chain variable region derived from BCMA-20 antibody:
TABLE-US-00006 (SEQIDNO:2) EVOLVESGGGLVQPGGSLRLSCAASGFTFSNFDMAWVRQAPG KGLVWVSSITTGADHAIYADSVKGRFTISRDNAKNTLYLQMN SLRAEDTAVYYCVRHGYYDGYHLFDYWGQGTLVTVSS
TABLE-US-00007 Residues Length of (numberof VH SEQID aminoacid Region Sequence NO:2 residues) HFR1 EVQLVESGGGLVQPG 1-30 30 GSLRLSCAASGFTFS (SEQIDNO:23) CDR- NEDMA 31-35 5 H1 (SEQIDNO:24) HFR2 WVRQAPGKGLVWVS 36-49 14 (SEQIDNO:25) CDR- SITTGADHAIYADSVKG 50-66 17 H2 (SEQIDNO:26) HFR3 RFTISRDNAKNTLYLQ 67-98 32 MNSLRAEDTAVYYCVR (SEQIDNO:27) CDR- HGYYDGYHLFDY 99-110 12 H3 (SEQIDNO:28) HFR4 WGQGTLVTVSS 111-121 11 (SEQIDNO:29) [0161] (6) light chain (VL) sequence of single-chain variable region derived from BCMA-CA8 antibody:
TABLE-US-00008 (SEQIDNO:3) DIQLTQTTSSLSASLGDRVTISCSASTTTSNYLNWYQQKPD GTVELVIYYTSNLHGGGPSRFSGSGSGTDYSLTIGYLEPED VATYYCQQYRKLPWTFGGGSKLEIKR
TABLE-US-00009 Length Residues (number of ofamino VL SEQID acid Region Sequence NO:3 residues) LFR1 DIQLTQTTSSLSAS 1-23 23 LGDRVTISC (SEQIDNO:30) CDR-L1 SASTTTSNYLN 24-34 11 (SEQIDNO:31) LFR2 WYQQKPDGTVELVIY 35-49 15 (SEQIDNO:32) CDR-L2 YTSNLHG 50-56 7 (SEQIDNO:33) LFR3 GGPSRFSGSGSGTD 57-88 32 YSLTIGYLEPEDV ATYYC (SEQIDNO:34) CDR-L3 QQYRKLPWT 89-97 9 (SEQIDNO:35) LFR4 FGGGSKLEIKR 98-108 11 (SEQIDNO:36) [0162] (7) heavy chain (VH) sequence of single-chain variable region derived from BCMA-CA8 antibody:
TABLE-US-00010 (SEQIDNO:4) EVQLQQSGAVLARPGASVKMSCKGSGYTFTNYWMHWVKQ RPGQGLEWIGATYRGHSDTYYNQKFKGKAKLTAVTSTST AYMELSSLTNEDSAVYYCTRGAIYNGYDVLDNWGQGTLV TVSS
TABLE-US-00011 Length Residues (number of ofamino VH SEQID acid Region Sequence NO:4 residues) HFR1 EVQLQQSGAVLARPGA 1-30 30 SVKMSCKGSGYTFT (SEQIDNO:37) CDR-H1 NYWMH 31-35 5 (SEQIDNO:38) HFR2 WVKQRPGQGLEWIG 36-49 14 (SEQIDNO:39) CDR-H2 ATYRGHSDTYYNQKF 50-66 17 KG (SEQIDNO:40) HFR3 KAKLTAVTSTSTA 67-98 32 YMELSSLTNEDSAV YYCTR (SEQIDNO:41) CDR-H3 GAIYNGYDVLDN 99-110 12 (SEQIDNO:42) HFR4 WGQGTLVTVSS 111-121 11 (SEQIDNO:43) [0163] (8) light chain (VL) sequence of single-chain variable region derived from BCMA-MO6 antibody:
TABLE-US-00012 (SEQIDNO:5) DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKP GKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQP EDFATYYCQQYRKLPWTFGQGTKLEIKR
TABLE-US-00013 Length Residues (numberof V.sub.L ofSEQ aminoacid Region Sequence IDNO:5 residues) LFR1 DIQMTQSPSSLSASVGDRVTITC(SEQ 1-23 23 IDNO:44) CDR-L1 SASQDISNYLN(SEQIDNO:45) 24-34 11 LFR2 WYQQKPGKAPKLLIY(SEQIDNO:46) 35-49 15 CDR-L2 YTSNLHS(SEQIDNO:47) 50-56 7 LFR3 GVPSRFSGSGSGTDFTLTISSLQPEDF 57-88 32 ATYYC(SEQIDNO:48) CDR-L3 QQYRKLPWT(SEQIDNO:49) 89-97 9 LFR4 FGQGTKLEIKR(SEQIDNO:50) 98-108 11 [0164] (9) heavy chain (VH) sequence of single-chain variable region derived from BCMA-MO6 antibody:
TABLE-US-00014 (SEQIDNO:6) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYWMHWVRQAPGQGLEWMG ATYRGHSDTYYNQKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR GAIYDGYDVLDNWGQGTLVTVSS
TABLE-US-00015 Length Residues (numberof V.sub.H ofSEQ aminoacid Region Sequence IDNO:6 residues) HFR1 QVQLVQSGAEVKKPGSSVKVSCKASG 1-30 30 GTFS(SEQIDNO:51) CDR-H1 NYWMH(SEQIDNO:52) 31-35 5 HFR2 WVRQAPGQGLEWMG(SEQIDNO:53) 36-49 14 CDR-H2 ATYRGHSDTYYNQKFKG(SEQIDNO: 50-66 17 54) HFR3 RVTITADKSTSTAYMELSSLRSEDTAV 67-98 32 YYCAR(SEQIDNO:55) CDR-H3 GAIYDGYDVLDN(SEQIDNO:56) 99-110 12 HFR4 WGQGTLVTVSS(SEQIDNO:57) 111-121 11 [0165] (10) The linker sequence between heavy chain and light chain of BCMA-1 single-chain variable region is:
TABLE-US-00016 (SEQIDNO:10) GSTSGSGKPGSGEGSTKG [0166] (11) The linker sequence between heavy chain and light chain of BCMA-20, BCMA-CA8, and BCMA-MO6 single-chain variable region is:
TABLE-US-00017 (SEQIDNO:11) GGGGSGGGGSGGGGS [0167] (12) Sequence of hinge region and linker region:
TABLE-US-00018 (SEQIDNO:12) FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRG LDFACD [0168] (13) The transmembrane region is a transmembrane region sequence of CD8 (CD8TM) antigen:
TABLE-US-00019 (SEQIDNO:13) IYIWAPLAGTCGVLLLSLVITLYC [0169] (14) The co-stimulatory factor signal region is derived from the sequence of 4-1BB cytoplasmic signaling motif:
TABLE-US-00020 (SEQIDNO:14) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL [0170] (15) The signaling region of CD3 zeta is derived from the sequence of immunoreceptor tyrosine-based activation motif (ITAM) of CD3zeta in the TCR complex:
TABLE-US-00021 (SEQIDNO:15) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP QRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR
[0171] In certain embodiments, the nucleic acid encoding the CAR (derived from the BCMA-20 antibody) may have the following sequence (SEQ ID NO: 58):
TABLE-US-00022 atggccttaccagtgaccgccttgctcctgccgctggccttgctgctcc acgccgccaggccggacatccagatgacccagtccccctcctccctgtc cgcctccgtgggcgaccgggtgaccatcacctgccgggcctcccagggc atctccaactacctgaactggtaccagcagaagcccggcaaggccccca agcccctgatctactacacctccaacctgcagtccggcgtgccctcccg gttctccggctccggctccggcaccgactacaccctgaccatctcctcc ctgcagcccgaggacttcgccacctactactgcatgggccagaccatct cctcctacaccttcggccagggcaccaagctggagatcaagggtggcgg tggctcgggcggtggtgggtcgggtggcggcggatctgaggtgcagctg gtggagtccggcggcggcctggtgcagcccggcggctccctgcggctgt cctgcgccgcctccggcttcaccttctccaacttcgacatggcctgggt gcggcaggcccccggcaagggcctggtgtgggtgtcctccatcaccacc ggcgccgaccacgccatctacgccgactccgtgaagggccggttcacca tctcccgggacaacgccaagaacaccctgtacctgcagatgaactccct gcgggccgaggacaccgccgtgtactactgcgtgcggcacggctactac gacggctaccacctgttcgactactggggccagggcaccctggtgaccg tgtcctccttcgtgccggtcttcctgccagcgaagcccaccacgacgcc agcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctg tccctgcgcccagaggcgtgccggccagcggggggggcgcagtgcacac gagggggctggacttcgcctgtgatatctacatctgggcgcccttggcc gggacttgtggggtccttctcctgtcactggttatcaccctttactgca aacggggcagaaagaaactcctgtatatattcaaacaaccatttatgag accagtacaaactactcaagaggaagatggctgtagctgccgatttcca gaagaagaagaaggaggatgtgaactgagagtgaagttcagcaggagcg cagacgcccccgcgtaccagcagggccagaaccagctctataacgagct caatctaggacgaagagaggagtacgatgttttggacaagagacgtggc cgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaag gcctgtacaatgaactgcagaaagataagatggcggaggcctacagtga gattgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctt taccagggtctcagtacagccaccaaggacacctacgacgcccttcaca tgcaggccctgccccctcgctaa
[0172] In certain embodiments, the CAR (derived from the BCMA-20 antibody) may have the following amino acid sequence (SEQ ID NO: 59):
TABLE-US-00023 MALPVTALLLPLALLLHAARPDIQMTQSPSSLSASVGDRVTITCRASQG ISNYLNWYQQKPGKAPKPLIYYTSNLQSGVPSRFSGSGSGTDYTLTISS LQPEDFATYYCMGQTISSYTFGQGTKLEIKGGGGSGGGGSGGGGSEVQL VESGGGLVQPGGSLRLSCAASGFTFSNFDMAWVRQAPGKGLVWVSSITT GADHAIYADSVKGRFTISRDNAKNTLYLOMNSLRAEDTAVYYCVRHGYY DGYHLFDYWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPL SLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRS ADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQE GLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALH MQALPPR
[0173] In certain embodiments, the nucleic acid encoding the CAR (derived from the BCMA-CA8 antibody) may have the following sequence (SEQ ID NO: 60):
TABLE-US-00024 atggccttaccagtgaccgccttgctcctgccgctggccttgctgctcc acgccgccaggccggatatccagctgacccagaccacaagcagcctgag cgcctccctgggcgacagggtgaccattagctgcagcgccagccaggac atcagcaactacctgaactggtaccagcagaagcccgacggcaccgtgg agctcgtgatctactacacctccaacctgcacagcggcgtgcccagcag gttctctggcagcggcagcggcaccgactacagcctgaccatcggctat ctggagcccgaggacgtcgccacctactactgccagcagtacaggaagc tgccctggaccttcggcggaggctctaagctggagattaagcgtggtgg cggtggctcgggcggtggtgggtcgggtggcggcggatctgaggtgcag ctgcagcagagcggcgccgtgctggccaggcccggagctagcgtgaaga tgagctgcaagggcagcggctacaccttcaccaactactggatgcactg ggtgaaacagaggcccggccagggactggagtggatcggcgccacctac aggggccacagcgacacctactacaaccagaagttcaagggcaaggcca agctgaccgccgtgacctcaaccagcaccgcctacatggaactgagcag cctgaccaacgaggacagcgccgtctattactgcaccaggggcgccatc tacaacggctacgacgtgctggacaattggggccagggaacactagtga ccgtgtccagcttcgtgccggtcttcctgccagcgaagcccaccacgac gccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagccc ctgtccctgcgcccagaggcgtgccggccagcggcggggggcgcagtgc acacgagggggctggacttcgcctgtgatatctacatctgggcgccctt ggccgggacttgtggggtccttctcctgtcactggttatcaccctttac tgcaaacggggcagaaagaaactcctgtatatattcaaacaaccattta tgagaccagtacaaactactcaagaggaagatggctgtagctgccgatt tccagaagaagaagaaggaggatgtgaactgagagtgaagttcagcagg agcgcagacgcccccgcgtaccagcagggccagaaccagctctataacg agctcaatctaggacgaagagaggagtacgatgttttggacaagagacg tggccgggaccctgagatggggggaaagccgagaaggaagaaccctcag gaaggcctgtacaatgaactgcagaaagataagatggcggaggcctaca gtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatgg cctttaccagggtctcagtacagccaccaaggacacctacgacgccctt cacatgcaggccctgccccctcgctaa
[0174] In certain embodiments, the CAR (derived from the BCMA-CA8 antibody) may have the following amino acid sequence (SEQ ID NO: 61):
TABLE-US-00025 MALPVTALLLPLALLLHAARPDIQLTQTTSSLSASLGDRVTISCSASQD ISNYLNWYQQKPDGTVELVIYYTSNLHSGVPSRFSGSGSGTDYSLTIGY LEPEDVATYYCQQYRKLPWTFGGGSKLEIKRGGGGSGGGGSGGGGSEVQ LQQSGAVLARPGASVKMSCKGSGYTFTNYWMHWVKQRPGQGLEWIGATY RGHSDTYYNQKFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCTRGAI YNGYDVLDNWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQP LSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSR SADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR
[0175] In certain embodiments, the nucleic acid encoding the CAR (derived from the BCMA-MO6 antibody) may have the following sequence (SEQ ID NO: 62):
TABLE-US-00026 atggccttaccagtgaccgccttgctcctgccgctggccttgctgctcc acgccgccaggccggacatccagatgacccagagccctagctcactgag cgccagcgtgggcgacagggtgaccattacctgctccgccagccaggac atcagcaactacctgaactggtaccagcagaagcccggcaaggccccca agctgctgatctactacacctccaacctgcactccggcgtgcccagcag gttcagcggaagcggcagcggcaccgatttcaccctgaccatctccagc ctgcagcccgaggacttcgccacctactactgccagcagtacaggaagc tcccctggactttcggccagggcaccaaactggagatcaagcgtggtgg cggtggctcgggcggtggtgggtcgggtggcggcggatctcaggtgcag ctggtccagagcggcgccgaagtgaagaagcccggcagctccgtgaaag tgagctgcaaggccagcggcggcaccttcagcaactactggatgcactg ggtgaggcaggcccccggacagggcctggagtggatgggcgccacctac aggggccacagcgacacctactacaaccagaagttcaagggccgggtga ccatcaccgccgacaagagcaccagcaccgcctacatggaactgagcag cctcaggagcgaggacaccgctgtgtattactgcgccaggggcgccatc tacgacggctacgacgtgctggacaactggggccagggcacactagtga ccgtgtccagcttcgtgccggtcttcctgccagcgaagcccaccacgac gccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagccc ctgtccctgcgcccagaggcgtgccggccagcggggggggcgcagtgca cacgagggggctggacttcgcctgtgatatctacatctgggcgcccttg gccgggacttgtggggtccttctcctgtcactggttatcaccctttact gcaaacggggcagaaagaaactcctgtatatattcaaacaaccatttat gagaccagtacaaactactcaagaggaagatggctgtagctgccgattt ccagaagaagaagaaggaggatgtgaactgagagtgaagttcagcagga gcgcagacgcccccgcgtaccagcagggccagaaccagctctataacga gctcaatctaggacgaagagaggagtacgatgttttggacaagagacgt ggccgggaccctgagatggggggaaagccgagaaggaagaaccctcagg aaggcctgtacaatgaactgcagaaagataagatggcggaggcctacag tgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggc ctttaccagggtctcagtacagccaccaaggacacctacgacgcccttc acatgcaggccctgccccctcgctaa
[0176] In certain embodiments, the CAR (derived from the BCMA-BCMA-MO6 antibody) may have the following amino acid sequence (SEQ ID NO: 63):
TABLE-US-00027 MALPVTALLLPLALLLHAARPDIQMTQSPSSLSASVGDRVTITCSASQD ISNYLNWYQQKPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISS LQPEDFATYYCQQYRKLPWTFGQGTKLEIKRGGGGSGGGGSGGGGSQVQ LVQSGAEVKKPGSSVKVSCKASGGTFSNYWMHWVRQAPGQGLEWMGATY RGHSDTYYNQKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARGAI YDGYDVLDNWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQP LSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLY CKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSR SADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR
[0177] Chimeric Antigen Receptor T Cells (CAR-T Cells)
[0178] As used herein, the terms CAR-T cell, CAR-T, and CART, may be used interchangeably.
[0179] The present disclosure relates to the construction of a chimeric antigen receptor structure targeting BCMA, a preparation method of a chimeric antigen receptor engineered T cell targeting BCMA, and activity identification thereof.
[0180] Vector
[0181] The nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the gene of interest can be produced synthetically.
[0182] The present disclosure also provides vectors in which the expression cassette of the present disclosure is inserted. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the advantage of low immunogenicity.
[0183] In brief summary, the expression cassette or nucleic acid sequence is typically and operably linked to a promoter, and incorporated into an expression vector. The vectors can be suitable for replication and integration in eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
[0184] The expression constructs of the present disclosure may also be used for nucleic acid immune and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties. In another embodiment, the disclosure provides a gene therapy vector.
[0185] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[0186] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al, (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
[0187] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, lentivirus vectors are used.
[0188] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.
[0189] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1 (EF-1). However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, either constitutive promoters or inducible promoters may be used. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionein promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
[0190] In order to assess the expression of a CAR polypeptide or portions thereof, the expression vector to be introduced into a ceil can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
[0191] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5 flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
[0192] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.
[0193] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.
[0194] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
[0195] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
[0196] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a collapsed structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
[0197] In one embodiment, the vector is a lentiviral vector.
[0198] Compositions
[0199] The disclosure provides a composition comprising the immune cell (e.g., CAR-T cell), and a pharmaceutically acceptable carrier, diluent and/or excipient. In one embodiment, the composition is a liquid composition. For example, the composition is an injectable composition. In certain embodiments, the concentration of the CAR-T cells in the composition is 110.sup.3-110.sup.8 cells/ml, or 110.sup.4-110.sup.7 cells/ml.
[0200] In one embodiment, the composition may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. The composition may be formulated for intravenous administration.
[0201] Therapeutic Application
[0202] The disclosure comprises therapeutic applications using cells (e.g., T cells) transduced with a lentiviral vector (LV) encoding the expression cassette of the disclosure. The transduced T cells can target the tumor cell marker BCMA, synergistically activate T cells, and cause T cell immune responses, thereby significantly increasing the killing efficiency against tumor cells.
[0203] Thus, the present disclosure also provides a method for stimulating a T cell-mediated immune response to a target cell population or tissue in a mammal comprising the step of administering to the mammal a CAR-T cell of the disclosure.
[0204] In one embodiment, the present disclosure comprises a class of cell therapies, wherein T cells from autologous patient (or heterologous donor) are isolated, activated and genetically modified to generate CAR-T cells, and then injected into the same patient. The probability of graft versus host disease in the way is extremely low, and antigens are recognized by T cells in a non-MHC-restricted manner. In addition, one CAR-T can treat all cancers that express the antigen. Unlike antibody therapies, CAR-T cells are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control
[0205] In one embodiment, the CAR-T cells of the disclosure can undergo robust in vivo T cell expansion and can persist for an extended amount of time. In addition, the CAR mediated immune response may be part of an adoptive immunotherapy approach in which CAR-modified T cells induce an immune response specific to the antigen binding moiety in the CAR. For example, an anti-BCMA CAR-T cell elicits an immune response specific against cells expressing BCMA.
[0206] Although the data disclosed herein specifically disclose lentiviral vector comprising BCMA scFv, hinge and transmembrane domain, and 4-1BB and CD3 signaling domains, the disclosure should be construed to include any number of variations for each of the components of the construct as described elsewhere herein.
[0207] Cancers that may be treated include tumors that are unvascularized or largely unvascularized, and tumors that are vascularized. Cancers may include non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or solid tumors. Types of cancers to be treated with the CARs include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
[0208] Hematologic cancers are cancers of the blood or bone marrow. Examples of hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblasts, promyeiocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
[0209] Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, mesothelioma, malignant lymphoma, pancreatic cancer and ovarian cancer.
[0210] The CAR-modified T cells may also serve as a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal. Preferably, the mammal is a human.
[0211] With respect to ex vivo immunization, at least one of the following occurs in vitro prior to administering the cell into a mammal: i) expanding the cells, ii) introducing a nucleic acid encoding a CAR to the cells, and/or iii) cryopreservation of the cells.
[0212] Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells are isolated from a mammal (such as a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAR disclosed herein. The CAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit. The mammalian recipient may be a human and the CAR-modified cell can be autologous with respect to the recipient. Alternatively, the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
[0213] In addition to using a cell-based vaccine in terms of ex vivo immunization, the present disclosure also provides compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
[0214] The present disclosure provides methods for treating tumors comprising administering to a subject in need thereof, a therapeutically effective amount of the CAR-modified T cells.
[0215] The CAR-modified T cells of the present disclosure may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2, IL-17 or other cytokines or cell populations. Briefly, pharmaceutical compositions of the present disclosure may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure may be formulated for intravenous administration.
[0216] Pharmaceutical compositions of the present disclosure may be administered in a manner appropriate to the disease to be treated (or prevented). The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
[0217] When an immunologically effective amount, an anti-tumor effective amount, an tumor-inhibiting effective amount, or therapeutic amount is indicated, the precise amount of the compositions of the present disclosure to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, or 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al, New Eng. J. of Med. 319: 1676, 1988). The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
[0218] The administration of the subject compositions may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous injection, or intraperitoneally. In one embodiment, the T cell compositions of the present disclosure are administered to a patient by intradermal or subcutaneous injection. In another embodiment, the T cell compositions of the present disclosure may be administered by intravenous injection. The compositions of T cells may be injected directly into a tumor, lymph node, or site of infection.
[0219] In certain embodiments of the present disclosure, cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels, are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients. In further embodiments, the T cells of the disclosure may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunotherapeutic agents. In a further embodiment, the cell compositions of the present disclosure are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, or the use of chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide. For example, in one embodiment, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In certain embodiments, following the transplant, subjects receive an infusion of the expanded immune cells of the present disclosure. In an additional embodiment, expanded cells are administered before or following surgery.
[0220] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for patient administration can be performed according to art-accepted practices. In general, 110.sup.6 to 110.sup.10 of the modified T cells of the disclosure (e.g., CAR-T-BCMA cells) can be applied to patients by means of, for example, intravenous infusion each treatment or each course of treatment.
[0221] The main advantages of the present disclosure include: [0222] (a) As for the chimeric antigen receptor of the present disclosure, the extracellular antigen binding domain is a specific anti-BCMA scFv; the CARs have shown a great ability of killing tumor cells with low cytotoxicity and low side effects. [0223] (b) The chimeric antigen receptor provided by the disclosure can achieve stable expression and membrane localization of CAR protein after T cells are infected by viral vectors (e.g., lentiviruses) carrying the CAR gene. [0224] (c) The CAR-modified T cells of the present disclosure have a longer survival time in vivo and strong anti-tumor effect. The scFv used in the present disclosure may be a humanized or human-derived antibody, and is less likely to produce specific immunological rejection.
[0225] The present disclosure will be further illustrated below with reference to the specific examples. It is to be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the invention. For the experimental methods in the following examples the specific conditions of which are not specifically indicated, they are performed under routine conditions, e.g., those described by Sambrook. et al., in Molecule Clone: A Laboratory Manual, New York: Cold Spring Harbor Laboratory Press, 1989, or as instructed by the manufacturers, unless otherwise specified. Percentages and parts are by weight unless otherwise stated.
Example 1 Construction of Lentiviral Expression Vector
[0226] The full-length DNA synthesis and cloning were commissioned by Shanghai Boyi Biotechnology Co., Ltd to achieve the construction of coding plasmids. The pWPT lentiviral vector was selected as a cloning vector, and the cloning sites were BamH I and Sal I sites. The specific sequence is as described above.
Example 2 Preparation of CAR-T Cell
[0227] (1) Mononuclear cells (PBMCs) were isolated from venous blood of healthy people by density gradient centrifugation. [0228] (2) On day 0, PBMCs were seeded in a cell culture flask previously coated with CD3 monoclonal antibody (OKT3) at a final concentration of 5 g/mL and Retronectin (purchased from TAKARA) at a final concentration of 10 g/mL. The medium was GT-551 cell culture medium containing 1% human albumin. Recombinant human interleukin 2 (IL-2) was added to the medium at a final concentration of 1000 U/mL. The cells were cultured in an CO.sub.2 incubator with a saturated humidity of 5% at 37 C. [0229] (3) On day 1, the supernatant of the cultured PBMCs was slowly aspirated and discarded. New GT-551 cell culture medium containing 1% human albumin was added, and recombinant human interleukin 2 (IL-2) was added to the medium at a final concentration of 1000 U/mL. The cells were continuously cultured in an CO.sub.2 incubator with a saturated humidity of 5% at 37 C. [0230] (4) On day 3, fresh medium, concentrated and purified CAR-BCMAs lentivirus solution, protamine sulfate (12 ug/ml), and IL-2 (at a final concentration of 1000 U/mL) were added. After 12 hours of infection in a 5% CO.sub.2 incubator at 37 C., the culture medium was discarded, fresh medium was added, and cultivation was continued in a 5% CO.sub.2 incubator at 37 C. [0231] (5) Starting from day 6, CAR-BCMAs cells can be taken for the corresponding activity assay.
Example 3 Detection of the Integration Rate of the CAR Gene in the T Cell Genome and the Expression Level of the Encoded Protein Thereof on the Membrane Surface
[0232] 0.510.sup.6 of CART-BCMAs cell samples cultured on day 7 (
[0233] The result is shown in
Example 4 Detection of the In Vitro Activation Ability of CAR-BCMAs
[0234] Cell activation level indicator proteins CD137 and IFN was detected using CART-BCMAs cells cultured on day 7 in Example 2. 110.sup.5 of CART-BCMA cells cultured on day 7 were cultured respectively with BCMA-positive K562-BCMA+E7 tumor cell line and BCMA-negative K562 tumor cell line, or without tumor cells, in 200 l GT-551 medium for 18 h at a ratio of 1:1. Then the expression level of CD137 on the surface of T cell membrane was detected by flow cytometry and the secretion level of IFN in the culture supernatant was detected by ELISA.
[0235] The results are shown in
[0236] Additionally, C-CAR088 induced higher levels of IFN- release (
[0237] CART-BCMA-20 induced greater apoptosis of BCMA-positive tumor cells than CART-BCMA-1 (positive control), CART-BCMA-MO6 and CART-BCMA-CA8 (
Example 5 Detection of Advanced Apoptosis Activity of Tumor Cells Induced by CART-BCMAs Cells
[0238] (1) The CART-BCMAs cells cultured on day 17 in Example 2 were mixed respectively with 110.sup.4 CFSE-labeled BCMA-negative cells (NH929) or BCMA-positive self-constructed cells (NH929-BCMA overexpressing tumor cell line) at a ratio of 1:1, 2.5:1, 5:1, 10:1, 20:1 (as shown in
[0240] The results are shown in
Example 6 Inhibition of CART-BCMAs on RPMI-8226 Myeloma Xenograft Model
[0241] RPMI-8226 cells in logarithmic growth phase were collected, and 4.010.sup.6 tumor cells were inoculated subcutaneously in the right back of 6-8 week old B-NDG mice. When the tumor volume reached about 120 mm.sup.3, the animals were randomly divided into 4 groups according to tumor volume, so that the tumor volume difference of each group was less than 10% of the mean value. Then the solvent control, 7.510.sup.6 NT and 7.510.sup.6 CART-BCMAs cells were injected through tail vein respectively.
[0242] The results are shown in
[0243] For in vivo studies, B-NDG mice were xenografted with human myeloma RPMI-8226 cells. When the tumor volume reached about 120 mm.sup.3, the solvent control, non-transfected (NT) T cells (a negative control) or CART-BCMAs cells were injected through the tail vein of the mice.
[0244] Compared with the control group, a single injection of CART-BCMA-1 and CART-BCMA-20 effectively inhibited the growth of the myeloma cells, and significantly prolonged the survival time of human myeloma-bearing mice: median survival of the CART-BCMA-treated groups was >33 days, while median survival of the control group was 23 days. There was no significant difference in the tumor proliferation rate and median survival between the mice treated with CART-BCMA-1 and the mice treated with CART-BCMA-20 (
[0245] The results suggest that BCMA-20 (C-CAR088) had high in vivo anti-tumor efficacy.
Comparative Example
[0246] In the screening process of the chimeric antigen receptor of the present application, the inventors tested a large number of candidate sequences, which are illustrated below with examples.
[0247] The antibodies to be screened include: BCMA-1, BCMA-2, BCMA-69, BCMA-72, BCMA-2A1, BCMA-1E1, BCMA-J22.9, BCMA-20, BCMA-CA8, and BCMA-MO6. Structures of chimeric antigen receptor targeting BCMA were constructed on the basis of the above antibodies. Among them, BCMA-1 and BCMA-2 are published Car-T sequences and used as a positive control for screening. CAR-T cells were prepared in the same way as in Example 2, and detected in the same way as in Examples 3 and 4.
[0248] The results are shown in
Example 7 Membrane Protein Array Experiment
[0249] The light chain variable region of SEQ ID NO: 1 and the heavy chain variable region of SEQ ID NO: 2 were used to prepare a single chain antibody B20-scFv-rabFc, and membrane protein array experiment was performed.
[0250] 20 ug/mL of B20-scFv-rabFc was added to HEK293T cell array transiently transfected with 5344 membrane proteins, respectively. Flow cytometry found that, under this test condition, B20-scFv-rabFc may cross-recognize with TNFRSF17 (Q02223), MAG (P20916), CR2 (P20023), CXADR (P78310) and DDR2 (Q16832), wherein TNFRSF17, i.e., BCMA is the specific target of B20-scFv, and MAG, CR2, CXADR and DDR2 are suspected non-specific targets.
[0251] To further confirm whether the suspected target can cause the activation of CAR-T, CBM.BCMA CAR-T was co-cultured with 293T cells transfected with BCMA, CR2, CXADR, DDR2, and MAG, respectively. The IFN, TNF, IL-2 and other cytokines in co-culture supernatant were detected. 293T cells transfected with empty vector were used as a negative control, and 293T cells transfected with BCMA were used as a positive control.
[0252]
[0253] The cytokine detection results are shown in
[0254]
[0255] Specific membrane staining was observed on human lymphocytes in thymus, spleen, lymph nodes, bone marrow and scattered lymphocytes in thyroid gland, adrenal gland at the concentrations of 20.0 g/mL (Table 1 and
TABLE-US-00028 TABLE 1 Staining site Tissue 5.0 g/mL 20.0 g/mL Nucleus Esophagus, mucosal 1/3.sup.a, +.sup.b 1/3, + layer Cytoplasm Stomach, mucosal 1/3, + 2/3, + layer Kidney, cortex 1/3, + 2/3, + Bladder, mucosal 1/3, + layer Membrane Thyroid 3/3, + Thymus, cortex, 3/3, + 3/3, + medulla Spleen, splenic cord 2/3, + 3/3, +~++ Lymph node, medulla 3/3, + 3/3, + Adrenal gland, cortex 3/3, + Bone marrow 3/3, + .sup.anumber of positive staining in 3 donors. .sup.bstaining intensity of positive cells and percentage of positive cells in the cells of the same type. No stained cells, + weakly positive staining, <10% cells are stained, ++ moderately positive staining, 11%-50% cells are stained.
Example 8 In Vitro Anti-Tumor Activity of C-CAR088 Cells
[0256] The chimeric antigen receptor BCMA-20 (hereafter named C-CAR088) was selected for subsequent experiments. C-CAR088 cells, NT cells (non-transfected T cells, used as negative control) and positive control cells (Bluebird bb2121) were co-cultured with BCMA negative cells (NH929) or BCMA positive cells (NH929-BCMA) at different effect target ratios, The killing ability of each cell to the target cell was analyzed.
[0257] The results are shown in
[0258] T cells with C-CAR088, non-transfected (NT) T cells (a negative control) and positive control cells (Bluebird bb2121) were co-cultured with BCMA negative cells (NH929) or BCMA positive cells (NH929-BCMA) at different effect/target ratios. Then the cytotoxicity was assayed.
[0259]
Example 9 Effect of Soluble BCMA on Cell Killing Activity
[0260] In the co-cultivation system of C-CAR088 cells with BCMA negative target cells A549 and BCMA positive target cells A549-BCMA-2E9, 100 ng/ml and 500 ng/ml soluble BCMA protein was added respectively to detect its effect on CD137 expression.
[0261] The results are shown in
Example 10 Dose Dependent Effect of C-CAR088 Cells
[0262] 6 week old B-NDG mice (half male and half female) were selected and intraperitoneally injected with 2.510.sup.6 human multiple myeloma cells RPMI-8226. Mice with similar tumor burden were selected and divided into 5 groups, and were injected with 2.510.sup.6 C-CAR088 cells (low-dose group), 510.sup.6 C-CAR088 cells (medium-dose group), 110.sup.7 C-CAR088 cells (high-dose group), T cells and vehicle (with cryoprotectant (CBMG C-CFMC) as vehicle), respectively. The experiment lasted 54 days. During the experiment, the tumor burden of the mice was evaluated every 5 days. At the end of the experiment, the survival rate of the mice was calculated.
[0263] The results are shown in
Example 11 Phase I Clinical Study of C-CAR088
[0264] With the approval of the Ethics Committee, a total of 15 volunteers conducted phase I clinical trials. The key eligibility criteria for volunteer are as follows: patients with multiple myeloma aged 18-75 years old, MM cells express BCMA, have measurable MM, and have received 2 prior lines of therapy for MM and have received treatment with PI and IMiD, have adequate hepatic, renal, cardiac and hematopoietic function.
[0265] The experimental process is shown in
[0266] The treatment results are shown in
TABLE-US-00029 TABLE 2 Clinical response Serum M Fol- pro- Re- low tien/ Clinical response search up sFLC Best center Patient ID length type Baseline 2 w 4 w 8 w 12 w 16 w 20 w 6 m ORR Jiangsu Z0203- 6 m IgG 71.0 g/L 42.0 g/L 26.3 g/L 1.8 g/L 6.2 g/L 7.0 g/L 16.4 g/L 45 g/L VGPR Pro- 00801C001 UIF() UIF() UIF() vincial Z0203- 12 w k 3250 mg/L 3050 mg/L 75 mg/L 170 mg/L 960 mg/L PD VGPR Peo- 00801C003 SIF() ple's UIF(+) Hos- UPEP() pital Z0203- 6 m IgG 46.5 g/L 7.9 g/L 9.0 g/L SPEP() SPEP() SPEP() SPEP() 21.6 g/L VGPR 00801C004 UIF() UIF() UIF() UIF() SIF(+) SIF(+) SIF(+) SIF(+) Z0203- 20 w IgG 26.1 g/L 9.1 g/L 4.8 g/L 14.6 g/L 9 g/L* 10 g/L* 17 g/L * PD PR 00801C008 Z0203- 4 e IgG 55.7 g/L 45.4 g/L 23.3 g/L PR 00801C010 Z0203- 3 w IgG 22.5 g/L 18.8 g/L SD 00801C011 Tianjin Z0203- 8 w IgA 16.7 g/L 7.4 g/L 3.6 g/L SPEP(-) VGPR Hema- 01301C001 UIF(-) tology SIF(+) Hos- Z0203- 4 w IgG 50.2 g/L 27.1 g/L 15.0 g/L PR pital 01301C003 Z0203- 4 w 760 mg/L SPEP() SPEP() VGPR 01301C006 UIF() UIF() SIF(+) SIF(+) Peking Z0203- 4 w IgG 17.4 g/L 10.8 g/L 5.3 g/L PR Union 00701C001 Medical Z0203- 4 w IgG 21.7 g/L 15.8 g/L 7.9 g/L PR College 00701C002 Hos- pital Daupei Z0203- 12 w 187 mg/L 3.28 mg/L UIF- SIF- SIF- SIF- SIF- SIF- sCR Hos- 00601C002 SIF- UIF- UIF- UIF- UIF- UIF- pital MRD- MRD- MRD- MRD- MRD- MRD- Z0203- 4 w 209 mg/L SIF- SIF- SIF- SIF- sCR 00601C004 UIF- UIF- UIF- UIF- MRD- MRD- MRD- MRD- Z0203- 4 w IgG 28.27 g/L 24.3 g/L 8.6 g/L PR 00601C005 Z0203- 2 W 121 mg/L SIF-UIF- sCR 00601C006 MRD-
[0267] The treatment-emerging adverse events are shown in Table 3. Only one patient occurred grade 3 cytokine release syndrome in 15 patients. No neurotoxicity events and no dose-limiting toxicity (DLTs) were observed in the dose escalation. The cytopenias is mostly related to Cy/Flu lymphodepletion. It should be noted that the occurrence of a certain degree of cytokine release syndrome after treatment also illustrates the effectiveness of CART treatment from the side. None of the 15 patients had particularly serious cytokines, and C-CAR088 has better safety.
TABLE-US-00030 TABLE 3 Treatment-Emerging Adverse Events Treatment-Emerging Adverse Events n (%) Overall n (%) Grade 3/4 Cytokine release syndrome 14(93) 1(7) Neutropenia 15(100) 15(100) Thrombocytopenia 13(87) 11(73) Anemia 12(80) 6(40) Increased AST 5(33) 3(20) Infection 3(20) 3(20)
[0268]
[0269]
[0270] Summary of observations for C-CAR088 was as follow. [0271] In preclinical studies, C-CAR088 showed antitumor activity both in vitro and in vivo. [0272] Early C-CAR088 trial results in patients with r/r MM support preclinical findings, showed promising efficacy and manageable safety profile. [0273] The early clinical efficacy signal at low, suboptimal dose was encouraging. [0274] Compared to KarMMa data, our current dose level from infused patients was well below the optimal dose of bb2121. 53% ( 8/15) were recently dosed (at 4 weeks). [0275] Dose dependence was observed based on PK profile. C-CAR088 was well tolerated in patients.
Example 12 an Anti-BCMA CAR T-Cell Therapy (C-CAR088) Showed Promising Safety and Efficacy Profile in Treating Relapsed or Refractory Multiple Myeloma (r/r MM)
[0276] Our studies demonstrated that C-CAR088 was considerably more cytotoxic towards tumor cells both in vitro and in vivo, compared to other anti-BCMA CARs.
[0277] We conducted a clinical trial of an anti-BCMA CAR (BCMA-20, also termed C-CAR088) in treating relapsed/refractory multiple myeloma (R/R MM) in patients.
[0278] Clinical trials are evaluated along a number of different criteria. Two key measures are overall response rate (ORR) and complete response rate (CR). When compared with other anti-BCMA CARs, the CARs of the claimed method offer better therapeutic efficacy in a clinical trial, as reflected by high response rates (95% overall response rate or ORR, and 67% complete response rate or CR) in treating relapsed/refractory multiple myeloma (R/R MM). Even when compared with JNJ-4528 (CARTITUDE-1), the percentage of adverse events, such as neurotoxicity, in the C-CAR088 was significantly lower. Specifically, for C-CAR088, only 4% patients experienced grade 1 neurotoxicity which resolved spontaneously. Thus, the CAR-T cells of the claimed method offered a favorable safety profile.
[0279] C-CAR088 demonstrated a manageable safety profile. [0280] Most cases of CRS were grade with median time to onset of 6 days. [0281] Neurotoxicity (ICANS) was infrequent and generally low-grade with 1 grade 1 event.
[0282] Dose dependent responses occurred early and deepened. [0283] ORR: 95.7%, with 43.5% CR rate at median time to CR: 1.6 months (range: 0.5-9.5).
[0284] Median time to response: 0.5 month. [0285] At median 6.2 months follow up, 65.1% patients were progression-free at 6 months
[0286] In preclinical studies, C-CAR088 showed very good in vitro and in vivo anti-tumor activity and target specificity. Clinical trial results in 24 patients with r/r MM showed strong therapeutic index with promising efficacy and manageable safety profile.
[0287] We conducted a clinical trial of an anti-BCMA CAR (BCMA-20, also termed C-CAR088) in treating relapsed/refractory multiple myeloma (R/R MM) in patients. The patients' baseline demographics and clinical characteristics prior to the start of our anti-BCMA CAR treatment are shown in Table 4.
[0288] The median age of the patients dosed was 60 years (range: 45-74 years). The median number of prior lines of therapy was 4 (ranging from 2-12 prior therapies). All patients had received prior treatment with IMiDs (immunomodulatory drug) and proteasome inhibitors. 25% patents were previously treated with anti-CD38 monoclonal antibody, while 25% patents had received autologous hematopoietic stem cell transplant.
TABLE-US-00031 TABLE 4 Summary of baseline clinical characteristics of the patients Characteristic N = 24 Characteristic N = 24 Median age, yrs (range) 60 (45-74) High Risk Cytogenetics*, n (%) Age 65, n (%) 9 (37.5) 0 3 (12.5) Male/Female, n 14/10 1 5 (20.8) MM subtype, n (%) 2 11 (45.8) IgG 14 (58.3) 3 2 (8.3) IgA 3 (12.5) Unknown 3 (12.5) IgD 1 (4.2) Median number of prior lines of therapy, n 4 (2-12) Light Chain 6 (25) (range) ECOG PS, n (%) Prior regimens, n (%) 0 15 (62.5) Prior PIs and IMiDs 24 (100) 1 9 (37.5) Prior ASCT 6 (25.0) ISS stage, n (%) Prior CD38 mAb 6 (25.0) I 7 (29.2) Received bridging therapy, n (%) 4 (16.7) II 11 (45.8) III 6 (25) *Including 1q21 gain, del (17p), t (4; 15) and t (14; 16).
[0289] The clinical protocol, as well as the key inclusion criteria, is shown in
[0290] At 5 and 3 days before the CAR-T infusion, the patients received lymphodepletion pretreatment, including fludarabine (30 mg/m.sup.2/d, intravenous, once per day for three days), and cyclophosphamide (300 mg/m.sup.2/d, intravenous, once per day for three days).
[0291] Approximately 72 hours after lymphodepletion, the patients were administered 1.0-6.010.sup.6 CAR-T cells/kg on day 0 as 3+3 dose escalation. Follow-ups with the patients were carried out after the infusion starting on day 1 through month 24.
[0292] The primary objectives included safety: rated of dose limiting toxicities; incidence and severity of treatment-emergent adverse events (CTCAEV5.0). Secondary objectives included efficacy: IMWG 2016 ORR; DOR; PFS; OS. Exploratory objectives included CAR-T expansion and persistence.
[0293] As shown in
[0294] The CR/sCR, VGPR and PR for overall and each dose group are shown in Table 5 and
TABLE-US-00032 TABLE 5 1.0 10.sup.6/kg 3.0 10.sup.6/kg 4.5-6.0 10.sup.6/kg Overall (n = 3) (n = 11) (n = 10)* Response (n = 24) (low dose) (mid dose) (high dose) ORR, n (%) 23 (95.8%) 3 (100%) 11 (100%) 9 (90.0%) CRR, n (%) 13 (54.2%) 0 6 (54.5%) 7 (70.0%) *1 patient received 4.5 10.sup.6/kg and 1 received 5.0 10.sup.6/kg.
[0295] Table 6 below compares the C-CAR088 trial with those of Munshi et al. (KarMMa: Idecabtagene Vicleucel), Mailankody et al. (EVOLVE: Orvacabtagene Autoleucel) and Madduri et al. (CARTITUDE-1: JNJ-4528).
TABLE-US-00033 TABLE 6 Comparison of C-CAR088 clinical trial with other BCMA-specific CARs KarMMa: EVOLVE: Idecabtagene Orvacabtagene CARTITUDE-1: Vicleucel Autoleucel JNJ-4528 C-CAR088 (n = 128) (n = 62) (n = 97) (n = 24) Median age, yrs (range) 61 (33-78) 61 (33-77) 61 (43-78) 60 (45-74) High risk cytogenetics 35% 41%* 24% 75%* Tumor burden in >50% PC: >60% PC: >50% PC: BM, % 51 22 17 Extramedullary PCs 39% 23% 13% 8% Median prior lines of 6 (3-16) 6 (3-18) 6 (3-18) 4 (2-12) therapies, No. (range) Triple refractory, % 84% 94% 88% 25% Bridging therapy 88% 63% 17% CRS: all/grade 3 84%/6% 89%/3% 95%/5% 92%/4% ICANS: all/grade 3 17%/3% 13%/3% 21%/10% 4%/0 (Neurotoxicity) ORR 73% 92% 97% 95% SCR/CR 33% 36% 67% 67% Evaluable patients 94% 84% 55% 83% with MRD neg 10.sup.5 PFS, mos 8.8 9.3.sup.+ 12-mo PFS: 6-mo PFS: 76.6% 78.7%.sup.# *Includes +1q21. .sup.+PFS in lowest dose cohort (300 10.sup.6 cells). .sup.#Results in 3-6 10.sup.6 CAR-T cell/kg dose cohort. ICANS: immune effector cell-associated neurotoxicity syndrome.
[0296] See, Munshi et al., Idecabtagene vicleucel (ide-cel; bb2121), a BCMA-targeted CAR T-cell therapy, in patients with relapsed and refractory multiple myeloma (RRMM): Initial KarMMa results, Journal of Clinical Oncology, 2020, 38(15) suppl., Abstract 8503; Mailankody et al., Orvacabtagene autoleucel (orva-cel), a B-cell maturation antigen (BCMA)-directed CAR T cell therapy for patients (pts) with relapsed/refractory multiple myeloma (RRMM): update of the phase EVOLVE study (NCT03430011), Journal of Clinical Oncology, 2020, 38(15) suppl., Abstract 8504; Madduri et al., CARTITUDE-1: Phase 1b/2 Study of Ciltacabtagene Autoleucel, a B-Cell Maturation AntigenDirected Chimeric Antigen Receptor T Cell Therapy, in Relapsed/Refractory Multiple Myeloma, 62nd ASH Annual Meeting and Exposition, Dec. 5-8, 2020, Abstract 177.
[0297] For our clinical trial of C-CAR088, the Kaplan Meier progression-free survival (PFS) estimates include a 6-month PFS of 78.7% for the mid- and high-dose group, with 95% confidence intervals (CIs) of 62.1%-99.7%. Median duration of response (DOR) was not reached. See Table 7 and
TABLE-US-00034 TABLE 7 Time (month) 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 n.risk 21 19 19 18 16 16 13 13 10 9 8 8 5 3 2 1 1 1 1 n.event 1 0 0 0 1 2 0 0 1 0 0 0 0 0 0 0 0 0 0
[0298] The time course of the CAR copies in the blood of the patients is shown in
[0299] C-CAR088 treatment was well tolerated. The patients' adverse reactions (adverse events, AEs) were recorded (Tables 8 and 9). There was only 1 (4.2%) grade 3 cytokine release syndrome (CRS). Neurotoxicity was observed only in one patient (4.2%) which resolved spontaneously, with no grade 3 neurotoxicity. Cytopenia, such as neutropenia and thrombocytopenia, was mostly related to the fludarabine/cyclophosphamide (Cy/Flu) lymphodepletion. No dose-limiting toxicities were observed, and all adverse events were reversible. These demonstrated that our anti-BCMA CAR had an excellent safety profile.
TABLE-US-00035 TABLE 8 Grade 3 AEs (25%), n (%) Any Grade (n = 24) (n = 24) Neutropenia 24 (100%) 22 (91.7%) Lymphopenia 22 (91.7%) 20 (83.3%) Thrombocytopenia 22 (91.7%) 9 (37.5%) Anemia 20 (83.3%) 12 (50.0%) Elevated AST/ALT 13 (54.2%)/8 (33.3%) 4 (16.7%)/0 (0) Infection 12 (50.0%) 6 (25.0%)
TABLE-US-00036 TABLE 9 Grade 3 CRS & Neurotoxicity * Any Grade (n = 24) (n = 24) CRS, n (%) 22 (91.7%) 1 (4.2%) Median days to onset, d (range) 6 (1-11) Median days to resolution, d (range) 5 (2-9) Treated with Tocilizumab, n (%) 6 (26.1) Treated with Steroids, n (%) 2 (8.7) Neurotoxicity, n (%) 1 (4.2%) 0 (0) Days to onset, d 8 Days to resolution, d 1 * ASTCT Consensus Grading for Cytokine Release Syndrome and Neurologic Toxicity Associated with Immune Effector Cells 2019. CRS: Cytokine release syndrome
[0300] The scope of the present invention is not limited by what has been specifically shown and described hereinabove. Those skilled in the art will recognize that there are suitable alternatives to the depicted examples of materials, configurations, constructions and dimensions. Numerous references, including patents and various publications, are cited and discussed in the description of this invention. The citation and discussion of such references is provided merely to clarify the description of the present invention and is not an admission that any reference is prior art to the invention described herein. All references cited and discussed in this specification are incorporated herein by reference in their entirety. Variations, modifications and other implementations of what is described herein will occur to those of ordinary skill in the art without departing from the spirit and scope of the invention. While certain embodiments of the present invention have been shown and described, it will be obvious to those skilled in the art that changes and modifications may be made without departing from the spirit and scope of the invention. The matter set forth in the foregoing description and accompanying drawings is offered by way of illustration only and not as a limitation.