EXPRESSION VECTORS COMPRISING ENGINEERED GENES

20210000977 ยท 2021-01-07

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides expression vectors, nucleic acids, vector particles and methods of treatment involving these vector particles, comprising an engineered KCNA1 gene encoding an edited Kv1.1 potassium channel, as well as methods of confirming the presence of engineered KCNA1 mRNA in a cell. The features of the engineered KCNA1 gene combine to advantageously enhance the translation and activity of the Kv1.1 protein and improve detection of KCNA1 gene expression in a cell and can be used for example in the treatment of epilepsy and similar neurological disorders.

Claims

1. An expression vector comprising an engineered KCNA1 gene encoding an edited Kv1.1 potassium channel operably linked to a promoter suitable to drive expression of the edited Kv1.1 potassium channel in human cells, wherein the engineered KCNA1 gene has a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence shown in SEQ ID NO: 1, and wherein the edited Kv1.1 potassium channel has an amino acid sequence having at least 90% sequence identity to the amino acid sequence shown in SEQ ID NO:2 and comprises a valine amino acid residue at a position corresponding to amino acid residue 400 shown in SEQ ID NO: 2.

2. An expression vector of claim 1, wherein the edited Kv1.1 potassium channel has an amino acid sequence comprising or consisting the amino acid sequence shown in SEQ ID NO: 2.

3. An expression vector of claim 2, wherein the engineered KCNA1 gene has a nucleotide sequence comprising or consisting of the nucleotide sequence shown in SEQ ID NO: 1.

4. An expression vector of claim 1, wherein the promoter is a cell type specific promoter, which is optionally a promoter is specific for neurons.

5. (canceled)

6. An expression vector of claim 4, wherein the cell type specific promoter is specific for pyramidal neurons.

7. An expression vector of claim 1, wherein the cell type specific promoter comprises a human CAMK2A promoter.

8. An expression vector of claim 7, wherein the human CAMK2A promoter has a nucleotide sequence comprising or consisting of the nucleotide sequence shown in SEQ ID NO: 3 or a nucleotide sequence having at least 80% identity to the nucleotide sequence shown in SEQ ID NO: 3.

9. An expression vector of claim 1 wherein the vector is a viral vector.

10. An expression vector of claim 9, wherein the viral vector is a lentiviral vector, optionally wherein the lentiviral vector is a non-integrating lentiviral vector.

11. An expression vector of claim 10, wherein the lentiviral vector comprises a nucleotide sequence having at least 95% identity to the nucleotide sequence of SEQ ID NO: 9.

12. An in vitro method of making viral particles comprising: transducing mammalian cells with a lentiviral vector according to claim 10 and expressing viral packaging and envelope proteins necessary for particle formation in the cells; and culturing the transduced cells in a culture medium, such that the cells produce lentiviral particles that are released into the medium.

13. An in vitro method of claim 12, wherein the method comprises transducing the mammalian cells with one or more viral packaging and envelope expression vectors that encode the viral packaging and envelope proteins necessary for particle formation.

14. An in vitro method of claim 12, wherein the one or more packaging proteins includes a non-functional integrase enzyme such that the lentiviral vector is unable to incorporate its viral genome into the genome of the cell.

15. An in vitro method of claim 12 further comprising separating the viral particles from the culture medium and optionally concentrating the viral particles.

16. (canceled)

17. A viral particle comprising a single stranded RNA molecule encoding an engineered KCNA1 gene operably linked to a promoter suitable to drive expression in human cells, wherein the engineered gene encodes an edited Kv1.1 potassium channel, wherein the engineered KCNA1 gene has a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence shown in SEQ ID NO: 1 and wherein the edited Kv1.1 potassium channel has an amino acid sequence having at least 90% sequence identity to the amino acid sequence shown in SEQ ID NO:2 and comprises a valine amino acid residue at a position corresponding to amino acid residue 400 shown in SEQ ID NO: 2.

18. A kit comprising an expression vector of claim 10 and one or more viral packaging and envelope expression vectors that encode viral packaging and envelope proteins necessary for particle formation when expressed in a cell, wherein the viral packaging expression vector is optionally an integrase-deficient viral packaging expression vector.

19. (canceled)

20. (canceled)

21. (canceled)

22. A method of treatment of a neurological disorder comprising administering to an individual with the neurological disorder the viral particle of claim 17.

23. (canceled)

24. A method of treatment of claim 22, wherein the neurological disorder is associated with neuronal hyperexcitibility.

25. A method of treatment of claim 22, wherein the neurological disorder is a seizure disorder.

26. A method of treatment according to claim 25, wherein the seizure disorder is epilepsy, which is optionally neocortical epilepsy.

27. (canceled)

28. A method of treatment of claim 22, wherein the neurological disorder is Parkinson's disease or chronic pain.

29. (canceled)

30. A method of confirming the presence of engineered KCNA1 mRNA in a cell, the method comprising: transducing a cell with an expression vector of claim 1 or administering a viral particle of claim 18 to a cell under conditions that permit expression of engineered KCNA1 mRNA; and detecting the presence of the engineered KCNA1 mRNA in the cell using a hybridisation assay.

31. An in vitro or ex vivo method of confirming the presence of engineered KCNA1 mRNA in a cell that has been obtained from a subject administered with a viral particle of claim 18, the method comprising: detecting the presence of engineered KCNA1 mRNA in the cell using a hybridisation assay.

32. (canceled)

33. A cell comprising the expression vector of claim 1, wherein the cell is optionally a mammalian cell, which is optionally a human cell, which is optionally a human embryonic kidney cell.

34. (canceled)

35. (canceled)

36. (canceled)

37. A nucleic acid comprising an engineered KCNA1 gene encoding an edited Kv1.1 potassium channel, wherein the engineered KCNA1 gene has a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence shown in SEQ ID NO: 1 and wherein the edited Kv1.1 potassium channel has an amino acid sequence having at least 90% sequence identity to the amino acid sequence shown in SEQ ID NO:2 and comprises a valine amino acid residue at a position corresponding to amino acid residue 400 shown in SEQ ID NO: 2.

Description

FIGURES

[0130] FIG. 1: Characterisation of the visual cortex TeNT model of focal neocortical epilepsy.

[0131] A. Representative seizure from an adult male Sprague Dawley rat showing its long duration and evolution over time (see FIG. 2 for representative seizures from Lister Hooded and Long-Evans rats). Expanded sections are taken at the times indicated.

[0132] B. Number of seizures per week for 9 animals recorded over a period of 5 weeks showing an increase to plateau at week 3, followed by a decline in frequency during week 5.

[0133] C. Cumulative seizure frequency (per day) over the same period.

[0134] D. Seizure duration (per week) over the same period indicating an initial rise to a stable duration of around 100 s.

[0135] E. Behavioural correlates of 102 randomly selected electrographic seizures (N=8 animals, n=102 seizures). All behaviour was assessed by a neurologist using video recordings time-locked to the ECoG trace. In the 11 cases where the behavioural correlate is unknown, either the animals were not visible beneath bedding or the video signal was interrupted.

[0136] Data are presented as meanthe standard error of the mean (SEM).

[0137] FIG. 2: The TeNT visual cortex model of focal neocortical epilepsy is not strain-specific.

[0138] Representative seizures from Lister Hooded, Long-Evans and Sprague Dawley rats.

[0139] FIG. 3: Kv1.1 overexpression reduces seizure frequency in the visual cortex model of focal neocortical epilepsy.

[0140] A. Neuronal transduction by the CMV-KCNA1 lentivector is restricted to a narrow column of cortex surrounding the site of injection.

[0141] B. Representative seizures from two animals after treatment with the CMV-KCNA1 lentivector (bottom trace) or its GFP-only control (top trace).

[0142] C. Raster plots of all seizures experienced by the same animals over the full 5 weeks of recording. Seizures presented in panel B are marked by asterisks.

[0143] D. Seizure frequency (per week) for rats treated with the CMV-KCNA1 lentivector (n=8) or its GFP-only control (n=8). The numbers of seizures experienced each week were normalized to the number experienced by each animal in the week preceding treatment (week BI). The CMV-KCNA1 lentivector significantly reduced normalized seizure frequency in the weeks following treatment.

[0144] E. Cumulative seizure frequency (per day) for rats treated with the CMV-KCNA1 lentivector or its GFP-only control. Cumulative seizure counts were normalized to the number experienced by each animal in the 7 days preceding treatment.

[0145] Data are presented as meanSEM.

[0146] FIG. 4: Kv1.1 overexpression with the CMV-KCNA1 lentivector suppresses inter-ictal spiking

[0147] A. Example ECoG traces of inter-ictal spikes.

[0148] B. Cumulative inter-ictal spike frequency (per day) for rats treated with the CMV-KCNA1 lentivector (n=8) or its GFP-only control (n=7). Cumulative inter-ictal spike counts were normalized to the number experienced by each animal in the 7 days preceding treatment. The frequency of inter-ictal spikes was significantly reduced by treatment with the CMV-KCNA1 lentivector (cumulative values at day 28 compared with a Mann Whitney U test; p=0.04).

[0149] FIG. 5: Design and characterisation of an optimized KCNA1 gene therapy for clinical translation.

[0150] A. Lentiviral transfer plasmid maps for the CMV-KCNA1 pilot vector (i), the optimized EKC vector (ii) and its reporter-only control (iii). Abbreviations: RSVRous sarcoma virus promoter; LTRlong terminal repeat; HIV-1 HIV-1 packaging signal; RRERev response element; cPPT/CTScentral polypurine tract and central termination sequence; EF1elongation factor 1 promoter; WPREwoodchuck hepatitis virus post-transcriptional regulatory element.

[0151] B. Heterologous expression of functional Kv1.1 channels from the optimized EKC transfer plasmid. (i): Representative current-time trace from a Neuro-2a cell transfected with the EKC transfer plasmid. (ii): Plot of mean current density against voltage for cells transfected with the EKC transfer plasmid (Kv; n=13), cells transfected with the dscGFP-only control plasmid (G; n=8), and untransfected controls (UT; n=10). Inset: histogram showing differences in current density between the three groups during the voltage step to +20 mV (Kv vs. UT: p=0.0013; Kv vs. G: p=0.0012; UT vs. G: p=0.82; ns=not significant; Welch's one-way ANOVA with Games-Howell post-hoc tests). (iii): Plot of mean normalised conductance against voltage for cells transfected with the EKC transfer plasmid. Data are fit with a single Boltzmann function. The V.sub.0.5 (voltage of half-maximal conductance) of 28.2 mV is similar to values obtained from human embryonic kidney 293 (HEK293) cells transfected with CMV-driven, wild-type KCNA1 (32.80.9 mV) (Tomlinson et al., 2013). All error bars represent SEM.

[0152] C. Bright-field (left) and fluorescence (right) images of a brain slice from a rat injected in the left visual cortex with 1.25 l (310.sup.6 infectious units (IU)) of the EKC lentivector showing a pattern of transduction similar to that of the CMV-KCNA1 vector.

[0153] D. Immunohistochemical assessment of the cell type specificity of EKC expression. (i): There was no overlap between lentivector-transduced neurons expressing dscGFP and astrocytes stained for GFAP. (ii): There was 100% overlap between dscGFP+ cells and neurons stained for NeuN. (iii): Minimal overlap was observed between dscGFP+ cells and inhibitory interneurons stained for GAD67.

[0154] FIG. 6: Cortical spread of EKC lentivector transduction.

[0155] Bright-field and fluorescence images of 6 sequential left-hemisphere visual cortex slices (70 m thick) from a rat brain injected with 1.25 l (310.sup.6 IU) of the EKC lentivector. Slices are ordered from top left (rostral) to bottom right (caudal). Scale bars represent 600 m and 200 m for bright-field and fluorescence images, respectively.

[0156] FIG. 7: EKC gene therapy robustly reduces seizure frequency in a blinded, randomised, pre-clinical trial.

[0157] A. Representative seizures from two animals after treatment with the EKC lentivector (bottom trace) or its dscGFP-only control (top trace).

[0158] B. Raster plots of all seizures experienced by the same animals over the full 5 weeks of recording. Seizures presented in panel A are marked by asterisks.

[0159] C. Normalized seizure frequency (per week) for rats treated with the EKC lentivector (n=7) or its reporter-only control (n=11). The EKC lentivector significantly reduced seizure frequency in the weeks following treatment.

[0160] D. Normalized cumulative seizure frequency (per day) for rats treated with the EKC lentivector or its reporter-only control.

[0161] Data are presented as meanSEM.

EXAMPLES

Example 1

Demonstration of Delivery of an Engineered Potassium Channel Gene in Epilepsy Gene Therapy

[0162] Materials and Methods

[0163] Molecular Biology

[0164] Lentiviral transfer plasmids were constructed using standard subcloning techniques. KCNA1 was codon optimized for human expression using GeneOptimizer software, and synthesised using GeneArt (Thermo Fisher Scientific). All plasmids were fully sequenced before use.

[0165] Voltage Clamp Recordings

[0166] Neuro-2a cells were obtained as a gift from the laboratory of S. Hart (UCL Institute of Child Health). Cells were grown in Gibco Dulbecco's Modified Eagle Medium (DMEM)+GlutaMAX (Thermo Fisher Scientific), supplemented with 10% heat-inactivated foetal bovine serum (Thermo Fisher Scientific), 1% penicillin/streptomycin (Thermo Fisher Scientific) and 1% non-essential amino acids (Sigma). Cultures were maintained in logarithmic growth phase in a humidified 5% CO.sub.2 atmosphere at 37 C. Transfections were performed using TurboFect transfection reagent (Thermo Fisher Scientific) according to the manufacturer's instructions. Transfected cells were plated onto 13 mm borosilicate glass coverslips (VWR). Coverslips were placed into the chamber of a BX51WI fixed-stage upright microscope equipped with UMPLFLN 10 and LUMPLFLN 40 water-immersion objectives (Olympus). Coverslips were submerged in a static bath of extracellular solution with the following composition (in mM): 140 NaCl, 4 KCl, 1.8 CaCl.sub.2, 2 MgCl.sub.2, 10 HEPES (pH 7.35, osmolarity 301 mOsm/L). Filamented borosilicate glass micropipettes (GC150-F; Warner Instruments) were pulled to tip resistances between 2.0 and 3.0 M using a P-97 Flaming/Brown micropipette puller (Sutter Instrument Company). Micropipettes were filled with an intracellular solution of the following composition (in mM): 140 KCl, 10 HEPES, 10 EGTA (pH 7.35, osmolarity 291 mOsm/L). Transfected cells were identified by their expression of the fluorescent marker dscGFP, excited with light of wavelength 488 nm. Macroscopic currents were recorded under voltage clamp using the whole-cell patch clamp configuration. The voltage step protocol used was as follows: cells were held at a resting potential of 80 mV and currents evoked by 200 ms depolarising steps delivered in 10 mV increments up to +20 mV. A 40 ms hyperpolarising step to 100 mV was included before returning to baseline. Data were filtered at 3 kHz and acquired at 10 kHz using WinWCP software (J. Dempster, University of Strathclyde) and an Axon Multiclamp 700B amplifier (Molecular Devices). Series resistance compensation was employed throughout, with prediction and correction components adjusted to 80% and the bandwidth set to 1.2 kHz. Cells with series resistance greater than 10 M were excluded from the analysis. All recordings were made at room temperature (23-26 C.). The liquid junction potential, calculated to be +4.1 mV, was left uncorrected. Leak currents were minimal and left unsubtracted.

[0167] For analysis, evoked currents were taken as the steady-state current in the last 40 ms of each voltage step. Baseline holding currents were subtracted before division by cell capacitance to generate current density values. To calculate normalised conductance, the current density at each voltage step was divided by the step potential minus the potassium reversal potential (91.34 mV). This generates raw conductance values that are corrected for the variation in K.sup.+ driving force which accompanies stepwise changes in membrane potential. Plots of raw conductance against voltage for each EKC-transfected cell were fit with individual Boltzmann functions given by the equation:

[00001] G = A 2 + A 1 - A 2 1 + e V - V 0.5 k

[0168] where G is the conductance, V the voltage, A.sub.1 the initial (minimum) conductance, A.sub.2 the final (maximum) conductance, V.sub.0.5 the voltage of half-maximal conductance, and k the slope factor. Raw conductance values were normalised to A.sub.1 and A.sub.2 of their own Boltzmann functions.

[0169] Raw conductance values were normalised to A.sub.1 and A.sub.2 of their own Boltzmann functions. Normalised conductance was then plotted against voltage for each EKC-transfected cell and again fit with individual Boltzmann functions. The mean adjusted R.sup.2 and V.sub.0.5 values presented in the results were extracted from these fits. For FIG. 5Biii, mean normalised conductance across cells was plotted against voltage before fitting with a final Boltzmann function. In line with convention, adjusted R.sup.2 and V.sub.0.5 values for this fit were not reported.

[0170] Lentiviral Synthesis

[0171] The CMV-KCNA1 lentivector was identical to that used in Wykes et al., 2012 and has the nucleotide sequence shown in SEQ ID NO: 6.

[0172] HEK293 producer cells were grown in Gibco DMEM+GlutaMAX, supplemented with 10% heat-inactivated foetal bovine serum and 1% penicillin/streptomycin. Cultures were maintained in logarithmic growth phase in a humidified 5% CO.sub.2 atmosphere at 37 C. Cells were split every 3-4 days using 0.05% Trypsin-EDTA (Thermo Fisher Scientific) and never grown for more than 15 passages. For lentiviral synthesis, cells were grown to a confluency of 70% and transiently co-transfected with pMDG-VSV.G, pCMVdR8.74.sup.D64V, and either the EKC transfer plasmid or its dscGFP-only control. pMDG-VSV.G and pCMVdR8.74.sup.D64V were obtained as gifts from the laboratory of A. J. Thrasher and W. Qasim (UCL Institute of Child Health). pMDG(VSV-G) encodes the envelope glycoprotein of the vesicular stomatitis virus. Lentivectors pseudotyped with VSV-G display a broad tropism and are relatively resistant to mechanical destruction during ultracentrifugation (Burns et al., 1993). pCMVdR8.74.sup.D64V is a 2.sup.nd generation human immunodeficiency virus 1 (HIV-1) packaging plasmid with an aspartic acid.sup.64-valine mutation in its integrase coding sequence. This mutation reduces genomic integration by a factor of 10,000 compared to wild-type levels (Leavitt et al., 1996). The mass ratio of envelope to packaging to transfer plasmids was 1:2.5:1.5. Transfections were performed using Lipofectamine 2000 transfection reagent (Thermo Fisher Scientific) at approximately 160 l per 100 g of total plasmid DNA. The transfection medium was removed after 18 hours and replaced with fresh medium. Two media harvests were collected, at 40 hours and 60 hours following transfection. Special care was taken to minimise cell detachment during each harvest. Harvested media were pre-cleaned by centrifugation at 1000 rpm for 3 min at 4 C., filtered through 0.45 m micropores and stored at 4 C. Media were overlaid on a sucrose solution with the following composition (in mM): 50 Tris-HCl, 100 NaCl, 0.5 EDTA (pH 7.4, 10% w/v sucrose), and centrifuged at 20,000 rpm for 2 hr at 4 C. The supernatant was discarded and lentiviral pellet resuspended in sterile PBS. Lentiviral suspensions were aliquoted and snap-frozen in liquid nitrogen before long-term storage at 80 C. A rough approximation of viral titre was obtained using the Lenti-X p24 rapid titer kit (Clontech). Each titration was performed in triplicate with 3 separate aliquots of each virus. Estimated titres were 2.4210.sup.9 IU/ml (EKC) and 4.2610.sup.9 IU/ml (control).

[0173] Surgical Procedures

[0174] All experiments were performed in accordance with the United Kingdom Animal (Scientific Procedures) Act 1986. Adult male rats (Sprague Dawley, Long-Evans or Lister Hooded; 300-400 g) were anaesthetized and placed into a stereotaxic frame (Kopf). 15 ng of TeNT (a gift from the laboratory of G. Schiavo (UCL Institute of Neurology)) was injected into layer 5 of the right visual cortex in a final volume of 1.0 l at a rate of 100 nl min.sup.1 (coordinates: 3 mm lateral, 7 mm posterior of bregma; 1.0 mm deep from the pia). An ECoG transmitter (A3028E; Open Source Instruments, MA, USA) was implanted subcutaneously with a subdural intracranial recording electrode positioned above the injection site. A reference electrode was implanted in the contralateral skull. A cannula (Plastics One) was positioned above the injection site for delivery of lentiviral vectors 11 or 14 days later. Each rat received a maximum of 2.0 l of lentivirus injected directly into the seizure focus. Animals injected with TeNT were housed separately in Faraday cages for the duration of the study.

[0175] ECoG Acquisition and Analysis

[0176] ECoG was recorded continuously for up to 6 weeks after surgery. Data were acquired using hardware and software purchased from Open Source Instruments. The method of seizure detection differed for the characterisation of the model, the pilot study and the final preclinical experiment. For the model characterisation, seizures were detected by continuous observation of the entire ECoG dataset by a neurologist. For the pilot study, ECoG traces were first divided into 1 s epochs. Four metrics (power, coastline, intermittency and coherence) were quantified for each epoch, and their values compared to those from a user-curated library of epochs validated by video as representing seizure activity (Wykes et al., 2012). Matched values were fed into a consolidation script that returned all instances of 5 or more sequential epochs identified as containing seizure activity. All seizures in the consolidation output were verified by an experimenter. For the final preclinical trial, 6 metrics were quantified for each epoch (power, coastline, intermittency, coherence, asymmetry and rhythm) and all matched values were checked for seizure activity without the use of a consolidation script. Seizure counts in this experiment were performed by an experimenter blinded to the treatment. For all datasets the minimum duration for a seizure was set at 10 s.

[0177] Behavioural Seizure Assessment

[0178] Assessment of the behavioural correlates of electrographic seizures was carried out by a neurologist. Seizures were randomly selected from the 5 weeks of recording, and associated behaviours observed using top-down video footage time-locked to the ECoG trace.

[0179] Immunohistochemistry

[0180] 1 week after lentivirus injection rats were terminally anaesthetised with sodium pentobarbital (Euthatal; Merial) and transcardially perfused with cold (4 C.) heparinised PBS (80 mg/litre heparin sodium salt; Sigma) followed by 4% paraformaldehyde (PFA) in PBS (Santa Cruz Biotechnology). Brains were removed and post-fixed in 4% PFA at 4 C. for a further 24 hours. After washing in PBS brains were sliced into 70 m coronal sections using a vibrating microtome (Leica). Slices were stored free-floating at 4 C. in PBS plus 0.02% sodium azide (Sigma). For antibody staining, slices were permeabilised for 20 minutes in PBS plus 0.3% Triton X-100 (Sigma) before blocking for 1 hour in PBS plus 0.3% Triton X-100 (Sigma), 1% bovine serum albumin (Sigma) and 4% goat serum (Sigma). Slices were incubated overnight at 4 C. in PBS plus 0.3% Triton X-100 and rabbit anti-NeuN (diluted 1:750; ab177487; Abcam), mouse anti-GFAP (diluted 1:500; MAB3402; Merck Millipore) or mouse anti-GAD67 (diluted 1:500; MAB5406; Merck Millipore) primary antibodies. After three 10 minute washes in PBS, slices were incubated at room temperature for 3 hours in PBS plus the relevant Alexa Fluor 594-conjugated secondary antibody (goat anti-rabbit (A-11037; Thermo Fisher Scientific) or goat anti-mouse (A-11005; Thermo Fisher Scientific); both diluted 1:750). After a further three 10 minute washes in PBS, slices were mounted onto plain glass microscope slides (Thermo Fisher Scientific) using Vectashield HardSet mounting medium (Vector Laboratories) and borosilicate glass coverslips (VWR). Bright-field and fluorescence images were acquired using one of two microscopes: an Axio Imager Al fluorescence microscope (Axiovision LE software) equipped with 2.5, 10 and 40 EC Plan-Neofluar non-immersion objectives, or an inverted LSM 710 confocal laser scanning microscope (ZEN 2009 software) equipped with 40 and 63 EC Plan-Neofluar oil-immersion objectives (Zeiss). For the confocal microscope, dscGFP and Alexa Fluor 594 were excited with the 488 nm and 561 nm lines of an argon or diode pumped solid state (DPSS) laser, respectively. All image processing was performed using ImageJ software. Composite images were assembled using the MosaicJ ImageJ plugin.

[0181] Statistics

[0182] Efficacy of treatment data (FIGS. 3D, 7C) were analysed using a generalized log-linear mixed model with random effect of animal (autoregressive covariance) and fixed effects of treatment group, week, and the interaction between treatment group and week. Seizure counts in the week preceding treatment (FIG. 7C) were compared using a Mann Whitney U test. Current densities at +20 mV (FIG. 5Bii) were compared using a Welch's one-way ANOVA followed by Games-Howell post-hoc tests.

[0183] Results

[0184] Injection of TeNT into the Visual Cortex Produces a Model of Focal Epilepsy with Discrete Seizures

[0185] Starting with a model developed in mice (Mainardi et al., 2012), we characterized the electrographic features, temporal evolution, and behavioural correlates of seizures evoked by injection of TeNT into the visual cortices of 9 adult male Sprague Dawley rats. In striking contrast to the brief, near-continuous epileptiform discharges seen following TeNT injection into the motor cortex (Wykes et al., 2012), injection into the visual cortex produced discrete spontaneous seizures (FIG. 1A). Seizures emerged approximately 4 days after the injection of TeNT, increased in frequency over 7-10 days, reached a plateau for 2-3 weeks, and resolved in most animals after 5 or 6 weeks (FIGS. 1B, C). The total number of seizures experienced by each animal was highly variable. Average seizure duration evolved over time, increasing from just under 50 s in the first week to approximately 100 s for the next four (FIG. 1D). Time-locked video-ECoG was employed to identify the behavioural correlates of a randomly selected subset of seizures (n=102; FIG. 1E). For 11 seizures (10.8%), associated behaviours were unobservable due to interrupted recordings or the animal remaining out of sight within its environmental enrichment material. All remaining seizures had observable behavioural correlates. For 45 seizures (44.1%) these were subtle, including repetitive eye blinking, sudden increases in agitation or aggressive searching behaviour. Unilateral motor involvement, e.g. twitching of the contralateral limb, was observed for 19 seizures (18.6%), with bilateral motor symptoms seen in a further 6 (5.9%). 21 seizures (20.6%) developed into full bilateral tonic-clonic seizures. This model of focal neocortical epilepsy was not strain-specific; similar seizures were evoked in both Lister Hooded and Long-Evans rats (FIG. 2).

[0186] A Pilot Study Shows KCNA1 Gene Therapy is Sufficient to Reduce Spontaneous Seizures

[0187] We asked whether the CMV-driven Kv1.1 vector (CMV-KCNA1) used earlier in a model of EPC (Wykes et al., 2012) remained effective against these longer and more complex seizures. Two weeks after the injection of TeNT, following the establishment of spontaneous seizures, animals were randomly divided into 2 groups and injected via pre-implanted cannula with either the CMV-KCNA1 lentivector or a control lentivector expressing only green fluorescent protein (GFP). ECoG recordings were continued for a further 4 weeks. As previously observed (Wykes et al., 2012), the CMV-KCNA1 lentivector transduced neurons within a narrow column of the cortex (FIG. 3A). Given the high variability in total seizure counts, to compare seizure frequency between the two treatment groups the numbers of seizures experienced each week were normalized to the number experienced by each animal in the week preceding treatment (baseline week (BI)). The CMV-KCNA1 lentivector significantly reduced normalized seizure frequency in the weeks following treatment (generalized log-linear mixed model on weeks 0-3, treatment*week interaction effect: F(1,60)=69.499, p<0.001; FIG. 3D). The therapeutic effect emerged rapidly; plots of cumulative daily seizure frequency for the two treatment groups begin to diverge within 3 days of lentivector injection (FIG. 3E). Kv1.1 overexpression did not influence seizure duration (data not shown).

[0188] Epilepsy is associated with a number of comorbidities. Among these are cognitive deficits which in temporal lobe epilepsies strongly correlate to inter-ictal discharges (Holmes G L 2013, Bragatti J A et al 2014, Dinkelacker V et al 2016). Similarly, in the neocortex inter-ictal activity is likely to cause significant disruption to normal brain function. In addition to its suppression of seizure frequency, Kv1.1 overexpression with the CMV-KCNA1 lentivector significantly reduced the frequency of inter-ictal discharges, another signature consistent with epileptogenesis (FIG. 4).

[0189] Because our model of focal neocortical epilepsy was not strain-specific (FIG. 2), this initial study included 16 animals from 3 different strains (Sprague Dawley, Lister Hooded and Long-Evans). To ensure that the positive effect of CMV-KCNA1 treatment was not biased by the minority of Lister Hooded and Long-Evans animals, seizure frequency data were reanalysed for the Sprague Dawley animals only. Despite the small sample size (6 treated vs. 5 controls), the CMV-KCNA1 lentivector still significantly reduced normalized seizure frequency in the weeks following treatment (generalized log-linear mixed model on weeks 0-3, treatment*week interaction effect: F(1,40)=4.851, p=0.033). This pilot study therefore strongly suggests that over-expression of KCNA1 is sufficient to reduce the number of discrete spontaneous seizures.

[0190] Design and Characterisation of a Gene Therapy Tool Optimized for Clinical Translation

[0191] To bring KCNA1 gene therapy closer to the clinic, we designed a new lentiviral transfer plasmid (FIG. 5Aii). The CMV promoter from the original CMV-KCNA1 construct (FIG. 5Ai) was replaced with a 1.3 kb human CAMK2A promoter (hCAMK2A) to bias expression to excitatory neurons (Dittgen et al., 2004; Yaguchi et al., 2013). The KCNA1 gene was codon-optimized for expression in human cells, and mutated to introduce an I400V amino acid change normally generated by RNA-editing. The I400V substitution elicits a 20-fold increase in the rate at which Kv1.1 channels recover from inactivation (Bhalla et al., 2004). For preclinical evaluation, a dscGFP reporter gene was linked to the engineered potassium channel (EKC) gene by a T2A peptide, which permits dual protein expression from a single promoter.

[0192] The salient components of our EKC lentiviral transfer plasmid (FIG. 5Aii) include: [0193] 1) A 1.3 kb human CAMK2A promoter (hCAMK2A) comprising 100 bp of the 5 untranslated region of CAMK2A coupled to 1.2 kb of upstream DNA. A murine Camk2a promoter of similar size has been shown to drive pyramidal neuron-specific gene expression in lentiviral-injected rat barrel cortex (Dittgen et al., 2004) and primate motor cortex (Yaguchi et al., 2013). This contrasts with the CMV promoter of our pilot vector, which is known to drive transgene expression preferentially within glia following lentiviral injection into the primate rhinal (Lerchner et al., 2014) or motor (Yaguchi et al., 2013) cortices. [0194] 2) An engineered potassium channel gene consisting of a codon-optimized KCNA1 with an adenine.sup.1998>guanine point mutation to modify channel inactivation properties. Codon optimization is useful beyond the benefit of increased Kv1.1 expression. It permits specific tracking of transgene expression with RNA-targeted techniques that would otherwise fail to distinguish between transgenic and endogenous KCNA1. Such tracking will prove particularly useful further along the translation pipeline with vectors that necessarily lack coding sequences for fluorescent reporter proteins. At negative membrane potentials, channels containing unedited I.sup.400 recover from inactivation at a rate around twenty times slower than their edited (V.sup.400) counterparts (Bhalla et al., 2004). Because Kv1.1 channels that recover faster from inactivation would be expected to dampen neuronal excitability, we decided to pre-empt the RNA edit in our codon-optimized KCNA1 by purposefully introducing the A.sup.1998G point mutation. [0195] 3) A superbright dscGFP reporter gene linked to EKC by a T2A peptide. 2A peptides are short (20 amino acids) sequences that permit multicistronic gene expression from single promoters by impairing peptide bond formation during ribosome-mediated translation (Szymczak and Vignali, 2005). Importantly, genes either side of a 2A peptide are expressed in a 1:1 ratio with translation taking place simultaneously. As such, reporter expression serves as a very reliable indicator of therapeutic transgene expression. This set-up contrasts with that of our pilot vector, where therapeutic and reporter transgenes were placed under the transcriptional control of separate and distinct promoters.

[0196] The EKC transfer plasmid used in these experiments has the sequence shown in SEQ ID NO: 7. The sequence of the dscGFP-only control transfer plasmid has the sequence shown in SEQ ID NO: 8.

[0197] To determine whether the optimized transfer plasmid could be decoded to produce functional Kv1.1 channels, Neuro-2a cells were transiently transfected with the EKC or dscGFP-only control transfer plasmids and subjected to whole-cell patch clamping. Cells exposed to the transfection mixture but lacking dscGFP fluorescence were used as a second set of controls. A typical voltage step protocol evoked negligible outward currents in both control groups, while Neuro-2a cells transfected with the EKC transfer plasmid displayed large voltage-dependent currents that peaked in amplitude at several nanoamps (FIG. 5Bi,ii). Current densities at the largest depolarising voltage step (+20 mV) were significantly larger in EKC-transfected cells than controls, which displayed only small endogenous voltage-dependent currents (FIG. 5Bii). There was no significant difference in current density between untransfected cells and cells transfected with the control plasmid (FIG. 5Bii). To determine if our molecular optimizations influenced the voltage dependence of Kv1.1 channel activation, normalised conductance-voltage plots were fit with individual Boltzmann functions for each EKC-transfected cell. A mean adjusted R.sup.2 of 0.9950.0007 demonstrated a good fit across all cells. The mean V.sub.0.5 of 28.20.4 mV was similar to values obtained from HEK293 cells transfected with CMV-driven, wild-type KCNA1 (32.80.9 mV) (Tomlinson et al., 2013). A plot of mean normalised conductance against voltage for all SKC-transfected cells, fit with its own Boltzmann function, is provided in FIG. 5Biii. Together these data indicate that the optimized EKC transfer plasmid supports the generation of robust Kv1.1 currents.

[0198] The EKC transfer plasmid was packaged into a non-integrating lentiviral vector (Yez-Muoz et al., 2006). When injected into the rat visual cortex, this lentivector drove strong, localised expression of the dscGFP reporter (FIG. 5C). Imaging of sequential brain slices produced an estimated transduction volume of 0.075 mm3 (FIG. 6).

[0199] Immunohistochemistry revealed no visible overlap between dscGFP expression and glial fibrillary acidic protein (GFAP) staining (0/512 dscGFP+ cells co-localized with GFAP, n=3 animals; FIG. 5Di). In contrast, all dscGFP+ cells co-localized with the neuronal marker NeuN (714/714, n=3 animals; FIG. 5Di). These data indicate that transgene expression from the EKC lentivector is restricted to neurons. There was minimal overlap between dscGFP expression and staining for glutamic acid decarboxylase 67 (GAD67), an enzymatic marker for GABAergic neurons (3/603 dscGFP+ cells co-localized with GAD67, n=3 animals; FIG. 3Diii). This suggests that EKC transgene expression is largely restricted to excitatory neurons.

[0200] EKC Gene Therapy Reduces Seizure Frequency in a Randomised, Blinded, Preclinical Trial

[0201] To test the efficacy of the EKC lentivector, we designed a randomised, blinded preclinical trial to mimic clinical trial conditions, and selected reduced seizure frequency as the primary outcome measure. A new batch of TeNT with slightly reduced potency produced fewer overall seizures and improved animal welfare. Eleven days after the injection of TeNT, 26 Sprague Dawley rats were randomly divided into 2 groups and injected via pre-implanted cannula with either the EKC lentivector or a dscGFP-only control vector. ECoG recordings were continued for a further 4 weeks. The timeline was altered from that of the pilot study to treat after 11 days in order to capture the period when seizure activity is at its highest (2-4 weeks following TeNT). To minimise the confounding influence of animals that failed to develop robust epilepsy, subjects were excluded if they experienced fewer than 5 seizures in the week preceding treatment. This criterion, applied prior to unblinding, led to the exclusion of 8 animals (6 EKC, 2 control). There was no significant difference between treatment groups in the number of seizures experienced in the week preceding virus injection (Mann Whitney U test, p=0.185). Analysis of the primary outcome measure indicated that EKC treatment produced a robust decrease in seizure frequency over time (generalized log-linear mixed model on weeks 0-3, treatment*week interaction effect: F(1,67)=29.704, p<0.001; FIG. 7C). As in the pilot study, the effect lasted for the duration of recording, and the absolute effect size only decreased as seizures abated in the control group. Again, the therapeutic effect emerged rapidly, with plots of cumulative daily seizure frequency for the two groups starting to diverge 2 days after treatment (FIG. 7D).

[0202] Discussion

[0203] EKC gene therapy represents an effective new treatment for focal neocortical seizures in a format adapted to improve safety and translation to the clinic.

[0204] We have previously shown that overexpression of Kv1.1 can reduce the frequency of epileptiform discharges in a motor cortex TeNT model of EPC (Wykes et al., 2012). However, it was unclear whether Kv1.1 overexpression would be sufficient to inhibit discrete long-lasting seizures. We show here, in two independent experiments, that Kv1.1 overexpression is indeed sufficient to reduce seizure frequency. The effect on seizure number is pronounced, but once initiated the seizures progress in a similar pattern with similar electrographic features in both treated and control animals.

[0205] Injection of TeNT into the occipital cortex induced seizures that lasted markedly longer (50-150 s) than those induced by TeNT injection in motor cortex (<1 s) (Wykes et al., 2012). The difference, which parallels that seen with occipital lobe seizures and EPC in human patients, may be a consequence of different connectivity in the occipital and motor cortices. Further studies will be needed to determine how cortical architecture impacts the type of epileptiform activity induced by TeNT insult.

[0206] Lentiviral gene therapy approaches are becoming more common in CNS disorders, and have shown good safety and tolerability even in extended trials (Palfi et al., 2014). In the case of epilepsy, an additional safety concern is the possibility of potassium channel overexpression in interneurons, which could aggravate seizure activity by exacerbating rather than attenuating local excitability. To mitigate this risk we have utilised a human CAMK2A promoter that in rats leads to very little expression in GABAergic cells. Our estimate of specificity may even be slightly conservative as a small proportion of excitatory pyramidal neurons in the rodent cortex stain positively for GABA as well as glutamate (Hill et al., 2000; Lavdas et al., 1996), and may therefore express GAD67 despite pyramidal morphology and physiology.

[0207] Because the role of potassium channels, including Kv1.1, in regulating neuronal excitability is conserved across a broad range of neurons, potassium channel overexpression may hold therapeutic promise in the treatment of other diseases characterised by neuronal hyperexcitability. There is currently an unmet clinical need for new treatments for chronic pain, and a variety of gene therapy approaches aimed at reducing the excitability of dorsal root ganglion neurons have already demonstrated preclinical efficacy (Snowball and Schorge, 2015). Other disorders such as Parkinson's disease may be associated with excessive activity in specific groups of neurons (Lobb, 2014), and could be candidates for treatment if suitable cell type specific promoters can be identified.

REFERENCES

[0208] Baum, C., von Kalle, C., Staal, F. J. T., Li, Z., Fehse, B., Schmidt, M., Weerkamp, F., Karlsson, S., Wagemaker, G., and Williams, D. A. (2004). Chance or necessity? Insertional mutagenesis in gene therapy and its consequences. Mol. Ther. J. Am. Soc. Gene Ther. 9, 5-13.

[0209] Bhalla, T., Rosenthal, J. J. C., Holmgren, M., and Reenan, R. (2004). Control of human potassium channel inactivation by editing of a small mRNA hairpin. Nat. Struct. Mol. Biol. 11, 950-956.

[0210] Biffi, A., Montini, E., Lorioli, L., Cesani, M., Fumagalli, F., Plati, T., Baldoli, C., Martino, S., Calabria, A., Canale, S., et al. (2013). Lentiviral Hematopoietic Stem Cell Gene Therapy Benefits Metachromatic Leukodystrophy. Science 341, 1233158.

[0211] Bovolenta, R., Zucchini, S., Paradiso, B., Rodi, D., Merigo, F., Navarro Mora, G., Osculati, F., Berto, E., Marconi, P., Marzola, A., et al. (2010). Hippocampal FGF-2 and BDNF overexpression attenuates epileptogenesis-associated neuroinflammation and reduces spontaneous recurrent seizures. J. Neuroinflammation 7, 81.

[0212] Burns, J. C., Friedmann, T., Driever, W., Burrascano, M., and Yee, J. K. (1993). Vesicular stomatitis virus G glycoprotein pseudotyped retroviral vectors: concentration to very high titer and efficient gene transfer into mammalian and nonmammalian cells. Proc. Natl. Acad. Sci. U.S.A. 90, 8033-8037.

[0213] Cartier, N., Hacein-Bey-Abina, S., Bartholomae, C. C., Veres, G., Schmidt, M., Kutschera, I., Vidaud, M., Abel, U., Dal-Cortivo, L., Caccavelli, L., et al. (2009). Hematopoietic stem cell gene therapy with a lentiviral vector in X-linked adrenoleukodystrophy. Science 326, 818-823.

[0214] D'Adamo M C, Catacuzzeno L, Di Giovanni G, Franciolini F, Pessia M. (2013). K(+) channelepsy: progress in the neurobiology of potassium channels and epilepsy. Front. Cell. Neurosci. 7, 134

[0215] Devinsky, O. (2011). Sudden, unexpected death in epilepsy. N. Engl. J. Med. 365, 1801-1811.

[0216] Dittgen, T., Nimmerjahn, A., Komai, S., Licznerski, P., Waters, J., Margrie, T. W., Helmchen, F., Denk, W., Brecht, M., and Osten, P. (2004). Lentivirus-based genetic manipulations of cortical neurons and their optical and electrophysiological monitoring in vivo. Proc. Natl. Acad. Sci. U.S.A. 101, 18206-18211.

[0217] Galanopoulou, A. S., Buckmaster, P. S., Staley, K. J., Mosh, S. L., Perucca, E., Engel, J., Jr, Lscher, W., Noebels, J. L., Pitknen, A., Stables, J., et al. (2012). Identification of new epilepsy treatments: issues in preclinical methodology. Epilepsia 53, 571-582.

[0218] Haberman, R. P., Samulski, R. J., and McCown, T. J. (2003). Attenuation of seizures and neuronal death by adeno-associated virus vector galanin expression and secretion. Nat Med 9, 1076-1080.

[0219] Hacein-Bey-Abina, S., Von Kalle, C., Schmidt, M., McCormack, M. P., Wulffraat, N., Leboulch, P., Lim, A., Osborne, C. S., Pawliuk, R., Morillon, E., et al. (2003). LMO2-associated clonal T cell proliferation in two patients after gene therapy for SCID-X1. Science 302, 415-419.

[0220] Heeroma, J. H., Henneberger, C., Rajakulendran, S., Hanna, M. G., Schorge, S., and Kullmann, D. M. (2009). Episodic ataxia type 1 mutations differentially affect neuronal excitability and transmitter release. Dis. Model. Mech. 2, 612-619.

[0221] Hill, E., Kalloniatis, M., and Tan, S. S. (2000). Glutamate, GABA and precursor amino acids in adult mouse neocortex: cellular diversity revealed by quantitative immunocytochemistry. Cereb. Cortex N. Y. N 1991 10, 1132-1142.

[0222] Hoppe, C., and Elger, C. E. (2011). Depression in epilepsy: a critical review from a clinical perspective. Nat. Rev. Neurol. 7, 462-472.

[0223] Kanter-Schlifke, I., Georgievska, B., Kirik, D., and Kokaia, M. (2007). Seizure suppression by GDNF gene therapy in animal models of epilepsy. Mol. Ther. J. Am. Soc. Gene Ther. 15, 1106-1113.

[0224] Kantor, B., McCown, T., Leone, P., and Gray, S. J. (2014). Chapter TwoClinical Applications Involving CNS Gene Transfer. In Advances in Genetics, J.C.D. and S.F.G. Theodore Friedmann, ed. (Academic Press), pp. 71-124.

[0225] Ktzel, D., Nicholson, E., Schorge, S., Walker, M. C., and Kullmann, D. M. (2014). Chemical-genetic attenuation of focal neocortical seizures. Nat. Commun. 5, 3847.

[0226] Kullmann, D. M., Schorge, S., Walker, M. C., and Wykes, R. C. (2014). Gene therapy in epilepsy-is it time for clinical trials? Nat. Rev. Neurol. 10, 300-304.

[0227] Kwan, P., Schachter, S. C., and Brodie, M. J. (2011). Drug-resistant epilepsy. N. Engl. J. Med. 365, 919-926.

[0228] Lavdas, A. A., Mione, M. C., and Parnavelas, J. G. (1996). Neuronal clones in the cerebral cortex show morphological and neurotransmitter heterogeneity during development. Cereb. Cortex N. Y. N 1991 6, 490-497.

[0229] Leavitt, A. D., Robles, G., Alesandro, N., and Varmus, H. E. (1996). Human immunodeficiency virus type 1 integrase mutants retain in vitro integrase activity yet fail to integrate viral DNA efficiently during infection. J. Virol. 70, 721-728.

[0230] Lerchner, W., Corgiat, B., Der Minassian, V., Saunders, R. C., and Richmond, B. J. (2014). Injection parameters and virus dependent choice of promoters to improve neuron targeting in the nonhuman primate brain. Gene Ther.

[0231] Lin, E.-J. D., Young, D., Baer, K., Herzog, H., and During, M. J. (2006). Differential actions of NPY on seizure modulation via Y1 and Y2 receptors: evidence from receptor knockout mice. Epilepsia 47, 773-780.

[0232] Lobb, C. (2014). Abnormal Bursting as a Pathophysiological Mechanism in Parkinson's Disease. Basal Ganglia 3,187-195.

[0233] Lundberg, C., Bjrklund, T., Carlsson, T., Jakobsson, J., Hantraye, P., Dglon, N., and Kirik, D. (2008). Applications of lentiviral vectors for biology and gene therapy of neurological disorders. Curr. Gene Ther. 8, 461-473.

[0234] Mainardi, M., Pietrasanta, M., Vannini, E., Rossetto, O., and Caleo, M. (2012). Tetanus neurotoxin-induced epilepsy in mouse visual cortex. Epilepsia 53, e132-136.

[0235] McCown, T. J. (2006). Adeno-associated Virus-Mediated Expression and Constitutive Secretion of Galanin Suppresses Limbic Seizure Activity in Vivo. Mol Ther 14, 63-68.

[0236] Ngugi, A. K., Bottomley, C., Kleinschmidt, I., Sander, J. W., and Newton, C. R. (2010). Estimation of the burden of active and life-time epilepsy: a meta-analytic approach. Epilepsia 51, 883-890.

[0237] Nikitidou, L., Torp, M., Fjord-Larsen, L., Kusk, P., Wahlberg, L. U., and Kokaia, M. (2014). Encapsulated galanin-producing cells attenuate focal epileptic seizures in the hippocampus. Epilepsia 55,167-174.

[0238] Noe', F. M., Srensen, A. T., Kokaia, M., and Vezzani, A. (2012). Gene therapy of focal onset epilepsy using adeno-associated virus vector-mediated overexpression of neuropeptide Y. In Jasper's Basic Mechanisms of the Epilepsies, J. L. Noebels, M. Avoli, M. A. Rogawski, R. W. Olsen, and A. V. Delgado-Escueta, eds. (Bethesda (Md.): National Center for Biotechnology Information (US)), p.

[0239] Palfi, S., Gurruchaga, J. M., Ralph, G. S., Lepetit, H., Lavisse, S., Buttery, P. C., Watts, C., Miskin, J., Kelleher, M., Deeley, S., et al. (2014). Long-term safety and tolerability of ProSavin, a lentiviral vector-based gene therapy for Parkinson's disease: a dose escalation, open-label, phase 1/2 trial. Lancet Lond. Engl. 383, 1138-1146.

[0240] Picot, M.-C., Baldy-Moulinier, M., Daurs, J.-P., Dujols, P., and Crespel, A. (2008). The prevalence of epilepsy and pharmacoresistant epilepsy in adults: a population-based study in a Western European country. Epilepsia 49, 1230-1238.

[0241] Rahim, A. A., Wong, A. M. S., Howe, S. J., Buckley, S. M. K., Acosta-Saltos, A. D., Elston, K. E., Ward, N. J., Philpott, N. J., Cooper, J. D., Anderson, P. N., et al. (2009). Efficient gene delivery to the adult and fetal CNS using pseudotyped non-integrating lentiviral vectors. Gene Ther. 16, 509-520.

[0242] Richichi, C., Lin, E.-J. D., Stefanin, D., Colella, D., Ravizza, T., Grignaschi, G., Veglianese, P., Sperk, G., During, M. J., and Vezzani, A. (2004). Anticonvulsant and antiepileptogenic effects mediated by adeno-associated virus vector neuropeptide Y expression in the rat hippocampus. J. Neurosci. Off. J. Soc. Neurosci. 24, 3051-3059.

[0243] Schuele, S. U., and Lders, H. O. (2008). Intractable epilepsy: management and therapeutic alternatives. Lancet Neurol. 7, 514-524.

[0244] Snowball, A., and Schorge, S. (2015). Changing channels in pain and epilepsy: Exploiting ion channel gene therapy for disorders of neuronal hyperexcitability. FEBS Lett. 589, 1620-1634.

[0245] Streit A K, Derst C, Wegner S, Heinemann U, Zahn R K, Decher N. (2011) RNA editing of Kv1.1 channels may account for reduced ictogenic potential of 4-aminopyridine in chronic epileptic rats. Epilepsia. 52, 645-8

[0246] Streit A K, Matschke L A, Dolga A M, Rinn S, Decher N. (2014). RNA editing in the central cavity as a mechanism to regulate surface expression of the voltage-gated potassium channel. J Biol Chem. 289, 26762-71

[0247] Szymczak, A. L., and Vignali, D. A. A. (2005). Development of 2A peptide-based strategies in the design of multicistronic vectors. Expert Opin. Biol. Ther. 5, 627-638.

[0248] Tomlinson, S. E., Rajakulendran, S., Tan, S. V., Graves, T. D., Bamiou, D. E., Labrum, R. W., Burke, D., Sue, C. M., Giunti, P., Schorge, S., et al. (2013). Clinical, genetic, neurophysiological and functional study of new mutations in episodic ataxia type 1. J Neurol Neurosurg Psychiatry.

[0249] Woldbye, D. P. D., Angehagen, M., Gotzsche, C. R., Elbrnd-Bek, H., Srensen, A. T., Christiansen, S. H., Olesen, M. V., Nikitidou, L., Hansen, T. V. O., Kanter-Schlifke, I., et al. (2010). Adeno-associated viral vector-induced overexpression of neuropeptide Y Y2 receptors in the hippocampus suppresses seizures. Brain J. Neurol. 133, 2778-2788.

[0250] Wykes, R. C., Heeroma, J. H., Kullmann, D. M., Walker, M. C., and Schorge, S. (2011) Lentiviral-mediated over-expression of the potassium channel Kv1.1 as a treatment for focal neocortical epilepsy. Poster No. 248.20/S6. 2011 Neuroscience Meeting Planner. Washington, D.C.: Society for Neuroscience, 2011. Online.

[0251] Wykes, R. C., Heeroma, J. H., Mantoan, L., Zheng, K., MacDonald, D. C., Deisseroth, K., Hashemi, K. S., Walker, M. C., Schorge, S., and Kullmann, D. M. (2012). Optogenetic and potassium channel gene therapy in a rodent model of focal neocortical epilepsy. Sci. Transl. Med. 4, 161ra152.

[0252] Wykes, R. C. and Lignani. G (2018). Gene therapy and editing: Novel potential treatments for neuronal channelopathies. Neuropharmacology. 132, 108-117

[0253] Yaguchi, M., Ohashi, Y., Tsubota, T., Sato, A., Koyano, K. W., Wang, N., and Miyashita, Y. (2013). Characterization of the properties of seven promoters in the motor cortex of rats and monkeys after lentiviral vector-mediated gene transfer. Hum. Gene Ther. Methods 24, 333-344.

[0254] Yez-Muoz, R. J., Balaggan, K. S., MacNeil, A., Howe, S. J., Schmidt, M., Smith, A. J., Buch, P., MacLaren, R. E., Anderson, P. N., Barker, S. E., et al. (2006). Effective gene therapy with nonintegrating lentiviral vectors. Nat. Med. 12, 348-353.

TABLE-US-00001 SequenceAnnex NucleotidesequenceofanexemplaryengineeredhumanKCNA1gene (SEQIDNO:1) ATGACCGTGATGAGCGGCGAGAACGTGGACGAGGCCTCTGCCGCTCCTGGACACCCTCAGGATGGC AGCTATCCCAGACAGGCCGACCACGACGATCACGAGTGCTGCGAGCGGGTCGTGATCAACATCAGC GGCCTGAGATTCGAGACACAGCTGAAAACCCTGGCCCAGTTCCCCAACACCCTGCTGGGCAACCCC AAGAAACGGATGCGGTACTTCGACCCCCTGCGGAACGAGTACTTCTTCGACCGGAACCGGCCCAGC TTCGACGCCATCCTGTACTACTACCAGAGCGGCGGCAGACTGCGGAGGCCCGTGAATGTGCCCCTG GACATGTTCAGCGAGGAAATCAAGTTCTACGAGCTGGGCGAGGAAGCCATGGAAAAGTTCAGAGAG GACGAGGGCTTCATCAAAGAGGAAGAGAGGCCCCTGCCCGAGAAAGAATACCAGAGACAAGTGTGG CTGCTGTTCGAGTACCCCGAGTCTAGCGGCCCTGCCAGAGTGATCGCCATCGTGTCCGTGATGGTC ATCCTGATCTCTATCGTGATCTTCTGCCTGGAAACCCTGCCTGAGCTGAAGGACGACAAGGACTTC ACCGGCACCGTGCACCGGATCGACAACACCACCGTGATCTACAACAGCAATATCTTCACCGACCCA TTCTTCATCGTGGAAACACTGTGCATCATCTGGTTCAGCTTCGAGCTGGTCGTGCGGTTCTTCGCC TGCCCCAGCAAGACCGACTTCTTCAAGAACATCATGAACTTCATTGATATCGTGGCCATCATCCCC TACTTCATCACCCTGGGCACCGAGATCGCCGAGCAGGAAGGCAATCAGAAGGGCGAGCAGGCCACC AGCCTGGCCATTCTGAGAGTGATCAGACTCGTGCGGGTGTTCCGGATCTTCAAGCTGAGCCGGCAC AGCAAGGGCCTGCAGATCCTGGGCCAGACACTGAAGGCCAGCATGAGAGAGCTGGGCCTGCTGATC TTCTTTCTGTTCATCGGCGTGATCCTGTTCAGCAGCGCCGTGTACTTCGCCGAGGCCGAAGAAGCC GAGAGCCACTTCAGCTCTATCCCCGACGCCTTTTGGTGGGCCGTGGTGTCCATGACCACAGTGGGC TACGGCGACATGTAnCCCGTGACAATCGGCGGCAAGATCGTGGGCAGCCTGTGTGCCATTGCCGGC GTGCTGACAGTCGCCCTGCCTGTGCCTGTGATCGTGTCCAACTTCAACTACTTCTACCACCGGGAA ACCGAGGGGGAGGAACAGGCTCAGCTGCTGCACGTGTCCAGCCCCAATCTGGCCAGCGACAGCGAC CTGAGCAGACGGTCTAGCAGCACCATGAGCAAGAGCGAGTACATGGAAATCGAAGAGGACATGAAC AACTCTATCGCCCACTACCGCCAAGTGAACATCCGGACCGCCAACTGCACCACCGCCAACCAGAAC TGCGTGAACAAGAGCAAGCTGCTGACCGATGTCTGA whereinnisTorC AminoacidsequenceofaneditedhumanKv1.1comprisingavalineat position400(underlined)(SEQIDNO:2) MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNP KKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFRE DEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDF TGTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIP YFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAG VLTVALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMN NSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV NucleotidesequenceofanexemplaryhumanCAMK2Apromoter(SEQID NO:3) TAAATAAATAAATAAATAATATAAATAATAAATGTCCAGGAATCAGAGCTCAAACTCAGATCCTTA GTCTTAAACTCCAGTCCCTTTTCTTCCTAACTCCAAGACCTTGGAGTAAGATCTTGTGGCTGTAGG TATGGCTGATGCCCTGAAGAGTTGAAGTTGGCAGGGAAGGTGCCCAGAAAATTTTGGATTGAAGAT TTCATGGCAAGTCTCTGGCCAGTGGCCTAGCCCGGGTAAGCCATGCTATGCTCACCTCCCCACAGC CCCCTCTCGCCTTTTTTTTTTTTTTTTTTTACCTTGACTGGAAGCACAAGCAGAAACTGGGACATG AGCACCAGGAGACCAGATTTCCATGGTCCCGTTGGGGGCATGGGGTTGGGGAGAGGTTGCAGAGGA GGGCTCTGGAGGGGAGCAACTGTCACAGCTGTGAGAGGTGGGGGTGAGCAGGCAGTCAGGGCTGTT CCCTCCAGAATCCTGGGGTGTCCTCTGCACTTCTGCGCCAAGCTGGAGTGCTAGTGTGATGGACAA GGTGGTAAGAGAGCTGAAAGAGCACGAGCATAACAAGAAAGACAGAGGCAGAAGCAAAAAAAAAAA AAAAAAAAAACAGAGGGCAACAGAGAGACAGTTACAGAGACTACAGTGATCCACAGAGGGAGAGCC ATCCCTGTGAATTAGCCATCATTTCCCTGTAAACCTTAGAACCCAGCTGTTGCCAGGGCAACGGGG CAATACCTGTCTCTCTAGAGATGAAGTTGCCAGGGTAACTGCATCCTGTCATTCGTTCCTGGGGAC CATCCGGAATGCGGCACCCACTGGCTGTTACCATGGCAACTGCCTTTTTGCCCCACTTAATCCCAT CCCGTCTGCTACAAGGGCCCCACAGTTGGAGGTGGGGGAGGTGGGAAGAGAAAAGATCACTTGTGG ACAAAGTTTGCTCTATTCCACCTCCTCCAGGCCCTCCTTGGGTCCATCACCCCAGGGGTGCTGGGT CCATCCCACCCCCAGGCCCACACAGGCTTGCAGTATTGTGTGCGGTATGGTCAGGGCGTCCGAGAG CAGGTTTCGCAGTGGAAGGCAGGCAGGTGTTGGGGAGGCAGTTACCGGGGCAACGGGAACAGGGCG TTTTGGAGGTGGTTGCCATGGGGACCTGGATGCTGACGAAGGCTCGCGAGGCTGTGAGCAGCCACA GTGCCCTGCTCAGAAGCCCCGGGCTCGTCAGTCAAACCGGTTCTCTGTTTGCACTCGGCAGCACGG GCAGGCAAGTGGTCCCTAGGTTCGGGAGCAGAGCAGCAGCGCC Nucleotidesequenceofwild-typeKCNA1codingsequence,comprisingan adenineatnucleotideposition1998(underlined)(SEQIDNO:4) ATGACGGTGATGTCTGGGGAGAACGTGGACGAGGCTTCGGCCGCCCCGGGCCACCCCCAGGATGGC AGCTACCCCCGGCAGGCCGACCACGACGACCACGAGTGCTGCGAGCGCGTGGTGATCAACATCTCC GGGCTGCGCTTCGAGACGCAGCTCAAGACCCTGGCGCAGTTCCCCAACACGCTGCTGGGCAACCCT AAGAAACGCATGCGCTACTTCGACCCCCTGAGGAACGAGTACTTCTTCGACCGCAACCGGCCCAGC TTCGACGCCATCCTCTACTACTACCAGTCCGGCGGCCGCCTGCGGAGGCCGGTCAACGTGCCCCTG GACATGTTCTCCGAGGAGATCAAGTTTTACGAGTTGGGCGAGGAGGCCATGGAGAAGTTCCGGGAG GACGAGGGCTTCATCAAGGAGGAGGAGCGCCCTCTGCCCGAGAAGGAGTACCAGCGCCAGGTGTGG CTGCTCTTCGAGTACCCCGAGAGCTCGGGGCCCGCCAGGGTCATCGCCATCGTCTCCGTCATGGTC ATCCTCATCTCCATCGTCATCTTTTGCCTGGAGACGCTCCCCGAGCTGAAGGATGACAAGGACTTC ACGGGCACCGTCCACCGCATCGACAACACCACGGTCATCTACAATTCCAACATCTTCACAGACCCC TTCTTCATCGTGGAAACGCTGTGTATCATCTGGTTCTCCTTCGAGCTGGTGGTGCGCTTCTTCGCC TGCCCCAGCAAGACGGACTTCTTCAAAAACATCATGAACTTCATAGACATTGTGGCCATCATTCCT TATTTCATCACGCTGGGCACCGAGATAGCTGAGCAGGAAGGAAACCAGAAGGGCGAGCAGGCCACC TCCCTGGCCATCCTCAGGGTCATCCGCTTGGTAAGGGTTTTTAGAATCTTCAAGCTCTCCCGCCAC TCTAAGGGCCTCCAGATCCTGGGCCAGACCCTCAAAGCTAGTATGAGAGAGCTAGGGCTGCTCATC TTTTTCCTCTTCATCGGGGTCATCCTGTTTTCTAGTGCAGTGTACTTTGCCGAGGCGGAAGAAGCT GAGTCGCACTTCTCCAGTATCCCCGATGCTTTCTGGTGGGCGGTGGTGTCCATGACCACTGTAGGA TACGGTGACATGTACCCTGTGACAATTGGAGGCAAGATCGTGGGCTCCTTGTGTGCCATCGCTGGT GTGCTAACAATTGCCCTGCCCGTACCTGTCATTGTGTCCAATTTCAACTATTTCTACCACCGAGAA ACTGAGGGGGAAGAGCAGGCTCAGTTGCTCCACGTCAGTTCCCCTAACTTAGCCTCTGACAGTGAC CTCAGTCGCCGCAGTTCCTCTACTATGAGCAAGTCTGAGTACATGGAGATCGAAGAGGATATGAAT AATAGCATAGCCCATTATAGACAGGTCAATATCAGAACTGCCAATTGCACCACTGCTAACCAAAAC TGCGTTAATAAGAGCAAGCTACTGACCGATGTTTAA Aminoacidsequenceofwild-typehumanKv1.1,comprisingaisoleucine atposition400(underlined)(SEQIDNO:5) MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNP KKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFRE DEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDF TGTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIP YFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAG VLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMN NSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV NucleotidesequenceofanexemplaryengineeredKCNA1geneviralvector lackingareporter(withoutbacterialplasmidportion)(SEQIDNO:9) GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATA TGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCC CATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAAT GGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGC CCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGG ACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGC AGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACG TCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCC CATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCGTTTAGTGA ACCGGGGTCTCTCTGGTTAGACCAGATCTGAGCCTGGGAGCTCTCTGGCTAACTAGGGAACCCACT GCTTAAGCCTCAATAAAGCTTGCCTTGAGTGCTTCAAGTAGTGTGTGCCCGTCTGTTGTGTGACTC TGGTAACTAGAGATCCCTCAGACCCTTTTAGTCAGTGTGGAAAATCTCTAGCAGTGGCGCCCGAAC AGGGACTTGAAAGCGAAAGGGAAACCAGAGGAGCTCTCTCGACGCAGGACTCGGCTTGCTGAAGCG CGCACGGCAAGAGGCGAGGGGCGGCGACTGGTGAGTACGCCAAAAATTTTGACTAGCGGAGGCTAG AAGGAGAGAGATGGGTGCGAGAGCGTCAGTATTAAGCGGGGGAGAATTAGATCGCGATGGGAAAAA ATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAATTAAAACATATAGTATGGGCAAGCAGGGAG CTAGAACGATTCGCAGTTAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATACTGGGA CAGCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAGATCATTATATAATACAGTAGCAACC CTCTATTGTGTGCATCAAAGGATAGAGATAAAAGACACCAAGGAAGCTTTAGACAAGATAGAGGAA GAGCAAAACAAAAGTAAGACCACCGCACAGCAAGCGGCCGCTGATCTTCAGACCTGGAGGAGGAGA TATGAGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAAAATTGAACCATTAGGAGT AGCACCCACCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGCAGTGGGAATAGGAGCTTT GTTCCTTGGGTTCTTGGGAGCAGCAGGAAGCACTATGGGCGCAGCGTCAATGACGCTGACGGTACA GGCCAGACAATTATTGTCTGGTATAGTGCAGCAGCAGAACAATTTGCTGAGGGCTATTGAGGCGCA ACAGCATCTGTTGCAACTCACAGTCTGGGGCATCAAGCAGCTCCAGGCAAGAATCCTGGCTGTGGA AAGATACCTAAAGGATCAACAGCTCCTGGGGATTTGGGGTTGCTCTGGAAAACTCATTTGCACCAC TGCTGTGCCTTGGAATGCTAGTTGGAGTAATAAATCTCTGGAACAGATTTGGAATCACACGACCTG GATGGAGTGGGACAGAGAAATTAACAATTACACAAGCTTAATACACTCCTTAATTGAAGAATCGCA AAACCAGCAAGAAAAGAATGAACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTG GTTTAACATAACAAATTGGCTGTGGTATATAAAATTATTCATAATGATAGTAGGAGGCTTGGTAGG TTTAAGAATAGTTTTTGCTGTACTTTCTATAGTGAATAGAGTTAGGCAGGGATATTCACCATTATC GTTTCAGACCCACCTCCCAACCCCGAGGGGACCCGACAGGCCCGAAGGAATAGAAGAAGAAGGTGG AGAGAGAGACAGAGACAGATCCATTCGATTAGTGAACGGATCTCGACGGTATCGGTTAACTTTTAA AAGAAAAGGGGGGATTGGGGGGTACAGTGCAGGGGAAAGAATAGTAGACATAATAGCAACAGACAT ACAAACTAAAGAATTACAAAAACAAATTACAAAATTCAAAATTTTATCGAATTCCACGGGGTTAAT CGAATAAATAAATAAATAAATAATATAAATAATAAATGTCCAGGAATCAGAGCTCAAACTCAGATC CTTAGTCTTAAACTCCAGTCCCTTTTCTTCCTAACTCCAAGACCTTGGAGTAAGATCTTGTGGCTG TAGGTATGGCTGATGCCCTGAAGAGTTGAAGTTGGCAGGGAAGGTGCCCAGAAAATTTTGGATTGA AGATTTCATGGCAAGTCTCTGGCCAGTGGCCTAGCCCGGGTAAGCCATGCTATGCTCACCTCCCCA CAGCCCCCTCTCGCCTTTTTTTTTTTTTTTTTTTACCTTGACTGGAAGCACAAGCAGAAACTGGGA CATGAGCACCAGGAGACCAGATTTCCATGGTCCCGTTGGGGGCATGGGGTTGGGGAGAGGTTGCAG AGGAGGGCTCTGGAGGGGAGCAACTGTCACAGCTGTGAGAGGTGGGGGTGAGCAGGCAGTCAGGGC TGTTCCCTCCAGAATCCTGGGGTGTCCTCTGCACTTCTGCGCCAAGCTGGAGTGCTAGTGTGATGG ACAAGGTGGTAAGAGAGCTGAAAGAGCACGAGCATAACAAGAAAGACAGAGGCAGAAGCAAAAAAA AAAAAAAAAAAAAACAGAGGGCAACAGAGAGACAGTTACAGAGACTACAGTGATCCACAGAGGGAG AGCCATCCCTGTGAATTAGCCATCATTTCCCTGTAAACCTTAGAACCCAGCTGTTGCCAGGGCAAC GGGGCAATACCTGTCTCTCTAGAGATGAAGTTGCCAGGGTAACTGCATCCTGTCATTCGTTCCTGG GGACCATCCGGAATGCGGCACCCACTGGCTGTTACCATGGCAACTGCCTTTTTGCCCCACTTAATC CCATCCCGTCTGCTACAAGGGCCCCACAGTTGGAGGTGGGGGAGGTGGGAAGAGAAAAGATCACTT GTGGACAAAGTTTGCTCTATTCCACCTCCTCCAGGCCCTCCTTGGGTCCATCACCCCAGGGGTGCT GGGTCCATCCCACCCCCAGGCCCACACAGGCTTGCAGTATTGTGTGCGGTATGGTCAGGGCGTCCG AGAGCAGGTTTCGCAGTGGAAGGCAGGCAGGTGTTGGGGAGGCAGTTACCGGGGCAACGGGAACAG GGCGTTTTGGAGGTGGTTGCCATGGGGACCTGGATGCTGACGAAGGCTCGCGAGGCTGTGAGCAGC CACAGTGCCCTGCTCAGAAGCCCCGGGCTCGTCAGTCAAACCGGTTCTCTGTTTGCACTCGGCAGC ACGGGCAGGCAAGTGGTCCCTAGGTTCGGGAGCAGAGCAGCAGCGCCGGATCCGCCACCATGACCG TGATGAGCGGCGAGAACGTGGACGAGGCCTCTGCCGCTCCTGGACACCCTCAGGATGGCAGCTATC CCAGACAGGCCGACCACGACGATCACGAGTGCTGCGAGCGGGTCGTGATCAACATCAGCGGCCTGA GATTCGAGACACAGCTGAAAACCCTGGCCCAGTTCCCCAACACCCTGCTGGGCAACCCCAAGAAAC GGATGCGGTACTTCGACCCCCTGCGGAACGAGTACTTCTTCGACCGGAACCGGCCCAGCTTCGACG CCATCCTGTACTACTACCAGAGCGGCGGCAGACTGCGGAGGCCCGTGAATGTGCCCCTGGACATGT TCAGCGAGGAAATCAAGTTCTACGAGCTGGGCGAGGAAGCCATGGAAAAGTTCAGAGAGGACGAGG GCTTCATCAAAGAGGAAGAGAGGCCCCTGCCCGAGAAAGAATACCAGAGACAAGTGTGGCTGCTGT TCGAGTACCCCGAGTCTAGCGGCCCTGCCAGAGTGATCGCCATCGTGTCCGTGATGGTCATCCTGA TCTCTATCGTGATCTTCTGCCTGGAAACCCTGCCTGAGCTGAAGGACGACAAGGACTTCACCGGCA CCGTGCACCGGATCGACAACACCACCGTGATCTACAACAGCAATATCTTCACCGACCCATTCTTCA TCGTGGAAACACTGTGCATCATCTGGTTCAGCTTCGAGCTGGTCGTGCGGTTCTTCGCCTGCCCCA GCAAGACCGACTTCTTCAAGAACATCATGAACTTCATTGATATCGTGGCCATCATCCCCTACTTCA TCACCCTGGGCACCGAGATCGCCGAGCAGGAAGGCAATCAGAAGGGCGAGCAGGCCACCAGCCTGG CCATTCTGAGAGTGATCAGACTCGTGCGGGTGTTCCGGATCTTCAAGCTGAGCCGGCACAGCAAGG GCCTGCAGATCCTGGGCCAGACACTGAAGGCCAGCATGAGAGAGCTGGGCCTGCTGATCTTCTTTC TGTTCATCGGCGTGATCCTGTTCAGCAGCGCCGTGTACTTCGCCGAGGCCGAAGAAGCCGAGAGCC ACTTCAGCTCTATCCCCGACGCCTTTTGGTGGGCCGTGGTGTCCATGACCACAGTGGGCTACGGCG ACATGTAnCCCGTGACAATCGGCGGCAAGATCGTGGGCAGCCTGTGTGCCATTGCCGGCGTGCTGA CAGTCGCCCTGCCTGTGCCTGTGATCGTGTCCAACTTCAACTACTTCTACCACCGGGAAACCGAGG GGGAGGAACAGGCTCAGCTGCTGCACGTGTCCAGCCCCAATCTGGCCAGCGACAGCGACCTGAGCA GACGGTCTAGCAGCACCATGAGCAAGAGCGAGTACATGGAAATCGAAGAGGACATGAACAACTCTA TCGCCCACTACCGCCAAGTGAACATCCGGACCGCCAACTGCACCACCGCCAACCAGAACTGCGTGA ACAAGAGCAAGCTGCTGACCGATGTCTGAGTCGACAATCAACCTCTGGATTACAAAATTTGTGAAA GATTGACTGGTATTCTTAACTATGTTGCTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTT TGTATCATGCTATTGCTTCCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAATCCTGGTTGCTGT CTCTTTATGAGGAGTTGTGGCCCGTTGTCAGGCAACGTGGCGTGGTGTGCACTGTGTTTGCTGACG CAACCCCCACTGGTTGGGGCATTGCCACCACCTGTCAGCTCCTTTCCGGGACTTTCGCTTTCCCCC TCCCTATTGCCACGGCGGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCTCGGCTGT TGGGCACTGACAATTCCGTGGTGTTGTCGGGGAAATCATCGTCCTTTCCTTGGCTGCTCGCCTGTG TTGCCACCTGGATTCTGCGCGGGACGTCCTTCTGCTACGTCCCTTCGGCCCTCAATCCAGCGGACC TTCCTTCCCGCGGCCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTCGCCTTCGCCCTCAGACGA GTCGGATCTCCCTTTGGGCCGCCTCCCCGCCTGGAATTCGAGCTCGGTACCTTTAAGACCAATGAC TTACAAGGCAGCTGTAGATCTTAGCCACTTTTTAAAAGAAAAGGGGGGACTGGAAGGGCTAATTCA CTCCCAACGAAGACAAGATCTGCTTTTTGCTTGTACTGGGTCTCTCTGGTTAGACCAGATCTGAGC CTGGGAGCTCTCTGGCTAACTAGGGAACCCACTGCTTAAGCCTCAATAAAGCTTGCCTTGAGTGCT TCAAGTAGTGTGTGCCCGTCTGTTGTGTGACTCTGGTAACTAGAGATCCCTCAGACCCTTTTAGTC AGTGTGGAAAATCTCTAGCA whereinnisTorC AminoacidsequenceofaneditedhumanKv1.1comprisingavalineat position400(underlined)andavalineatposition379substitution (bolded)(SEQIDNO:14) MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNP KKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFRE DEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDF TGTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIP YFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAG VLTVALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMN NSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV