IMMUNOTOXINS, FORMULATIONS THEREOF AND THEIR USE IN MEDICINE

20200407443 ยท 2020-12-31

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides a composition comprising a first antibody molecule that specifically recognizes CD3 and a second antibody molecule that specifically recognizes CD7, for use in a method of treatment, or preventative treatment of viral infection or viral reactivation in a mammalian subject undergoing immunomodulatory treatment, wherein the first and second antibody molecules are each provided with a toxic moiety. Also provided is a method of treating a mammalian subject having, or being at risk of developing, chronic Graft versus Host disease (cGVHD). Also provided is a related pharmaceutical composition.

    Claims

    1-71. (canceled)

    72. A pharmaceutical composition comprising: (i) a first monoclonal antibody that recognizes CD3 having a heavy chain variable region comprising a complementarity determining region 1 (CDRH1) comprising the amino acid sequence of SEQ ID NO: 5; a complementarity determining region 2 (CDRH2) comprising the amino acid sequence of SEQ ID NO: 6; and a complementarity determining region 3 (CDRH3) comprising the amino acid sequence of SEQ ID NO: 7; and a light chain variable region comprising a complementarity determining region 1 (CDRL1) comprising the amino acid sequence of SEQ ID NO: 8; a complementarity determining region 2 (CDRL2) comprising the amino acid sequence of SEQ ID NO: 9, and a complementarity determining region 3 (CDRL3) comprising the amino acid sequence of SEQ ID NO: 10, wherein the first antibody is conjugated to at least one ricin toxin A (RTA), and a second monoclonal antibody that recognizes CD7 having a heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO: 15; a CDRH2 comprising the amino acid sequence of SEQ ID NO: 16; and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 17; and a light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO: 18; a CDRL2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 20, wherein the second antibody is conjugated to at least one ricin toxin A (RTA); (ii) 5 to 20 mM of a citrate buffer; (iii) 50 to 300 mM of L-arginine or a pharmaceutically acceptable salt thereof; (iv) 0.01 to 0.1% (w/v) of a polysorbate; and (v) 120 to 160 mM maltose, wherein the composition is in water and has a pH in the range 6 to 7.5.

    73. The composition of claim 72, wherein: the first monoclonal antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and a light chain comprising the amino acid sequence of SEQ ID NO: 2, wherein the first antibody is conjugated to at least one ricin toxin A (RTA), and the second monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 11 and a light chain comprising the amino acid sequence of SEQ ID NO: 12, wherein the second antibody is conjugated to at least one ricin toxin A (RTA).

    74. The composition of claim 72, further comprising at least one agent selected from: 100 to 150 mM trehalose; 25 to 75 mM glycine; and 80 to 120 mM mannitol.

    75. The composition of claim 72, wherein the maltose is 130 to 150 mM maltose monohydrate.

    76. The composition of claim 72, comprising 0.05 to 0.5 mg/mL of the first monoclonal antibody and 0.05 to 0.5 mg/mL of the second monoclonal antibody.

    77. The composition of claim 72, comprising 0.2 mg/mL of the first monoclonal antibody and 0.2 mg/mL of the second monoclonal antibody.

    78. The composition of claim 72, comprising 10 mM sodium citrate/citric acid buffer.

    79. The composition of claim 72, comprising 125 mM of L-arginine HCl.

    80. The composition of claim 72, comprising 0.05% (w/v) Tween 20.

    81. The composition of claim 72, comprising 140 mM maltose monohydrate.

    82. The composition of claim 72, wherein the composition is in water for injection and has a pH of 6.5.

    83. The composition of claim 72, wherein the ricin toxin A is ricin, deglycosylated ricin A (dgRTA) or non-glycosylated recombinant ricin A.

    84. A lyophilised composition that is a freeze-dried form of the composition of claim 72 and which is suitable for reconstitution with water or an aqueous solution.

    85. A method of treating acute Graft versus Host disease (aGVHD) in a human subject, wherein the method comprises: (a) analysing a sample obtained from the subject for viral infection; (b) administering a composition to the subject when the subject is determined to exhibit elevated or rising Epstein-Barr virus (EBV) or human cytomegalovirus (CMV) viral titre, and wherein the composition comprises: a first monoclonal antibody that recognizes CD3 having a heavy chain variable region comprising a complementarity determining region 1 (CDRH1) comprising the amino acid sequence of SEQ ID NO: 5; a complementarity determining region 2 (CDRH2) comprising the amino acid sequence of SEQ ID NO: 6; and a complementarity determining region 3 (CDRH3) comprising the amino acid sequence of SEQ ID NO: 7; and a light chain variable region comprising a complementarity determining region 1 (CDRL1) comprising the amino acid sequence of SEQ ID NO: 8; a complementarity determining region 2 (CDRL2) comprising the amino acid sequence of SEQ ID NO: 9, and a complementarity determining region 3 (CDRL3) comprising the amino acid sequence of SEQ ID NO: 10, wherein the first antibody is conjugated to at least one ricin toxin A (RTA), and a second monoclonal antibody that recognizes CD7 having a heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO: 15; a CDRH2 comprising the amino acid sequence of SEQ ID NO: 16; and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 17; and a light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO: 18; a CDRL2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 20, wherein the second antibody is conjugated to at least one ricin toxin A (RTA).

    86. The method of claim 85, wherein the composition comprises: a first monoclonal antibody molecule that specifically recognises CD3, said first monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and a light chain comprising the amino acid sequence of SEQ ID NO: 2, wherein the first antibody is conjugated to at least one ricin toxin A (RTA); and a second monoclonal antibody molecule that specifically recognises CD7, said second monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 11 and a light chain comprising the amino acid sequence of SEQ ID NO: 12, wherein the second antibody is conjugated to at least one RTA.

    87. The method of claim 85, wherein the administering comprises multiple infusions of said composition at a dose of 4 mg/m.sup.2 Body Surface Area (BSA).

    88. The method of claim 85, wherein the administering comprises four 4-hour infusions given at 48-hour intervals.

    89. The method of claim 85, wherein the ricin toxin A is ricin, deglycosylated ricin A (dgRTA) or non-glycosylated recombinant ricin A.

    90. The method of claim 85, wherein at least one of the following is de-immunised: the first antibody; the second antibody; the toxic moiety of the first antibody; and the toxic moiety of the second antibody.

    91. The method of claim 85, wherein the subject exhibits an EBV or CMV viral titre above 1000 viral DNA copies/ml of blood.

    92. The method of claim 85, wherein the composition suppresses or kills CD3+ or CD7+ T-cells.

    93. The method of claim 85, wherein the composition spares CD8+ anti-viral T-cells relative to CD3+ or CD7+ T-cells.

    94. The method of claim 85, wherein the subject is monitored for viral infection or reactivation by measuring at least one of a viral titre, viral culture, viral antigen detection, viral serology, or immunohistochemistry at least once before administration of said composition.

    95. The method of claim 94, wherein said monitoring comprises measuring plasma viral titre by real-time quantitative PCR.

    96. The method of claim 85, wherein the subject is being or has been treated with prophylactic antiviral medication.

    97. A method of preventing chronic GVHD (cGVHD) in a human subject having acute Graft versus Host disease (aGVHD), comprising the step of administering a therapeutically effective amount of a composition, the composition comprising: a first monoclonal antibody that recognizes CD3 having a heavy chain variable region comprising a complementarity determining region 1 (CDRH1) comprising the amino acid sequence of SEQ ID NO: 5; a complementarity determining region 2 (CDRH2) comprising the amino acid sequence of SEQ ID NO: 6; and a complementarity determining region 3 (CDRH3) comprising the amino acid sequence of SEQ ID NO: 7; and a light chain variable region comprising a complementarity determining region 1 (CDRL1) comprising the amino acid sequence of SEQ ID NO: 8; a complementarity determining region 2 (CDRL2) comprising the amino acid sequence of SEQ ID NO: 9, and a complementarity determining region 3 (CDRL3) comprising the amino acid sequence of SEQ ID NO: 10, wherein the first antibody is conjugated to at least one ricin toxin A (RTA), and a second monoclonal antibody that recognizes CD7 having a heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO: 15; a CDRH2 comprising the amino acid sequence of SEQ ID NO: 16; and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 17; and a light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO: 18; a CDRL2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 20, wherein the second antibody is conjugated to at least one ricin toxin A (RTA).

    98. The method of claim 97, wherein the composition comprises: a first monoclonal antibody molecule that specifically recognises CD3, said first monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and a light chain comprising the amino acid sequence of SEQ ID NO: 2, wherein said first antibody is conjugated to at least one ricin toxin A (RTA); and a second monoclonal antibody molecule that specifically recognises CD7, said second monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 11 and a light chain comprising the amino acid sequence of SEQ ID NO: 12 and which is conjugated to at least one RTA.

    99. A method of treating acute Graft versus Host disease (aGVHD) in a human subject, wherein the method comprises: (a) measuring the serum albumin level in a sample obtained from the subject; (b) administering a composition to the subject when the subject has a serum albumin level of between 10 g/L and 15 g/L, wherein the composition comprises: a first monoclonal antibody that recognizes CD3 having a heavy chain variable region comprising a complementarity determining region 1 (CDRH1) comprising the amino acid sequence of SEQ ID NO: 5; a complementarity determining region 2 (CDRH2) comprising the amino acid sequence of SEQ ID NO: 6; and a complementarity determining region 3 (CDRH3) comprising the amino acid sequence of SEQ ID NO: 7; and a light chain variable region comprising a complementarity determining region 1 (CDRL1) comprising the amino acid sequence of SEQ ID NO: 8; a complementarity determining region 2 (CDRL2) comprising the amino acid sequence of SEQ ID NO: 9, and a complementarity determining region 3 (CDRL3) comprising the amino acid sequence of SEQ ID NO: 10, wherein the first antibody is conjugated to at least one ricin toxin A (RTA), and a second monoclonal antibody that recognizes CD7 having a heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO: 15; a CDRH2 comprising the amino acid sequence of SEQ ID NO: 16; and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 17; and a light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO: 18; a CDRL2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 20, wherein the second antibody is conjugated to at least one ricin toxin A (RTA).

    100. The method of claim 99, wherein the composition comprises: a first monoclonal antibody molecule that specifically recognises CD3, said first monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and a light chain comprising the amino acid sequence of SEQ ID NO: 2, wherein said first monoclonal antibody is conjugated to at least one ricin toxin A (RTA); and a second monoclonal antibody molecule that specifically recognises CD7, said second monoclonal antibody having a heavy chain comprising the amino acid sequence of SEQ ID NO: 11 and a light chain comprising the amino acid sequence of SEQ ID NO: 12 and which is conjugated to at least one RTA.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0103] FIG. 1 shows day 28 response rate (bars 1 and 2) and 6-month overall survival (bars 3 and 4) for control (n=21) (bars 1 and 3) and for T-Guard-treated (n=6) (bars 2 and 4) expressed as percentage of the study population. Both response rate and survival were higher in the T-Guard-treated group.

    [0104] FIG. 2 shows a survival curve (survival on the y-axis plotted against time in months post-GvHD on the x-axis) for patients treated with the control (institutional standard of care). An initial phase <6 months exhibits a rapid decline in survival associated with refractory GvHD and infections; a later phase >6 months exhibits a slower decline in survival associated with relapse of underlying disease.

    [0105] FIG. 3 shows two survival curves (survival on the y-axis plotted against time in months post-GvHD on the x-axis) for patients treated with the control (institutional standard of care) (n=20) and T-Guard (n=6) up to 6 months. The T-Guard-treated patients exhibit higher survival than the control group.

    [0106] FIG. 4 shows a plot of EBV (circles) and CMV (triangles) titres plotted against time in days after treatment start for a patient treated with T-Guard (four infusions given at 48-hour intervals as indicated by the arrows). It is clear that after T-Guard treatment and subsequent wash-out, the EBV titre, which had reached a measured level of 250000 DNA copies/ml, exhibited a significant decline over subsequent days.

    [0107] FIG. 5 shows a plot of EBV (circles) and CMV (triangles) titres plotted against time in days after treatment start for a patient (different patent than that treated in FIG. 4) treated with T-Guard (four infusions given at 48-hour intervals as indicated by the arrows). It is clear that after T-Guard treatment the CMV titre declined. Moreover, after T-Guard treatment and subsequent wash out, 14 days after the start of treatment, a significant decline in EBV titre was seen.

    [0108] FIG. 6 shows an example from one patient of FACS cell sorting results obtained from patients treated with T-Guard. The left-hand panel shows CD3 cy7 plotted against CD8 FITC. The right-hand panel shows CMV PE plotted against CMV APC. Analysis of circulating T cells of patient 02-02 with tetramers revealed a large fraction (17.38%) of CMV-reactive cells within the CD8 positive T cell fraction, within 3 weeks after treatment start.

    [0109] FIG. 7 shows overall clinical response (ORR) at day 28 and overall survival (OS) at 6 months for T-Guard-treated patients and patients treated with the historical controls. The T-Guard-treated results (n=20) are shown in bars 2 and 4; the historical controls (n=42; Nijmegen, NL (n=21): inolimomab/etanercept; Mnster, DE (n=21): infliximab) are shown in bars 1 and 3. CR=Complete Response (lower bar portions in darker shading of bars 1 and 2). PR=Partial Response (upper bar portions in lighter shading). The y-axis shows the percentage of the study population. CR and OS are higher among the T-Guard-treated patients than the historical controls.

    [0110] FIG. 8 shows Kaplan Meijer curves of overall survival (OS) of the patients treated with T-Guard (n=20; orange; upper curve from around 1 month onwards) and the historical controls (n=42; grey; lower curve from around 1 month onwards). The y-axis is OS (%); the x-axis is time (months) follow-up post-second line treatment. Six month OS was 60% for T-Guard-treated vs. 29% for historical controls. A Cox regression analysis gave P=0.02.

    [0111] FIG. 9 shows a flow-chart depiction of the step-by-step process for preparing and purifying the antibody-toxin conjugates to obtain pharmaceutically acceptable product compositions (Process A). The conjugation and purification steps above the central horizontal line are performed in the 25 mM phosphate buffer at pH 7.5; steps below the horizontal line are performed in the 10 mM citrate buffer at pH 6.5.

    [0112] FIG. 10 shows a flow-chart depiction of an alternative step-by-step process for preparing and purifying the antibody-toxin conjugates to obtain pharmaceutically acceptable product compositions (Process B). The difference relative to Process A is that the change to the 10 mM citrate buffer occurs further upstream at the point shown by the upper horizontal line. Steps below that upper horizontal line are performed in the 10 mM citrate buffer at pH 6.5.

    [0113] FIG. 11 shows that T-Guard treatment induces a swift immune reconstitution with a diverse T cell repertoire. (A) The number of unique T cell clones, as measured by the total number of unique CDR3 sequences, are shown for 21 patients before (screening) and at 1 month (Ml), 3 months (M3) and 6 months (M6) after T-Guard therapy (Wilcoxon matched-paired signed rank test). There is significant increase of unique T cell clones within the first 6 months after T-Guard therapy, highlighting a diversity expansion within T cells. The blood T cells repertoires of a single patient before T-Guard therapy (C), 1 month (D), 3 months (E) and 6 months (F) after therapy.

    [0114] FIG. 12 shows an illustration depicting the possible mechanistic mode of action of immunotoxin combination of the present invention, as exemplified by T-Guard administration. Both toxin-induced apoptosis (anti-CD3 and anti-CD7 directed) and inhibition of alloactivation are believed to be implicated.

    [0115] FIG. 13 Overview of the response rate at day 28 (top) and overall survival 6 months after treatment with CD3/CD7-IT (bottom) compared to historical controls. The difference between patients who received CD3/CD7-IT and the historical controls was statistically significant, with improvements in both complete remission rate (p=0.012) and 6-month survival (p=0.021).

    [0116] FIG. 14 CD3/CD7-IT induces rapid immune reconstitution with a diverse T-cell repertoire. (A-C) Time course of the median T-cell count (A), median NK-cell count (B), and median B-cell count (C) for all patients. In each plot, the blue line represents the median value, and the lower and upper gray dotted lines represent the 25.sup.th and 75.sup.th percentiles, respectively. (D) Summary of the absolute number of unique T-cell clones prior to administration of CD3/CD7-IT (Pre) and 1, 3, and 6 months after treatment. The number of unique T-cell clones was measured using the total number of unique CDR3 sequences. The p-values are based on a Wilcoxon matched-paired signed rank test. The significant increase in unique T-cell clones 6 months after CD3/CD7-IT therapy reflects an increase in the diversity of expanded T-cells. (E-H) Representative histograms showing the T-cell repertoires in a single patient pre-therapy (E) and 1 (F), 3 (G), and 6 (H) months after CD3/CD7-IT therapy.

    [0117] FIG. 15 CD3/CD7-IT does not affect the fraction of anti-virus EBV- and CMV-associated T cell clones. (A&C) Summary of the absolute numbers of anti-EBV (A) and anti-CMV (C) T-cells in patients who tested positive for viral infection after treatment. In each patient group, the number of virus-associated T-cells was measured prior and after treatment. (B&D) Plots showing the differential abundance analysis of unique anti-EBV (B) and anti-CMV (D) T-cell clones. Shown are representative graphs of two patients who tested positive for the respective viral infection prior to treatment. Screening samples were compared to samples taken 1 month and 3 months after therapy with CD3/CD7-IT. This pairwise comparison confirms that the majority of the respective CMV- and EBV-associated clones neither expanded nor contracted as a result of therapy. In each plot, the solid gray diagonal line indicates equal numbers of clones in both samples (no change). Clones positioned between the dotted gray lines and the respective X or Y-axis were not present in other sample, e.g. present pre-therapy but not post therapy.

    DETAILED DESCRIPTION OF THE INVENTION

    [0118] In describing the present invention, the following terms will be employed, and are intended to be defined as indicated below.

    [0119] Antibody Molecule

    [0120] As used herein with reference to all aspects of the invention, the term antibody or antibody molecule includes any immunoglobulin whether natural or partly or wholly synthetically produced. The term antibody or antibody molecule includes monoclonal antibodies (mAb) and polyclonal antibodies (including polyclonal antisera). Antibodies may be intact or fragments derived from full antibodies (see below). Antibodies may be human antibodies, humanised antibodies or antibodies of non-human origin. Monoclonal antibodies are homogeneous, highly specific antibody populations directed against a single antigenic site or determinant of the target molecule. Polyclonal antibodies include heterogeneous antibody populations that are directed against different antigenic determinants of the target molecule. The term antiserum or antisera refers to blood serum containing antibodies obtained from immunized animals.

    [0121] It has been shown that fragments of a whole antibody can perform the function of binding antigens. Thus reference to antibody herein, and with reference to the methods, arrays and kits of the invention, covers a full antibody and also covers any polypeptide or protein comprising an antibody binding fragment. Examples of binding fragments are (i) the Fab fragment consisting of V.sub.L, V.sub.H, C.sub.T, and C.sub.H1 domains; the Fd fragment consisting of the V.sub.H and C.sub.H1 domains; (iii) the Fv fragment consisting of the V.sub.L and V.sub.H domains of a single antibody; (iv) the dAb fragment which consists of a V, domain; (v) isolated CDR regions; (vi) F(ab).sub.2 fragments, a bivalent fragment comprising two linked Fab fragments (vii) single chain Fv molecules (scFv), wherein a V.sub.H domain and a V.sub.L domain are linked by a peptide linker which allows the two domains to associate to form an antigen binding site; (viii) bispecific single chain Fv dimers (WO 93/11161) and (ix) diabodies, multivalent or multispecific fragments constructed by gene fusion (WO94/13804; 58). Fv, scFv or diabody molecules may be stabilised by the incorporation of disulphide bridges linking the VH and VL domains. Minibodies comprising a scFv joined to a CH3 domain may also be made.

    [0122] As used herein, antibody molecule and immunotoxin are intended to encompass recombinant antibodies and recombinant immunotoxins, respectively (e.g., Fab, scFv or SC mAb linked through a cleavable peptide linker to a recombinant ribosomal inhibiting protein). Additionally or alternatively, the first and second antibody molecules may be provided as a single bispecific (anti-CD3/anti-CD7) antibody, thereby providing a bispecific immunotoxin such as anti-CD3/CD7-rRTA.

    [0123] In relation to an antibody molecule, the term selectively binds may be used herein to refer to the situation in which one member of a specific binding pair will not show any significant binding to molecules other than its specific binding partner(s). The term is also applicable where e.g. an antigen-binding site is specific for a particular epitope that is carried by a number of antigens, in which case the specific binding member carrying the antigen-binding site will be able to bind to the various antigens carrying the epitope.

    [0124] The antibody that selectively binds CD3 may in some cases comprise the complementarity determining regions (CDRs) of the antibody SPV-T3a. In accordance with IMGT numbering system (Lefranc, M.-P. et al., Nucleic Acids Research, 1999, Vol. 27, pp. 209-212, incorporated herein by reference) the CDRs of SFV-T3a are: CDRH1-H3: SEQ ID NOs: 5-7; CDRL1-L3: SEQ ID NOs: 8-10. In some cases the antibody that selectively binds CD3 may comprise the V of SPV-T3a (SEQ ID NO: 3) and/or the V.sub.L of SPV-T3a (SEQ ID NO: 4). In certain embodiments, the antibody that selectively binds CD3 may be the SPV-T3a antibody having the heavy chain of SEQ ID NO: 1 and light chain of SEQ ID NO: 2.

    [0125] The antibody that selectively binds CD7 may in some cases comprise the complementarity determining regions (CDRs) of the antibody WT1. In accordance with IMGT numbering system (Lefranc, M.-P. et al., Nucleic Acids Research, 1999, Vol. 27, pp. 209-212, incorporated herein by reference) the CDRs of WT1 are: CDRH1-H3: SEQ ID NOs: 15-17; CDRL1-L3: SEQ ID NOs: 18-20. In some cases the antibody that selectively binds CD7 may comprise the V.sub.H of WT1 (SEQ ID NO: 13) and/or the V.sub.L of WT1 (SEQ ID NO: 14). In certain embodiments, the antibody that selectively binds CD7 may be the WT1 antibody having the heavy chain of SEQ ID NO: 11 and light chain of SEQ ID NO: 12.

    [0126] SPV-T3a

    [0127] SPV-T3a is a murine IgG2b monoclonal antibody that selectively binds human CD3, a T cell surface glycoprotein composed of a CD3 chain (UniProt: P09693), a CD3 chain (UniProt: P04234), and two CD3 chains (UniProt: P07766). The production and characterization of SPV-T3a is described in Spits et al., Hybridoma, 1983, Vol. 2, pp. 423-437, the entire content of which is expressly incorporated herein by reference. As described herein, the SVP-T3a antibody may be conjugated to ricin toxin A (RTA), for example deglycosylated ricin toxin A, using the 4-succinimidyloxocarbonyl--methyl--(2-pyridyldithio)toluene (SMPT) crosslinker. The average number of deglycosylated ricin toxin A molecules conjugated to each SPV-T3a antibody is believed to be approximately 1.5. This antibody conjugate may be referred to herein as SPV-T3a-RTA. Conjugation and purification may be carried out by the process depicted in FIG. 9 or the process depicted in FIG. 10.

    [0128] The amino acid sequence of the SPV-T3a light chain and heavy chain were determined by extracting mRNA from hybridoma cell pellets, RT-PCR was performed and DNA sequenced on an ABI3130x1 Genetic Analyzer. Amino acid sequences were predicted and were corroborated by Mass Spectrometry analysis. The complementarity determining regions (CDRs) are as determined according to the IMGT numbering system (Lefranc, M.-P. et al., Nucleic Acids Research, 1999, Vol. 27, pp. 209-212, incorporated herein by reference).

    [0129] The amino acid sequences of SPV-T3a heavy chain and light chain, respectively, are shown below.

    TABLE-US-00001 SPV-T3aHeavyChain: (SEQIDNO:1) 1 [00001]embedded image 51 [00002]embedded image 101 [00003]embedded image 151 GYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTV 201 TCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVF 251 IFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQT 301 HREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKG 351 LVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENY 401 KDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTI 451 SRSPGK

    [0130] VH domain is underlined; CDRH1-H3 are shown in bold and curved underlined.

    TABLE-US-00002 SPV-T3aLightChain: (SEQIDNO:2) 1 [00004]embedded image 51 [00005]embedded image 101 TKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKID 151 GSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS 201 TSPIVKSFNRNEC

    [0131] VL domain is underlined; CDRL1-L3 are shown in bold and curved underlined.

    TABLE-US-00003 SFV-T3a-VH: (SEQIDNO:3) 1 [00006]embedded image 51 [00007]embedded image 101 [00008]embedded image SPV-T3a-VL: (SEQIDNO:4) 1 [00009]embedded image 51 [00010]embedded image 101 TKLELKR SPV-T3a-CDRH1: (SEQIDNO:5) [00011]embedded image SPV-T3a-CDRH2: (SEQIDNO:6) [00012]embedded image SPV-T3a-CDRH3: (SEQIDNO:7) [00013]embedded image SPV-T3a-CDRL1: (SEQIDNO:8) [00014]embedded image SPV-T3a-CDRL2: (SEQIDNO:9) [00015]embedded image SPV-T3a-CDRL3: (SEQIDNO:10) [00016]embedded image

    [0132] WT1

    [0133] WT1 is a murine IgG2a monoclonal antibody that selectively binds human CD7 (UniProt: P09564), a transmembrane protein which is a member of the immunoglobulin superfamily and is found on thymocytes and mature T cells. The production and characterization of WT1 is described in Tax et al., Hamatol Bluttransfus, 1983, Vol. 28, pp. 139-141 and Tax et al., Clin Exp Immunol, 1984, Vol. 55, pp. 427-436, the contents of both of which are expressly incorporated herein by reference. As described herein, the WT1 antibody may be conjugated to ricin toxin A (RTA), for example deglycosylated ricin toxin A, using the SMPT crosslinker. The average number of deglycosylated ricin toxin A molecules conjugated to each WT1 antibody is believed to be approximately 1.5. This antibody conjugate may be referred to herein as WT1-RTA. Conjugation and purification may be carried out by the process depicted in FIG. 9 or the process depicted in FIG. 10. WT1 is commercially available. For example, the anti-CD7 antibody (clone WT1) is sold by LifeSpan BioSciences, Inc. under catalogue number: LS-C122885-1000 (1000 l in PBS, 0.1% sodium azide) for research use, e.g., immunofluorescence and immunohistochemistry.

    [0134] The amino acid sequence of the WT1 light chain and heavy chain were determined by extracting mRNA from hybridoma cell pellets, RT-PCR was performed and DNA sequenced on an ABI3130x1 Genetic Analyzer. Amino acid sequences were predicted and were corroborated by Mass Spectrometry analysis. The complementarity determining regions (CDRs) are as determined according to the IMGT numbering system (Lefranc, M.-P. et al., Nucleic Acids Research, 1999, Vol. 27, pp. 209-212, incorporated herein by reference).

    [0135] The amino acid sequences of WT1 heavy chain and light chain, respectively, are shown below.

    TABLE-US-00004 WT1HeavyChain: (SEQIDNO:11) 1 [00017]embedded image 51 [00018]embedded image 101 [00019]embedded image 151 LVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPS 201 QSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFP 251 PKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRE 301 DYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVR 351 APQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNT 401 EPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRT 451 PGK

    [0136] VH domain is underlined; CDRH1-H3 are shown in bold and curved underlined.

    TABLE-US-00005 WT1LightChain: (SEQIDNO:12) 1 [00020]embedded image 51 [00021]embedded image 101 GGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVD 151 WKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTH 201 EGHTVEKSLSRADCS

    [0137] VL domain is underlined; CDRL1-L3 are shown in bold and curved underlined.

    TABLE-US-00006 WT1-VH: (SEQIDNO:13) 1 [00022]embedded image 51 [00023]embedded image 101 [00024]embedded image WT1-VL: (SEQIDNO:14) 1 [00025]embedded image 51 [00026]embedded image 101 GGGTKLTVL WT1-CDRH1: (SEQIDNO:15) [00027]embedded image WT1-CDRH2: (SEQIDNO:16) [00028]embedded image WT1-CDRH3: (SEQIDNO:17) [00029]embedded image WT1-CDRL1: (SEQIDNO:18) [00030]embedded image WT1-CDRL2: (SEQIDNO:19) [00031]embedded image WT1-CDRL3: (SEQIDNO:20) [00032]embedded image

    [0138] Graft Versus Host Disease (GVHD)Acute and Chronic

    [0139] GVHD is a medical complication following the receipt of transplanted tissue from a genetically different person. GVHD is commonly associated with stem cell transplant (bone marrow transplant), but the term also applies to other forms of tissue graft. Immune cells in the donated tissue (the graft) recognize the recipient (the host) as foreign (nonself). The transplanted immune cells then attack the host's body cells. Traditionally, GVHD that occurred within the first 100 days after transplantation was arbitrarily classified as acute, whereas GVHD that was still present, or developed, at a later stage was referred to as chronic GVHD. The current viewpoint is that chronic GVHD is not simply a continuation of acute GVHD (Toubai et al. 2008, Flowers et al. 2011). While there is significant overlap between the organs involved in acute and chronic GVHD, the distribution of affected organs in chronic GVHD is much broader, including also the eyes, lungs, salivary glands, and esophagus. Based on histological signs, acute GVHD is dominated by apoptosis and necrosis, whereas chronic GVHD represents an inflammatory and fibrotic process similar to as seen in certain autoimmune disorders (Higman et al. 2004, Filipovich et al. 2005). Although acute GVHD is highly associated with subsequent chronic GVDH, approximately 20-30% of people with acute GVHD do not develop chronic GVHD later. Moreover, 25-35% of chronic GVHD is de novo without any preceding acute manifestations (Lee 2005).

    [0140] As used herein providing a clinical benefit as measured by the incidence of grade 3 or above capillary leak syndrome (CLS) means avoiding development of grade 3 or above capillary leak syndrome or vascular leak syndrome (VLS) in a patient administered the composition of the present invention, for example as assessed between 1 and 100, e.g. between 1 and 10 days following administration of said composition. CLS/VLS grading may be as defined in Sausville et al., Blood, 1995, Vol. 85, No. 12, pp. 3457-3465, the contents of which are expressly incorporated herein by reference. In particular, the NCI Common Toxicity criteria were used. Vascular leak was specifically graded as follows: grade 1, minimal ankle pitting edema; grade 2, ankle pitting edema and weight gain, but total weight gain of less than 10 lb; grade 3, peripheral edema with a weight gain of greater than 10 lb or pleural effusion with no pulmonary function deficit documented; grade 4, anasarca, pleural effusion or ascites with pulmonary function deficit or pulmonary edema; and grade 5, respiratory failure requiring mechanical ventilation in the setting of pulmonary edema or hypotension requiring pressor support.

    [0141] Pharmaceutical Compositions and Administration Thereof

    [0142] The compositions of the invention may be formulated as pharmaceutical compositions that may be in the forms of solid or liquid compositions. Such compositions will generally comprise a carrier of some sort, for example a solid carrier or a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included. Such compositions and preparations generally contain at least 0.1 wt % of the compound.

    [0143] For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient may be in the form of a parenterally acceptable aqueous solution or liquid which is pyrogen-free and has suitable pH, tonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, solutions of the compounds or a derivative thereof, e.g. in physiological saline, a dispersion prepared with glycerol, liquid polyethylene glycol or oils.

    [0144] In addition to one or more of the compounds, optionally in combination with other active ingredient(s), the compositions can comprise one or more of a pharmaceutically acceptable excipient, carrier, buffer, stabiliser, tonicising adjusting agent, preservative or anti-oxidant or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material may depend on the route of administration, e.g., intravenous injection.

    [0145] Preferably, the pharmaceutically compositions are given to an individual in a prophylactically effective amount or a therapeutically effective amount (as the case may be, although prophylaxis may be considered therapy), this being sufficient to show benefit to the individual. Typically, this will be to cause a therapeutically useful activity providing benefit to the individual. The actual amount of the compounds administered, and rate and time-course of administration, will depend on the nature and severity of the condition being treated. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Handbook of Pharmaceutical Additives, 2nd Edition (eds. M. Ash and I. Ash), 2001 (Synapse Information Resources, Inc., Endicott, N.Y., USA); Remington's Pharmaceutical Sciences, 20th Edition, 2000, pub. Lippincott, Williams & Wilkins; and Handbook of Pharmaceutical Excipients, 2nd edition, 1994. By way of example, and the compositions are preferably administered to patients in dosages of between about 0.01 and 100 mg of active compound per kg of body weight, and more preferably between about 0.5 and 10 mg/kg of body weight.

    [0146] In particular cases, the pharmaceutical compositions of the present invention may be administered, or for administration, at a dose of approximately 4 mg/m.sup.2 Body Surface Area (BSA). The pharmaceutical compositions of the present invention may advantageously be administered, or for administration, as multiple infusions, e.g. four 4-hour infusions given at 48-hour intervals.

    [0147] The following is presented by way of example and is not to be construed as a limitation to the scope of the claims.

    EXAMPLES

    Example 1Prolonged Survival of Graft Vs. Host Disease Patients Following Treatment with T-Guard Immunotoxin Cocktail

    [0148] The investigational product is an immunotoxin-combination named T-Guard, consisting of equal amounts (w/w) of two murine antibodies (mAb) SVP-T3a (anti-CD3, IgG2b) and WT1 (anti-CD7, IgG2a), each conjugated to the recombinant ricin toxin A-chain (RTA): SPV-T3a-RTA and WT1-RTA. T-Guard is administered intravenously to human GvHD patients as four 4-hour infusions given at 48-hour intervals. Each dose consists of 4 mg/m.sup.2 Body Surface Area (BSA). Typically, the estimated BSA will lie somewhere between 1.4 and 2.5 m.sup.2 (small personlarge person). If a patient's BSA is more than 2.5 m.sup.2, the dose calculation should use 2.5 m.sup.2.

    [0149] Of seven GvHD patients in the group to be treated with T-Guard, one was positive for CMV and one was positive for EBV just prior to the start of the T-Guard treatment. No new re-activations of EBV or CMV after start of the T-Guard treatment were seen. Of the 21 patients treated with the institutional standard of care (SoC) consisting of a combination of inolimomab (trade name Leucotac, anti-CD25) and etanercept (trade name Enbrel, anti-TNF), 2 patients developed a probable invasive mould disease, 2 patients developed a CMV infection (one progressing to CMV colitis), 2 patients developed an adenovirus infection, and 3 patients developed an EBV infection. As shown in FIG. 1, day 28 response rate and 6-month survival were both superior in the T-Guard-treated group compared with control. FIG. 2 shows a survival curve for patients treated with Institutional SoC. A marked early mortality phase (<6 months) is evident. This early mortality period is associated with both refractory GvHD and with viral infection or reactivation (see also van Groningen et al., Biol. Blood Marrow Transplant, 2016, Vol. 22, pp. 170-182. FIG. 3 shows survival curves for T-Guard-treated patients versus Institutional SoC, up to the 6-month time point. It is clear that cumulative survival is higher among the T-Guard-treated patients.

    Example 2Spontaneous Resolution of Viral Reactivation Among Graft Vs. Host Disease Patients Treated with T-Guard Immunotoxin Cocktail

    [0150] A further investigation was carried out in which GvHD patients exhibiting positive virus titres were treated with T-Guard (same dosage amount and interval as described above in Example 1) and monitored for CMV and EBV viral titres over time.

    [0151] CMV titre was measured by real-time quantitative PCR, essentially as described in Kalpoe et al., J. Clin. Microbiol., 2004, Vol. 42, No. 4, pp. 1498-1504, the entire contents of which are expressly incorporated herein by reference.

    [0152] EBV titre was measured by real-time quantitative PCR, essentially as described in Niesters et al., J. Clin. Microbial., 2000, Vol. 38, pp. 712-715, the entire contents of which are expressly incorporated herein by reference.

    [0153] Two GvHD patients exhibited positive virus titres at screening, despite prophylaxis with Aciclovir. The first patient was positive for EBV, the second patient for both EBV and CMV. Especially the first patient showed a massive increase in EBV titre in the first week after T-Guard treatment start, amounting to 250000 DNA copies/ml (see FIG. 4). Surprisingly, the EBV titre then resolved in the next two weeks without further intervention in the form of rituximab or therapeutic CTLs. A similar response was seen in the second patient, for both EBV and CMV, although at lower titres (see FIG. 5).

    [0154] Tetramer analysis of the Day 21-blood sample of the second patient showed that his CD8 positive cells included 17% that were CMV-directed T-cells (see FIG. 6). Without wishing to be bound by any particular theory, the present inventors believe that the anti-CMV T-cells, relatively spared by T-Guard treatment, are able to keep the patient's CMV titre low. It is further contemplated that staining with HLA-matching EBV tetramers will be performed. The resolution of EBV reactivation in the second week after treatment start clearly suggests that there must be EBV-directed T-cells present as well (see FIG. 5).

    [0155] The present example demonstrates patients recovering from steroid-resistant acute GvHD and successfully fighting (pre-existing) infections within 2-3 weeks after receiving T-Guard treatment. The fact that both these patients are stable GvHD responders suggests that T-Guard preferentially eliminates allo-reactive T-cells over anti-viral T-cells. It is presently thought that what is being seen is a relative sparing of anti-viral cells, which might then expand by lymphopenia-induced homeostatic proliferation after T-Guard has been washed away (within 1-2 days after last infusion). Further support for this conclusion comes from the expanded T cell repertoire shown in FIG. 11.

    Example 3a Phase I/II Study on the Anti-CD3/CD7 Immunotoxin Combination (T-Guard) for the Treatment of Steroid-Refractory Acute GVHD

    Background

    [0156] More effective therapies for steroid-refractory acute graft-versus-host disease (SR-aGVHD) are urgently needed. Because infections and relapse of the hematological malignancy contribute to the dismal overall survival (OS), therapies that limit the duration of immune suppression after achieving a remission might be preferred. The immunotoxin (IT)-combination (T-Guard) consists of two antibody-drug conjugates (i.e. Ricin A) that target CD3 and CD7 on activated T lymphocytes and has shown efficacy as third-line therapy in SR-aGVHD while allowing fast immune reconstitution. T-Guard is therefore a composition in accordance with the various aspects of the present invention.

    Objectives

    [0157] We conducted a prospective phase I/II multicenter trial on the safety and efficacy of T-Guard for the treatment of SR-aGVHD (NCT02027805).

    Methods

    [0158] Adult patients with grade II-IV SR-aGVHD were eligible for inclusion. Exclusion criteria consisted of the presence of uncontrolled infections, signs of chronic GVHD, severe renal impairment and severe hypoalbuminemia. T-Guard was given as 4-hour intravenous infusions every 48 hours for a total of 4 doses of each 4 mg/m2. The primary efficacy endpoint was defined as overall clinical response (ORR) on day 28. The main secondary endpoints were the 6-month OS and the safety and tolerability.

    Results

    [0159] Between June 2014 and September 2016 the planned 20 adult patients were included in two European centers. Patients, 11 female and 9 male, with a median age of 53 years (range 18-74) all had received an allogeneic stem cell transplantation for myeloid and lymphoid malignancies. All but two completed the planned 8 days of treatment with T-Guard. SR-aGVHD was grade II in 3 patients (15%), III in 11 (55%), and IV in 7 (35%). In most patients 2 organs were involved (16/20, 80%), with gastro-intestinal (GI) and liver involvement in 18 and 5 cases, respectively. Baseline albumin levels were median 23 gr/L (range: 16-34; N 35-50 gr/L) and based on the 2-biomarker model (ST2 and REG3) no patients were classified as low-risk (<0.08), and 50% as high-risk (0.32). The 2-biomarker model is further described in WO 2013/066369, the entire content of which is expressly incorporated herein by reference.

    [0160] On day 28, 12 patients had achieved a clinical response (ORR: 12/20, 60%), with 10 (50%) achieving a complete remission (CR), FIG. 7. In those with a high-risk biomarker profile a CR was achieved in 50%. With a minimum follow-up of 6 months 12 patients were alive (6-month OS 60%), FIG. 7. The cause of death in the other eight patients was refractory aGVHD (N=4), refractory GVHD and infection (N=3) and pseudomembranous colitis (N=1). Of those receiving the planned treatment the ORR, CR rate and 6-month OS were 60%, 50%, and 60% respectively. The outcomes compared favorably with historical controls receiving either infliximab (N=21) or inolimomab/etanercept (N=21) were the ORR was 52% and the 6-month OS 29% (FIGS. 7 and 8).

    [0161] No significant infusion reactions were recorded, although two patients experienced chills on their first infusion, and after introduction of clemastine pre-infusion no infusion reactions were seen. As expected, the rate of overall infection and adverse events was high. However, there was a limited number of potentially attributable adverse events that occurred in more than one patient, and consisted of hypoalbuminemia, microangiopathy, and thrombocytopenia. Capillary Leak Syndrome occurred in only one patient, with edema requiring treatment with diuretics (grade 2). Early (<3 months) EBV and CMV infections were recorded in 3 patients each, but no CMV disease or PTLD occurred. Whilst only 40% received mould-active antifungal prophylaxis no invasive fungal disease (IFD) were seen. The low number and mild severity of side effects observed is considered unusual in comparison with other RTA immunotoxins. This suggests that the dose was able to produce a therapeutic effect while minimising side effects.

    [0162] While the one-week treatment course was associated with an immediate depletion of T and NK cells, the T-Guard IT-combination's short half-life (9 hrs) allowed for a swift immune reconstitution accompanied by a diverse T cell receptor repertoire and without a negative effect on the fraction of anti-viral EBV and CMV-specific clones, as assessed by deep sequencing. Within 6 months there was a significant increase of unique T cell clones compared to the first month post-therapy (p=0.03) (see FIG. 11).

    [0163] Of particular note, only 1 out of 12 patients was diagnosed with cGVHD symptoms 6 months (180 Days) after T-Guard treatment in this Phase 1/2 study; this translates to a cGVHD incidence at 180 days of only 8.3%. Moreover, this cGVHD event was assessed to be limited only (see Table 1).

    TABLE-US-00007 TABLE 1 Chronic GVHD Events % Days cGVHD (n) Pt. No. Diagnosed R/OS Comments Absent 80% NA NA (16) Limited 15% 01-06* Pre-study, CR/A End of study absent (3) and D28-56 01-07** Pre-study, PR/D End of study absent, and D02-56 cause of death: gut failure 02-05 D1B0 CR/A Extensive 5% 01-02 End of CR/D Cause of (1) study death: fever and intestinal failure *Signs and symptoms of cGVHD (mouth and skin) reported before enrolment. **Patient had confirmed cGVHD reported in medical history. CR = Complete Responder; PR = Partial Responder; A = Alive; D = Death.

    [0164] The cGVHD rate for survivors at 6 months (180 days) is only 8.3% instead of the typical >40% incidence reported in the literature. In particular, the following cGVHD have been reported previously: [0165] Furlong et al., Bone Marrow Transplant., 2009, Vol. 44, No. 11, pp. 739-748: 73.3% for MMF after 100 Days (survivors only). [0166] Socie et al., Blood, 2017, Vol. 129, No. 5, pp. 643-649: 75.4% for inolimomab and 80.2% for ATG after 1 year (survivors only); all events were assessed to be severe. [0167] MacMillan et al., Biology of Blood and Marrow Transplantation, 2002, Vol. 8, pp. 40-46: 50.6% for ATG after 1 year (survivors only). [0168] MacMillan et al., Blood, 2007, Vol. 109, No. 6, pp. 2657-2662: 44% for ABX-CBL an 46% for ATG relative to the patients who started treatment.

    CONCLUSIONS

    [0169] Treatment of SR-aGVHD with a short course of the T-Guard proved to be safe and well tolerated, and resulted in a high rate of CR and a promising 6-month OS of 60%, especially considering the high-risk setting (90% GI involvement, 50% high-risk biomarker profile).

    [0170] Furthermore, the study results surprisingly show that T-Guard, a composition in accordance with the various aspects of the present invention, was able to preventatively treat cGVHD as assessed by incidence of cGVHD at 180 days after second-line treatment (i.e. T-Guard administration) for SR-aGVHD. These results therefore indicate that T-Guard may enjoy a secondary use in the preventative treatment of cGVHD among the patient group undergoing immunomodulatory treatment for aGVHD, including SR-aGVHD.

    [0171] Absence of Severe RTA-Related Toxicities

    [0172] One of the main safety concerns associated with the therapeutic use of RTA-based immunotoxins is capillary leak syndrome (CLS), followed by myalgia associated with elevated CK levels (Vitetta et al. 1991, Amlot et al. 1993, Conry et al. 1995, Sausville et al. 1995, Stone et al. 1996, Engert et al. 1997, Frankel et al. 1997, Schnell et al. 1998, Messmann et al. 2000, Schnell et al. 2000, Schindler et al. 2001, Schnell et al. 2002, Schnell et al. 2003, Schindler et al. 2011). The research group of Prof. Vitetta described for comparable immunotoxins that serum concentrations at or above 1 g/ml (0.510-8 M) were typically associated with the occurrence of serious RTA-associated side effects, predominantly consisting of CLS (Amlot et al. 1993, Sausville et al. 1995, Stone et al. 1996). Moreover, based upon a retrospective analysis of patients in five clinical trials, Schindler et al. concluded that the toxicity of RTA-based immunotoxins is exacerbated by prior radiotherapy (Schindler et al. 2001). Stone et al., 2001 and Sausville et al. 1995 reported that immunotoxin Cmax is positively correlated with CLS/VLS severity (see, e.g., FIG. 2 of Sausville et al., 1995).

    [0173] Interestingly, as described herein, T-Guard treatment did not induce any severe CLS or myalgia in any of the patients treated so far. Not in the Phase 1/2 trial, nor in the investigator-initiated dose escalation study, while all respective patients had received prior chemo- and radiotherapy, and Cmax values at or above 1 g/ml were obtained in all patients. Although eight of the patients in the Phase 2 study were diagnosed to have some limited symptoms associated with CLS, 7 of these patients did not require treatment at all (mild CLS; Grade 1) and only one was treated with diuretics for edema (moderate CLS; Grade 2). Thus far, no severe cases of CLS have been reported in any of the 32 patients treated with T-Guard (including the investigator-initiated dose escalation study and named patients). There were also no observations of CK rise or treatment-related myalgia in the Phase 1/2 study (in the investigator-initiated dose escalation study, only 1 patient demonstrated a Grade 1 increase of plasma CK levels).

    [0174] Without wishing to be bound by any particular theory, the present inventors postulate that the reason for T-Guard's favorable safety profile might be the partitioning of the RTA toxin over SPV-T3a and WT1 (half a dose each), which mAbs might have different systemic distribution profiles (and, thereby, causing a dilution of nonspecific toxicities) due to differences in isoelectric point. Together with the presumed synergistic elimination of T cells by SPV-T3a-RTA and WT1-RTA, and the additive immunosuppression provided by SPV-T3a through inhibition of alloactivation, this might explain T-Guard's promising therapeutic window thus far observed.

    [0175] By way of contrast, the use of Denileukin Diftitox (Ontak) in Cutaneous T Cell Lymphoma (CTCL) has label warning Delay administration of Ontak until serum albumin levels are at least 3.0 g/dL (see ONTAK US label revised 10/2009). Capillary leak syndrome was reported as occurring in 32.5% (76/234) of Ontak-treated patients. The label warns: Withhold Ontak for serum albumin levels of less than 3.0 g/dL. Moreover, Olsen et al., J. Clin. Oncol., 2001, Vol. 19, No. 2, pp. 376-388, describing a phase III trial of denileukin difitox for the treatment of CTCL, defines CLS (or vascular leak syndrome VLS as they call it) as the simultaneous occurrence, regardless of severity, of at least two of the following: edema, hypoalbuminemia (2.8 g/dL), and/or hypotension. By this definition, 25% (18 of 71) of the patients experienced VLS. Olsen et al. 2001 further stated that The four patients who experienced a second episode of VLS on rechallenge had albumin levels less than 2.8 g/dL at the start of the course in which the second episode occurred. Serum albumin levels less than 3.0 g/dL seemed to predict and may predispose patients to this syndrome. Preexisting edema was also a risk factor for development of the syndrome.

    [0176] Notably, the patients of the T-Guard Phase 1/2 study had median serum albumin levels of 23 g/L (range 16-34 g/L) at treatment start (i.e. 2.3 g/dL (range 1.6-3.4 g/dL)). This surprisingly shows that T-Guard, despite being and immunotoxin-based therapy, appears to be suitable for use in a patient subgroup having serum albumin levels below that considered safe for another immunotoxin-based therapy (Ontak). Without wishing to be bound by any particular theory, the present inventors believe that this advantageously opens up further treatment choice for medical practitioners and their patients.

    ADDITIONAL REFERENCES CITED IN EXAMPLE 3

    [0177] Amlot, P. L., M. J. Stone, D. Cunningham, J. Fay, J. Newman, R. Collins, R. May, M. McCarthy, J. Richardson, V. Ghetie and et al. (1993). A phase I study of an anti-CD22-deglycosylated ricin A chain immunotoxin in the treatment of B-cell lymphomas resistant to conventional therapy. Blood 82(9): 2624-2633. [0178] Conry, R. M., M. B. Khazaeli, M. N. Saleh, V. Ghetie, E. S. Vitetta, T. Liu and A. F. LoBuglio (1995). Phase I trial of an anti-CD19 deglycosylated ricin A chain immunotoxin in non-Hodgkin's lymphoma: effect of an intensive schedule of administration. J Immunother Emphasis Tumor Immunol 18(4): 231-241. [0179] Engert, A., V. Diehl, R. Schnell, A. Radszuhn, M. T. Hatwig, S. Drillich, G. Schon, H. Bohlen, H. Tesch, M. L. Hansmann, S. Barth, J. Schindler, V. Ghetie, J. Uhr and E. Vitetta (1997). A phase-I study of an anti-CD25 ricin A-chain immunotoxin (RFT5-SMPT-dgA) in patients with refractory Hodgkin's lymphoma. Blood 89(2): 403-410. Frankel, A. E., J. H. Laver, M. C. Willingham, L. J. Burns, J. H. Kersey and D. A. Vallera (1997). Therapy of patients with T-cell lymphomas and leukemias using an anti-CD7 monoclonal antibody-ricin A chain immunotoxin. Leuk Lymphoma 26(3-4): 287-298. [0180] Messmann, R. A., E. S. Vitetta, D. Headlee, A. M. Senderowicz, W. D. Figg, J. Schindler, D. F. Michiel, S. Creekmore, S. M. Steinberg, D. Kohler, E. S. Jaffe, M. Stetler-Stevenson, H. Chen, V. Ghetie and E. A. Sausville (2000). A phase I study of combination therapy with immunotoxins IgG-HD37-deglycosylated ricin A chain (dgA) and IgG-RFB4-dgA (Combotox) in patients with refractory CD19(+), CD22(+) B cell lymphoma. Clin Cancer Res 6(4): 1302-1313. [0181] Sausville, E. A., D. Headlee, M. Stetler-Stevenson, E. S. Jaffe, D. Solomon, W. D. Figg, J. Herdt, W. C. Kopp, H. Rager, S. M. Steinberg and et al. (1995). Continuous infusion of the anti-CD22 immunotoxin IgG-RFB4-SMPT-dcA in patients with B-cell lymphoma: a phase I study. Blood 85(12): 3457-3465. [0182] Schindler, J., S. Gajavelli, F. Ravandi, Y. Shen, S. Parekh, I. Braunchweig, S. Barta, V. Ghetie, E. Vitetta and A. Verma (2011). A phase I study of a combination of anti-CD19 and anti-CD22 immunotoxins (Combotox) in adult patients with refractory B-lineage acute lymphoblastic leukaemia. Br J Haematol 154(4): 471-476. Schindler, J., E. Sausville, R. Messmann, J. W. Uhr and E. S. Vitetta (2001). The toxicity of deglycosylated ricin A chain-containing immunotoxins in patients with non-Hodgkin's lymphoma exacerbated by prior radiotherapy: a retrospective analysis of patients in five clinical trials. Clin Cancer Res 7(2): 255-258. Schnell, R., P. Borchmann, J. O. Staak, J. Schindler, V. Ghetie, E. S. Vitetta and A. Engert (2003). Clinical evaluation of ricin A-chain immunotoxins in patients with Hodgkin's lymphoma. Ann Oncol 14(5): 729-736. [0183] Schnell, R., O. Staak, P. Borchmann, C. Schwartz, B. Matthey, H. Hansen, J. Schindler, V. Ghetie, E. S. Vitetta, V. Diehl and A. Engert (2002). A Phase I study with an anti-CD30 ricin A-chain immunotoxin (Ki-4.dgA) in patients with refractory CD30+ Hodgkin's and non-Hodgkin's lymphoma. Clin Cancer Res 8(6): 1779-1786. Schnell, R., E. Vitetta, J. Schindler, S. Barth, U. Winkler, P. Borchmann, M. L. Hansmann, V. Diehl, V. Ghetie and A. Engert (199E). Clinical trials with an anti-CD25 ricin A-chain experimental and immunotoxin (RFT5-SMPT-dgA) in Hodgkin's lymphoma. Leuk Lymphoma 30(5-6): 525-537. [0184] Schnell, R., E. Vitetta, J. Schindler, P. Borchmann, S. Barth, V. Ghetie, K. Hell, S. Drillich, V. Diehl and A. Engert (2000). Treatment of refractory Hodgkin's lymphoma patients with an anti-CD25 ricin A-chain immunotoxin. Leukemia 14(1): 129-135. Stone, M. J., E. A. Sausville, J. W. Fay, D. Headlee, R. H. Collins, W. D. Figg, M. Stetler-Stevenson, V. Jain, E. S. Jaffe, D. Solomon, R. M. Lush, A. Senderowicz, V. Ghetie, J. Schindler, J. W. Uhr and E. S. Vitetta (1996). A phase I study of bolus versus continuous infusion of the anti-CD19 immunotoxin, IgG-HD37-dgA, in patients with B-cell lymphoma. Blood 88(4): 1188-1197. Vitetta, E. S. et al. (1991). Phase I immunotoxin trial in patients with B-cell lymphoma. Cancer Res 51(15): 4052-4058.

    Example 4Development of an Improved Immunotoxin Formulation

    [0185] T-Guard is being developed for the treatment of GVHD. T-Guard is a combination product which consists of two antibodies (SPV-T3a and WT1). The monoclonal antibody SPV-T3a is targeted against CD-3 whereas WT-1 targets CD-7 protein. Both are individually coupled to a Ricin Toxin A chain (RTA), which serves as a toxic load upon binding of the target cell. Antibody Drug Conjugates (ADCs) may be formulated as separate infusion concentrates (SPV-T3a-RTA and WT1-RTA) to be mixed just before administration. For example, 4 mL of each formulation (1/1 ratio) may be diluted together in 1 vial up to 100 mL with diluent.

    [0186] Both antibodies (SPV-T3a and WT1) show physical stability problems in the formulation buffer (13 mM sodium phosphate buffer pH 7.5, 140 mM NaCl and 0.05%, (v/v) Tween-20). This formulation buffer corresponds to a PBS buffer supplemented with Tween-20. SPV-T3a-RTA is stable for 2.5 years at 2-8 C. in that formulation buffer, but shows aggregate formation upon freeze/thaw stress. WT1-RTA is not stable at 5-8 C. in that formulation buffer and is kept stable at 20 C. for 2.5 years. After 3 years of storage the product does not meet the specifications concerning biological activity and particle formation, as detected with DLS.

    [0187] The present inventors wished to obtain a formulation which would increase the physical stability of both monoclonal antibodies (MAbs) for a longer shelf life.

    [0188] Methods

    [0189] Protein Content Analysis

    [0190] A common application of spectrophotometry is the measurement of light absorption in the UV region of the spectrum, in order to quantify the protein concentration in a sample. Several amino acids usually found in proteins, such as tryptophan and tyrosine, absorb light in the 280 nm range. The absorption of a protein solution depends on the content of the amino acid sequence and the protein concentration. Using the mass extinction coefficient of a protein (s), the concentration in a solution can be calculated from its absorbance (A), according to Lambert-Beer's law:

    A=*c*l where:
    A=absorbance
    =mass extinction coefficient in cm.sup.1*(mg L).sup.1
    c=concentration in mg/mL
    l=path length in cm

    [0191] As buffer components and salts may also absorb light at this wavelength, the spectrophotometer should always be blanked with the formulation buffer. The formulation buffer should also be used for the dilution of the sample(s). Measurements are performed on a UV-1800 Spectrophotometer (Shimadzu) using disposable cuvettes.

    [0192] SDS-PAGE

    [0193] SDS-PAGE separates proteins in a polyacrylamide matrix according to their electrophoretic mobility. Binding of SDS masks the intrinsic charge of proteins and results in an even distribution of charge to mass units. During gel electrophoresis, SDS-treated proteins will therefore migrate as a function of their approximate size. In addition, existing non-covalent aggregates will dissociate in the presence of SDS.

    [0194] According to the application, samples can either be run under non-reducing or reducing conditions. Addition of a reducing agent (e.g. dithiothreitol (DTT)) causes the disruption of internal disulphide bonds in the protein and can be used to discriminate between proteins with an intact protein backbone and nicked proteins held together by these disulfide bridges.

    [0195] Samples are analyzed on a Novex 4-126 Bis/Tris gel. In case the electrophoresis was performed under reducing conditions, NuPage reducing agent was added to the samples and antioxidant agent (Invitrogen) to the electrophoresis buffer. In order to prevent differences in band height or band broadening, equivalent volumes of the samples were loaded. The electrophoresis was run with MOPS-SDS running buffer. After incubation in the fixation solution, proteins were stained with CBBR250-solution and destained. Gels were scanned using proprietary scanning software (ImageQuant, GE).

    [0196] SE-UPLC Analysis

    [0197] SE-UPLC allows determination of the molecular size distribution and the relative amounts of intact, monomeric antibody and potential (protein-related) impurities and variants. The primary goal of SE-UPLC is to detect irreversible soluble protein oligomerization and aggregation as well as smaller protein fragments generated by protein hydrolysis. During the method development a column and mobile phase are selected which give minimal interaction of the protein with the solid phase to prevent sticking of the protein or its multimeric forms to the column while at the same time giving a good recovery. The components should be separated solely by their MW. Proteins are detected by UV absorbance at 280 nm and the relative amount of a specific protein impurity (expressed as relative surface area (5) is calculated by dividing the surface area of its peak by the total surface area.

    [0198] Experiments are performed on an UPLC H-Class bio instrument (Waters) with a detection at 220 nm or 280 nm. The system is equipped with a bio-inert flow path a stainless steel, specifically for biomolecules.

    [0199] Particle Size Analysis (DLS)

    [0200] When a beam of light passes through a colloidal dispersion, the particles or droplets scatter some of the light in all directions. When the particles are very small compared with the wavelength of the light, the intensity of the scattered light is uniform in all directions (Rayleigh scattering); for larger particles (above approximately 250 nm diameter), the intensity is angle dependent (Mie scattering).

    [0201] Using coherent laser light it is possible to observe time-dependent fluctuations in the scattered intensity using a photomultiplier detector. These fluctuations arise from the fact that the particles are small enough to undergo random thermal (Brownian) motion and the distance between them is therefore constantly varying. Analysis of the time dependence of the intensity fluctuation can therefore yield the diffusion coefficient of the particles from which, via the Stokes Einstein equation, knowing the viscosity of the medium, the hydrodynamic radius or diameter of the particles can be calculated.

    [0202] DLS measurements were performed on a Zetasizer NanoZS (Malvern) in disposable low volume UVCuvettes (PlastiBrand). Typical measurements were performed in 70 L at 25 C. where the sample was equilibrated to the temperature during 3 minutes prior to the actual measurement. Measurement duration and laser intensity was chosen automatically by the instrument based on the scattering signal of the sample. All measurements were analysed using the Zetasiser Software (version 7.02).

    [0203] Buffer Exchange

    [0204] To allow a fast screening of multiple buffers the buffer exchange was performed with 2 mL Zeba Spin Desalting columns (MWCC=7 kDa, Pierce). These columns contain a size exclusion resin and can be used for diluted or concentrated samples, allowing a good protein recovery. The columns were always used with sample sizes of 700 L material.

    [0205] PEG Screening

    [0206] A PEG-6000 based screen was used to perform a primary formulation screen. Since it is known that the ADC's are susceptible to aggregation, solubility is one of the major stability parameters. The buffer type and pH will influence the solubility and therefore 12 different buffers were prepared to screen for an optimal solubility of the MAb's.

    [0207] The conditions tested were: [0208] Histidine buffer pH 5.5, 6.0 and 6.5 [0209] Phosphate buffer pH 7.0, 7.5 and 7.5 [0210] Citrate buffer pH 5.5, 6.0 and 6.5 [0211] Acetate buffer pH 4.0, 4.5 and 5.0 [0212] D-PBS (as reference)

    [0213] 50 mM solutions were prepared from each buffer as well as buffer solutions containing 40% (w/v) PEG-6000. The latter was made by weighing 12 g PEG-6000 and adding concentrated buffer solutions and MQ water up to 30 mL in order to obtain a 50 mM solution with 40% (w/v) PEG-6000. The stock solution was diluted further with buffer or protein to a final concentration of 4-20% (w/v) PEG-6000.

    [0214] The original material was concentrated using a concentrator (Amicon ultra 15, 10 kDa MWCO) to approximately concentration of 0.40 mg/mL. Concentrations are determined using UV absorbance measurements. The material was diluted 2-fold in the plate in a total volume of 100 L and after 1 day incubation at 5C the plate was measured. The readout was performed on a Envision (Perkin Elmer) with an OD filter of 405 nm.

    [0215] Summary of Results

    [0216] Out of the different experiments the following overviews (Table 2 and Table 3) are made, giving an overview of the different experiments. Both overviews show a preference for a citrate buffer pH 6.5 as compared to a phosphate buffer pH 7.5. Phosphate buffers Give rise to more aggregation events as compared to citrate buffers. This is confirmed by SE-UPLC, SDS-PAGE and DLS. Differences for the excipients are observed for the citrate buffers. In this case, a higher recovery and better stability is seen for arginine as excipient. This excipient showed resistance to freeze/thaw stress and a lower amount of high molecular weight (HMW) variants at temperatures up to 25 C. At 40 C. there was also a high amount of aggregates observed. The same conclusion could be made for both antibodies and confirmation of the results was obtained by SDS-PAGE.

    TABLE-US-00008 TABLE 2 F/T Stab 5 C. Stab 25 C. Stab 40 C. HMW Agg DLS HMW Agg HMW Agg HMW Agg Phosphate Sucrose ++ ++ ++ + Arginine ++ ++ ++ ++ ++ ++ ++ Mannitol ++ + ++ ++ ++ + + Trehalose ++ ++ ++ + + + + NaCl ++ + ++ ++ ++ ++ Citrate Sucrose ++ ++ ++ ++ + ++ + + + Arginine ++ ++ ++ ++ ++ ++ ++ ++ Mannitol ++ ++ ++ ++ + ++ + + + trehalose ++ ++ ++ ++ + ++ + + + overview of the different results for WT1-RTA from the freeze/thaw analysis and short term storage study. The different buffers (phosphate and citrate) as well as the excipients are given and results are evaluated as good (++), intermediate (+) or not preferred (). The SE-UPLC results are given as HMW and agg (area under the curve). F/T = freeze/thaw; Stab = stability; HMW = high molecular weight variants; Agg = aggregates.

    TABLE-US-00009 TABLE 3 F/T Stab 5 C. Stab 25 C. Stab 40 C. HMW Agg DLS HMW Agg HMW Agg HMW Agg Phosphate Sucrose ++ ++ ++ ++ + Arginine ++ ++ ++ ++ ++ ++ Mannitol ++ ++ ++ ++ ++ + + Trehalose ++ ++ ++ ++ + + + + NaCl ++ ++ ++ ++ ++ Citrate Sucrose ++ ++ ++ ++ + ++ + + + Arginine ++ ++ ++ ++ ++ ++ ++ Mannitol ++ ++ ++ ++ + ++ + + + trehalose ++ ++ ++ ++ + ++ + + + overview of the different results for SPV-T3a-RTA from the freeze/thaw analysis and short term storage study. The different buffers (phosphate and citrate) as well as the excipients are given and results are evaluated as good (++), intermediate (+) or not preferred (). The SE-UPLC results are given as HMW and agg (area under the curve). F/T = freeze/thaw; Stab = stability; HMW = high molecular weight variants; Agg = aggregates.

    [0217] The formulation that was selected on the basis of the above results for WT1-RTA and SPV-T3a-RTA was: 10 mM citrate (pH 6.5), 155 mM L-Arginine.HCl and 0.05% (w/v) Tween-20. The recipe for this formulation is as follows:

    [0218] Component Amount

    [0219] Citric acid*0.11 g

    [0220] Sodium Citrate*2.79 g

    [0221] L-Arginine.HCl 32.70 g

    [0222] Tween-20 0.5 g

    [0223] H.sub.2O Add up to 1000 mL

    [0224] *correct pH to 6.5 using NaOH solution

    Example 5Development of a Still-Further Improved Immunotoxin Formulation

    [0225] The present inventors sought to improve the stability of the T-Guard formulation still further. In the above-mentioned formulation (10 mM citrate (pH 6.5), 155 mM L-Arginine.HCl and 0.05 (w/v) Tween-20), both SPV-T3a-RTA and WT1-RTA were found to be stable at 60 C., 20 C. and 5 C. for up to 9 months. However, stability at 25 C. was found to be sub-optimal owing to the formation of aggregates. The aim of presently-described study was to develop a more stable formulation based on accelerated stability studies.

    [0226] Heat Stress Study

    [0227] To characterize both compounds (WT1-RTA and SPV-T3a-RTA), 6 different analysis techniques were used: [0228] SEC [0229] SDS-PAGE [0230] Aggregation point [0231] DLS [0232] pH [0233] Osmolality

    TABLE-US-00010 TABLE 4 Overview of heat stress study Sample Temperature Time point SPV-T3a-RTA 5 C. T = 0 40 C. T = 2 days 40 C. T = 4 days WT1-RTA 5 C. T = 0 40 C. T = 2 days 40 C. T = 4 days

    [0234] Since no information was available on the aggregation mechanism of the antibodies, a broad range of excipients were taken into account for the screening: reducing agents, solubilizing agents, antioxidants, amino acids and sugars.

    [0235] The effect of each combination of excipients is summarised below for each antibody.

    TABLE-US-00011 TABLE 5 Effect of the excipients on SPV-T3a-RTA Agent Effect 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.2 mM N-Acetylcysteine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.5 mg/ml poly (ethyleneimine) 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.5 mg/ml poly (ethyleneimine); 0.25 mg/ml EDTA disodium salt 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; = 0.5 mg/ml poly (ethyleneimine); 10 mM sodium benzoate 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.2 mM monothioglycerol 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.25 mg/ml vitamin E TPGS 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 1 mM 2-2-dithiodipyridine 10 mM citrate; 100 mM L-arginine; 0.05% Tween 20; 0.5% Glycerin 10 mM citrate; 50 mM L-arginine; 0.05% Tween 20 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 12 mM glutamate 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 50 mM glycine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 1 mM methionine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 50 mM betaine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 20 mM sorbitol 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 20 mM trehalose

    TABLE-US-00012 TABLE 6 Effect of the excipients on WT1-RTA Agent Effect 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.2 mM N-Acetylcysteine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.5 mg/ml poly (ethyleneimine) 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.5 mg/ml poly (ethyleneimine); 0.25 mg/ml EDTA disodium salt 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.5 mg/ml poly (ethyleneimine); 10 mM sodium benzoate 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.2 mM monothioglycerol 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 0.25 mg/ml vitamin E TPGS 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 1 mM 2-2-dithiodipyridine 10 mM citrate; 100 mM L-arginine; 0.05% Tween 20; 0.5% Glycerin 10 mM citrate; 50 mM L-arginine; 0.05% Tween 20 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 12 mM glutamate 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 50 mM glycine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 1 mM methionine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; 50 mM betaine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 20 mM sorbitol 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 20 mM trehalose

    [0236] Addition of 12 mM glutamate and 50 mM glycine have a positive effect on the stability of SPV-T3aRTA, while addition of 50 mM glycine, 20 mM sorbitol and 20 mM trehalose have a positive effect on the stability of WT1-RTA.

    [0237] A new formulation study was carried out in order to: [0238] confirm the positive effect observed with glycine, sorbitol and trehalose [0239] test additional combinations of the existent excipients (e.g. higher glycine concentration) [0240] new excipients (e.g. other sugars)

    [0241] The target for osmolality of the formulation buffers was between 300 and 450 mOsm/kg.

    [0242] Accordingly, an additional excipient screen was set-up with formulation buffers which had a positive effect on both compounds in the above-described study, new combinations with the tested excipients, formulation buffers with higher concentrations of the excipients and formulation buffers with other sugars.

    [0243] Accelerated stability testing was carried out according to the following overview.

    TABLE-US-00013 TABLE 7 Overview of accelerated stability study Incubation Time point Time point temperature 2 days 2 months 20 C. 5 C. T = 0 5 C. 40 C. T = 2 days 25 C. 40 C. T = 4 days 37 C. 5 C. T = 0

    TABLE-US-00014 TABLE 8 Effect of the excipients on the stability of SPV-T3a-RTA Agent Effect 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; = 50 mM glycine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; = 12 mM glutamate 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 75 mM glycine, 50 mM glutamate 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 100 mM glycine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 50 mM glycine; 50 mM sorbitol 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; + + 125 mM trehalose; 50 mM glycine 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; + + 125 mM maltose; 50 mM glycine 10 mM citrate; 120 mM L-arginine; 0.05% Tween 20; + + 100 mM mannitol; 50 mM glycine 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; + + 140 mM maltose 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; 40 mM maltose; 100 mM glycine

    TABLE-US-00015 TABLE 9 Effect of the excipients on the stability of WT1-RTA Agent Effect 10 mM citrate.; 150 mM L-arginine; 0.05% Tween 20; + 50 mM glycine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + + 100 mM glycine 10 mM citrate; 150 mM L-arginine; 0.05% Tween 20; + 50 mM glycine; 50 mM sorbitol 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; + + 125 mM trehalose; 50 mM glycine 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; + + 125 mM maltose; 50 mM glycine 10 mM citrate; 120 mM L-arginine; 0.05% Tween 20; ++ 100 mM mannitol; 50 mM glycine 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; + + 140 mM maltose 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; 40 mM maltose; 100 mM glycine

    [0244] 4 of the tested formulations have a positive effect on the stability of both compounds (SPV-T3a-RTA and WT1-RTA): [0245] 1. 10 mM citrate, 125 mM L-arginine; 0.05% Tween 20; 125 mM trehalose; 50 mM glycine [0246] 2. 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; 125 mM maltose; 50 mM glycine [0247] 3. 10 mM citrate; 120 mM L-arginine; 0.05% Tween 20; 100 mM mannitol; 50 mM glycine [0248] 4. 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; 140 mM maltose

    [0249] Further stability testing was then carried out on the following formulation: 10 mM citrate; 125 mM L-arginine; 0.05% Tween 20; 140 mM maltose (adjusted to pH 6.5 with 37% HCl).

    [0250] 2 days incubation at 40 C. in the new formulation buffer resulted in approximately 23% more SPV-T3a-RTA monomer and approximately 13% more WT1-RTA monomer compared to incubations in the previous formulation buffer. Also a decrease of insoluble aggregates was observed (see Tables 10 and 11).

    TABLE-US-00016 TABLE 10 WT1-RTA protein distribution after 2 days at 40 C. in the previous and new formulation buffer Soluble Insoluble Monomer aggregates aggregates Formulation (%) (%) (%) 10 mM citrate, 150 mM L-ArgHCl, 61.5 24.9 13.7 0.05% (w/v) Tween-20 (pH 6.5) 10 mM citrate, 125 mM L-ArgHCl, 74.0 22.9 3.1 0.05% (w/v) Tween-20, 140 mM Maltose (pH 6.5)

    TABLE-US-00017 TABLE 11 SPV-T3a-RTA protein distribution after 2 days at 40 C. in the previous and new formulation buffer Soluble Insoluble Monomer aggregates aggregates Formulation (%) (%) (%) 10 mM citrate, 150 mM L-ArgHCl, 44.9 15.9 39.1 0.05% (w/v) Tween-20 (pH 6.5) 10 mM citrate, 125 mM L-ArgHCl, 67.9 28.1 4.0 0.05% (w/v) Tween-20, 140 mM Maltose (pH 6.5)

    [0251] The aggregation point analysis showed that SPV-T3a-RTA (Tagg=51 C.) and WT1-RTA (Tagg=52 C.) are more stable in the new formulation buffer compared to the previous formulation buffer (Tagg=42 C. and 15 C. for SPV-T3a-RTA and WT1-RTA, respectively).

    Example 6Modification of the Monoclonal Antibody-RTA Conjugation Process

    [0252] The above-described studies (Examples 4 and 5) resulted in a formulation that supports a very good stability profile of both conjugates. Consequently, development work continued to explore how far upstream this preferred formulation buffer could be used in the production and purification process.

    [0253] The inventors aimed to reduce precipitation and resulting product loss. Yield of the Blue Sepharose column step (removal of unconjugated free antibody) is poor and the fraction that is recovered suffers from aggregation. A substantial fraction precipitates on the column and is lost.

    [0254] The inventors also aimed to refine loading and elution conditions for Blue Sepharose affinity chromatography to achieve robust, complete separation of mAb and mAb-RTA conjugate.

    [0255] Finally, the inventors sought to employ the favorable formulation buffer further upstream, up to and including the conjugation step, to prevent precipitation in this earlier phase too.

    [0256] The change in the production process is depicted in FIGS. 9 and 10. FIG. 9 shows process A, in which the conjugation and purification steps above the central horizontal line are performed in the 25 mM phosphate buffer at pH 7.5; steps below the horizontal line are performed in the 10 mM citrate buffer at pH 6.5. FIG. 10 shows process B, which differs from process A in that the change to the 10 mM citrate buffer occurs further upstream at the point shown by the upper horizontal line. Steps below that upper horizontal line are performed in the 10 mM citrate buffer at pH 6.5.

    [0257] Upon changing to process B, it was found that: [0258] The antibody conjugation reaction is robust and is compatible with the formulation buffer (10 mM citrate, 125 mM L-Arg.HCl, 0.05% (w Tween-20, 140 mM Maltose (pH 6.5)). [0259] Implementation is simple by changing running buffer on G25 [0260] Blue Sepharose binding can be subtly altered by changing L-Arginine concentration. Elution can be achieved by increasing the L-arginine concentration. [0261] In 125 mM L-Arginine no non-conjugated mAb binds, only minor portion of mAb-RTA.sub.1 is unbound in flow-through. Optimal selective conditions for equilibration, binding and washing can be determined within the range of 75-125 mM, such as 100-125 mM, L-Arginine. [0262] Elution steps show that mAb-RTA.sub.1, mAb-RTA.sub.2 and mAb-RTA.sub.3 could be separated. Binding becomes stronger with higher degree of conjugation. [0263] Process B is amenable to optimization to balance yield and purity. Also drug-antibody variants could be selectively enriched. [0264] The elution pool after Blue Sepharose was found to have reduced turbidity or precipitation.

    Example 7Phase I/II Trial of a Combination of Anti-CD3/CD7 Immunotoxins for Steroid-Refractory Acute Graft-Versus-Host Disease

    Introduction

    [0265] Acute graft-versus-host disease (aGvHD) is a major complication that can occur following allogenic hematopoietic stem cell transplantation (HSCT). The prognosis among patients who develop aGvHD is poor, particularly in cases of severe steroid-refractory aGvHD (SR-aGvHD) with gastrointestinal (GI) and/or liver involvement..sup.1,2 At present, no standard second-line therapy is approved for SR-aGvHD, and none of the available treatment options seems to provide convincingly superior results with on average only 30% complete responders..sup.1, 3, 4 Six-month survival approximates 50%, but long-term survival is achieved in 1 out of 5 patients..sup.2

    [0266] The underlying core of a graft-versus-host immune reaction is the proliferation and differentiation of alloreactive donor T-cells in response to the host's antigen-presenting cells, which induce tissue damage and the propagation of inflammation during the effector phase..sup.5-7 Therefore, many of the currently used therapies consist of antibodies that cause the depletion of T-cells or either biologicals or small molecule inhibitors designed to suppress T-cell function..sup.1,3,6,8 The obvious challenge of such approaches is that the induced immunosuppression should be as selective and as brief as possible, to avoid infectious complications and relapse of the underlying hematological malignancy, which could otherwise counterbalance the immediate benefit of controlling the acute GvHD reaction..sup.9-12

    [0267] As a novel approach to achieve this goal, we developed a combination of two anti-T-cell immunotoxins designed to induce a synergistic in-vivo depletion and suppression of T-cells while allowing for a rapid post-treatment reconstitution of the immune system..sup.13,14 This combination product consists of a 1:1 mixture of two murine monoclonal antibodies against CD3 and CD7, each of which is separately conjugated to a recombinant ricin toxin A chain.sup.15 (I-Guard), hereafter abbreviated as CD3/CD7-IT)..sup.16,17 Preclinical studies showed that CD3/CD7-IT induces apoptosis of both T-cellsparticularly activated T- and NK-cells by inhibiting protein synthesis, and reduces T-cell activation by blocking and modulation of the TCR/CD3 complex (FIG. 12)..sup.17 In a dose-escalation study, 5 out of seven patients with SR-aGvHD, responded to CD3/CD7-IT as third-line therapy..sup.17 The promising outcome of that study led to the phase I/II study of CD3/CD7-IT for treatment of SR-aGVHD reported here.

    [0268] Methods

    [0269] This prospective single arm phase I/II study was approved by the ethics committees and institutional review boards at the Radboud University Medical Center Nijmegen (the Netherlands) and the University Medical Center Muenster (Germany). Informed consent was obtained from all patients.

    [0270] The 4 mg/m.sup.2 T-Guard starting dose of the phase I/II study was selected on basis of the outcome of the dose escalation study..sup.17 A Bryant-Day 2-stage design was applied.sup.18, with a pre-scheduled interim analysis after 8 patients, to protect patients from unnecessary exposure to an ineffective or toxic treatment. If after the first 8 patients 2 or fewer (25%) day 28 responders and/or 4 or more (50%) dose limiting toxicities (adverse drug reactions of grade 3 or higher) would be observed (phase I), the trial would have been terminated for futility and/or toxicity. Otherwise, the trial should be extended to a total of 20 patients (phase II) (sample size estimation: S2).

    [0271] Adult (18 years) patients who developed grade II to IV aGvHD following HSCT or following post-transplant donor lymphocyte infusion.sup.19 were eligible for participation; aGvHD grade was defined according to the criteria established by Harris et al..sup.20 Diagnosis of aGvHD was confirmed with a tissue biopsy. SR-aGvHD was defined as aGvHD that progressed after 3 days or did not improve after 7 days on systemic corticosteroids (2 mg/kg/day prednisolone or equivalent)..sup.3, 4 Patients who had already received additional therapeutics for SR-aGvHD were excluded, as were patients with manifestations of moderate or severe chronic GvHD (cGvHD), severe organ dysfunction, uncontrolled infection, serum creatinine levels >266 mol/L (1.87 mg/dL), and/or serum albumin levels 1.5 g/dL.

    [0272] The treatment schedule of CD3/CD7-IT (S3) consisted of four 4-hour intravenous (i.v.) infusions of 4 mg/m administered at 48-hour intervals. GvHD prophylaxis, which consisted primarily of cyclosporine-A either alone or in combination with mycophenolate mofetil, was continued during therapy with CD3/CD7-IT. The recommended taper for systemic corticosteroids in patients responding to T-Guard was 10% (of the starting dose) at 3-5 days intervals. After study Day 28, the rate of steroid tapering was left to local protocols. The use of antimicrobial prophylaxis, pre-emptive and/or empirical treatment for infection, and clemastine pretreatment (2 mg i.v.) was left to the discretion of the physician and established local protocols.

    [0273] Patients were included in the analysis regarding toxicity and efficacy if they received at least one dose of CD3/CD7-IT. The primary endpoints were the overall response rate (ORR, defined as the sum of PR and CR rates) on day 28 and the occurrence of possible drug-related AEs up to 6 months following treatment with CD3/CD7-IT. The secondary endpoints were the day 28 CR rate, 6-month overall survival (OS), and the incidence of cGvHD. ORR, CR on day 28, and 6-month CS were compared to results obtained with our institutions' historical controls who received either inolimomab-etanercept (N=21) or infliximab (N=21)..sup.21 CR was defined as the resolution of all signs and symptoms associated with aGvHD. PR was defined as an improvement in GvHD stage in all initial GvHD target organs, without complete resolution or emergence of GvHD in any new organ. No response (NR) was defined as either no change, a mixed response, progressive disease, or the need for salvage therapy before day 28..sup.22 The 2014 NIH diagnostic criteria were used to assess and score cGvHD..sup.23 Hematological and non-hematological AEs, including cytokine release syndrome (CRS), were graded based on the Common Terminology Criteria for AEs (CTCAE 4.0). Capillary leak syndrome (CLS) was graded as follows using the criteria defined earlier.sup.24: grade 1, asymptomatic, not requiring therapy; grade 2, symptomatic, but not requiring fluid support; grade 3, respiratory compromise or requiring fluids; grade 4, life threatening, requiring vasopressor support and/or mechanical ventilation. In the event of a grade 3 AE, subsequent doses with CD3/CD7-IT were only to be given if the patient's toxicity parameters improved or when judged to be in the patient's interest, at the investigator's discretion. Invasive fungal disease (IFD), EEV- and CMV infection were defined in accordance with established guidelines..sup.25-27

    [0274] Manufacturing of CD3/CD7-IT

    [0275] CD3/CD7-IT consists of the murine monoclonal antibodies SPV-T3a (anti-CD3) and WT1 (anti-CD7), each of which is conjugated to recombinant RTA. CD3/CD7-IT was manufactured using Good Manufacturing Practices as described previously.sup.15, with the addition of a step to block residual linkers with cysteine and the replacement of deglycosylated plant-derived RTA with recombinant RTA..sup.17, 28 The immunotoxins were formulated at a concentration of 0.2 mg/ml in an isotonic buffered solution, pH6.5, and stored frozen (at 20 C. or below).

    [0276] In-Vitro Laboratory Analyses

    [0277] Peripheral blood samples were collected before and after treatment to analyze predictive GvHD biomarkers, cytokine levels, immune reconstitution, pharmacokinetics, and the development of human anti-drug antibodies (ADRs).

    [0278] Levels of the biomarkers ST2 (suppression of tumorigenicity 2) and Reg3 (regenerating islet-derived protein 3-alpha) were measured at the Icahn School of Medicine at Mount Sinai, N.Y. A probability score, p{circumflex over ()} was determined for each patient based on a validated algorithm.sup.29 used to predict the risk for treatment failure and non-relapse mortality among patients with aGvHD. Patients are at high-risk when the p{circumflex over ()} is >0.291 after one weekthree days of treatment with systemic corticosteroids.

    [0279] Serum cytokine levels were measured at Myriad RBM (Austin, Tex.) using quantitative, multiplexed immunoassays.

    [0280] Lymphocytes were analyzed by immunophenotyping using flow cytometry. Lymphocytes were gated on CD45+ and side scatter low cells and enumeration of helper T-cells (CD5+ and CD4+), cytotoxic T-cells (CD5+ and CD8+), NK cells (CD56+ and CD5), and B cells (CD19+) was recorded for each phenotype per microliter of blood. CD5 was used instead of CD3 to identify and quantify I-cells because of potential CD3 modulation by the CD3/CD7-IT treatment. For TCR sequencing, DNA was isolated from whole blood collected in PAXgene tubes. The TCR CDR3 region was then amplified and sequenced using ImmunoSEQ (Adaptive Biotechnologies, Seattle). Bias-controlled V and J gene primers were used to amplify the rearranged V(D)J segments for high-throughput sequencing (HTS) analysis at approximately 20 coverage..sup.30 After correcting for sequencing errors using a clustering algorithm CDR3 segments were annotated using the International ImMunoGeneTics information system, thereby identifying which V, D, and J genes contributed to each rearrangement..sup.31 The absolute numbers of EBV-associated and CMV-associated T-cells were determined by comparing the patients' TCR data with TCR sequences reported to be specific for EBV and CMV antigens..sup.37

    [0281] The serum concentrations of SPV-T3a-RTA and WT1-RTA, as well as the presence of ADAs against either of these immunotoxins, were measured at Celonic AG (Basel, Switzerland) using validated bioluminescence assays. Pharmacokinetics analyses were performed as described previously..sup.17

    [0282] Statistical Analysis

    [0283] Patient characteristics were analyzed using descriptive statistics. The estimated aGvHD response rates along with the 95% Clopper-Pearson exact confidence interval (CI) are presented. Toxicity was analyzed by tabulating the incidence of AEs and/or infections with a CTCAE grade2. Kaplan-Meier curves were used to analyze overall survival. The Chi-square test was used to compare the ORR and the complete and partial rates of remission on day 28 due to CD3/CD7-IT, with the corresponding results obtained from institutional historical controls who received either inolimomab-etanercept (N=21) or infliximab (N=21)..sup.21 The 6-month OS rate was compared using the log-rank test.

    [0284] With regards to the immuno-reconstitution within-patient differences were analyzed between the pre-treatment, 1-month, 3-month, and 6-month samples using the Wilcoxon matched-paired signed rank test. A two-sided p-value <0.05 was considered statistically significant. Expanded and enriched T-cell clones were identified using differential abundance analysis as described by DeWitt et al..sup.33 A given clone was determined to be significantly expanded or contracted in two samples based on its proportion in each repertoire or timepoint and was analyzed using Fisher's exact test with Benjamini-Hochberg correction at the 5% level.

    [0285] Results

    [0286] Patient and GvHD Characteristics

    [0287] Twenty patients were enrolled in the study from June 2014 through September 2016. The patient, donor and GvHD characteristics are presented in Table 1. At the time of enrollment, 3 patients (15%) had grade II aGvHD, and 17 had grade III or IV aGvHD (85%). In 16 patients (80%), two organs were involved; the GI tract and liver were involved in 18 (90%) and 5 (25%) cases, respectively. Baseline albumin levels were low, particularly in the patients with GI-GvHD (median: 2.3 g/dL; range: 1.6-3.4 g/dL; normal range: 3.5-5.0 g/dL). A validated algorithm using serum concentration of ST2 and Reg3 demonstrated significant risk for all patients with a mean p{circumflex over ()} of 0.345; the majority of patients (11/20) were classified as high-risk for treatment failure and NRM..sup.29 Treatment with CD3/CD7-IT was initiated after a median interval of 8 days (range: 5-16 days) after the initial corticosteroid treatment and median 48 days after transplantation (range: 26-308 days).

    [0288] GvHD Response and Patient Outcome

    [0289] The median follow-up period after therapy with CD3/CD7-IT was 292 days (range: 3-889 days). Two patients died due to progressive SR-aGvHD before completing the treatment schedule. The remaining 18 patients (90%) received all four scheduled doses at 48-hour intervals. On day 28, ORR was 60% (12/20 patients) with a 95% CI of 36-81%; 10 patients (50%; 95% CI:27-73%) achieved a CR (FIG. 13). In the 12 responding and surviving patients corticosteroids could be tapered according to protocol. ORR was 55% ( 6/11) in patients with a high-risk biomarker profile. At the 6-month time point, 12 patients had survived after response on the CD3/CD7-IT combination, corresponding to an OS rate of 60% (95% CI:36-78%) (FIG. 13); survival was 64% ( 7/11) for patients with a high-risk biomarker profile. The cause of death for the 8 patients who died during the trial was refractory aGvHD (4 patients), refractory GvHD with infection (3 patients), and pseudomembranous colitis (1 patient). The outcomes achieved with CD3/CD7-IT were favorable compared to the outcomes reported for the cohort of 42 patients that were included immediately adjacent to the start of the trial. Specifically, the CR rate was 50% versus 19%, respectively (p=0.012), and the 6-month OS rate was 60% versus 29% (p=0.021). No clear differences could be found with regards to baseline characteristics predicting day 28 response or 6-month survival. To compensate for differences in aGVHD severity at treatment start, the above analysis was repeated following adjustment for overall aGVHD grading. After adjustment for aGVHD grade.sup.20, the CR and OS rates remained significant (p=0.032 and 0.034 respectively. At 24-month after treatment start, the study patients still showed an almost doubling in overall survival as compared to this historical control group (from 16.7 to 35%, p=0.47 and 0.09 respectively). Three of the 12 patients (25%) who survived to the 6-month time point developed cGVHD; for two patients the severity was reported to be mild, for one patient severe. Relapse was seen in three patients with AML, but all were patients with an adverse risk AML.

    [0290] Safety

    [0291] The Data and Safety Monitoring Board (DSMB) reviewed the pre-planned interim analysis of the first 8 patients, on basis of which they concluded that no major safety concerns had arisen and that the observed risk-benefit balance warranted continuation of the study. In general, CD3/CD7-IT was well tolerated and was found to be safe, with no SUSARs (suspected unexpected serious adverse reactions) or SAEs (serious AEs) related to the study-drug reported. Although no clinically significant infusion-related reactions were recorded, two patients who had not received pre-treatment experienced chills that resolved quickly after clemastine treatment (grade2 AE). Most of the patients had elevated levels of markers of macrophage activation/recruitment (MCP-1 and MIP-1), and this increase was most prominent after the first infusion; however, only the two aforementioned patients who experienced chills also had an increase in IL-6 levels..sup.34, 35 The remaining patients had no increase in IL-6, IL-8, IL-10, or IFN- concentrations, nor did they develop clinical signs corresponding to CRS.

    [0292] Several of the 20 patients developed a limited number of possible treatment-related AEs, including hypoalbuminemia, microangiopathy, and/or thrombocytopenia (Tablet). Hypoalbuminemia was present in all 20 patients at baseline (grade 2 or 3 in 80% of patients) and may have worsened in 8 patients due to treatment with CD3/CD7-IT. These 8 patients developed mild peripheral edema, which in all but one case could easily be managed with diuretics. One patient required treatment with an albumin infusion and diuretics for generalized edema and marked weight gain; this patient was therefore classified as having grade 2 CLS. Fifteen patients (75%) had a pre-existing low platelet count (grade 3 or 4 in 25% of cases), and thrombocytopenia either occurred or worsened in 14 patients (70%). Although various other causes may have contributed to the development of thrombocytopenia, the time course is at least suggestive of a possible relationship with CD3/CD7-IT in nine patients. Nevertheless, the thrombocytopenia was transient, did not result in a bleeding event, and rarely required platelet transfusion. Early EBV and CMV infections (within 3 months) were observed in 3 patients each (with two patients being positive for both EBV and CMV); however, no EBV or CMV disease occurred. Although only 40% of patients received mold-active antifungal prophylaxis, IFD was not observed in any of the patients. Nevertheless, as expected in this setting, the number of infections and AEs was relatively high. Two patients developed a Clostridium difficile infection, which resulted in one death due to pseudomembranous colitis. Moreover, although patients developed bacteremia (with enterococci, staphylococci, or Klebsiella oxytoca infection 2, 2, and 1 patient, respectively), this incidence rate (25%) was not higher than reported in historical controls..sup.21

    [0293] After treatment with CD3/CD7-IT, ADAs were detected against SPV-T3a-RTA and/or WT1-RTA in 10 out of 20 patients (50%); in four of these 10 patients, the titers were 20,000 at any given point. Nevertheless, no cases of serum sickness were reported. The emergence of ADAs was considered to be of little clinical relevance, as ADAs typically form after 9-10 days, whereas CD3/CD7-IT is currently developed as a one-week treatment option only, and its serum half-life is only 9 hours.

    [0294] Pharmacokinetics

    [0295] Pharmacokinetics analysis revealed that the mean serum half-life and C.sub.max (and SD) of CD3/CD7-IT were 8.593.04 h and 1231671 g/L, respectively, which is consistent with previously published data..sup.17

    [0296] Immune Reconstitution and Anti-Viral Immunity

    [0297] Consistent with its intended effect, treatment with CD3/CD7-IT led to a profound depletion of T-cells and NK-cells, with rapid recovery starting as early as the second week following treatment (FIG. 14A-B). Importantly, no significant effect could be observed on the absolute B cell count (FIG. 14C). No apparent patterns were seen in terms of treatment-induced changes in the relative proportions of nave, memory, effector and effector memory type of T-cells before and after treatment start (also no decrease or reversal of the CD4:CD8 ratio). In addition, the absolute count of regulatory T cells (Tregs) and the percentage of Tregs in the CD4 population showed normal variation and no obvious upward or downward trends could be observed at 28 days after treatment start or during the rest of the follow up period.

    [0298] HTS was performed on the CDR3 region of the TCR- genes in PBMCs before andwhen possible1, 3, and 6 months after treatment with CD3/CD7-IT. HTS can determine the total T-cell count, the diversity of the T-cell repertoire, and the sequences of the TCR CDR3 regions in all T-cells in a given sample. The T-cell diversity in a sample is characterized by the number of unique T-cell clones present in the sample, which is reflected by the number of unique CDR3 sequences identified using HTS. Prior to the start of treatment with CD3/CD7-IT, patients had low T-cell diversity that decreased further by month one, most probably due to a reduction in the absolute number of T-cells. T-cell diversity steadily rebounded by six months post-treatment with a diverse T-cell repertoire that included several new polyclonal T-cell populations (FIG. 14D-H).

    [0299] Next, we examined whether CD3/CD7-IT affects anti-virus T-cell clones. We therefore analyzed the development of EBV- and/or CMV-specific T-cell clones in patients following treatment with CD3/CD7-IT. Anti-viral T-cell clones were identified by screening for a validated list of 164 and 854 TCR sequences encoding receptors that recognize CMV- and EBV-specific antigens, respectively.

    [0300] Patients had positive serology in 95% and 40% and donors in 85% and 35%, for EBV and CMV, respectively. Infections occurred only in those patients with positive serology. FIG. 15A&C show the four patients who experienced an EBV and/or CMV infection after treatment with CD3/CD7-IT (two patients had EBV or CMV infection only and two patients had both EBV&CMV infections). All these patients demonstrated increased numbers of post-infection EBV- and CMV-associated clones, suggesting that the anti-viral T-cell response was not negatively affected by treatment with CD3/CD7-IT.

    [0301] Lastly, we ran a differential analysis of unique antiviral T-cell clones by performing pairwise comparisons between samples taken directly before treatment with CD3/CD7-IT and samples taken 1 and 3 months after treatment in patients who tested positive for a viral infection prior to the start of treatment. This analysis revealed that at the start of treatment, the EBV- and CMV-associated T-cell clones were distributed equally throughout the entire T-cell population in terms of clonal abundance; moreover, these clones did not expand or contract as a result of therapy with CD3/CD7-IT (FIG. 15B-D). Similar results were obtained when we analyzed samples from patients who had anti-viral T-cells at the start of treatment but did not develop a viral infection; our data (not shown) suggest that these patients may have acquired these anti-virus clones from a seropositive donor. Summarized, these results indicate that CD3/CD7-IT does not negatively affect the proportions of anti-EBV or anti-CMV T-cell clones, suggesting that this treatment does not appear to place these patients at a higher risk of acquiring an infection with these opportunistic viruses.

    [0302] Discussion

    [0303] Here we report the results of a multicenter phase I/II trial to study the in-vivo safety and efficacy of using CD3/CD7-IT therapy in patients with SR-aGvHD. Our results show that this CD3/CD7-IT has promising efficacy, with an ORR of 60% on day 28; specifically, 50% of our patients achieved a CR, and the 6-month OS rate was 60%. These results were better compared to the outcome reported for our institutional historical controls (FIG. 13) and are notable given the high-risk profile of the patients: 85% with severe SR-aGvHD, 90% GI involvement, and 55% had a high-risk biomarker profile. A pooled analysis of second-line therapies showed that only 32% of patients achieve complete remission with a corresponding 6-month survival rate of 49%..sup.1 In addition, our phase II results surely match those reported for other drugs currently under investigation for SR-aGVHD, including brentuximab vedotin and ruxolitinib, which have been shown to achieve CR in approximately 30% of patients..sup.36 Our study has several limitations that require acknowledgment. First, the sample size was relatively small and we did not include a randomized comparator arm. In addition, the study population was heterogeneous with respect to age, conditioning regimen, donor type, and GvHD prophylaxis regimens used. Nonetheless, the study population is representative of patients with SR-aGVHD treated at our institutions and consisted primarily of patients with underlying high-risk features.

    [0304] CD3/CD7-IT appeared safe. Despite the presence of the anti-CD3 mAb SFV-T3a, CD3/CD7-IT induced a mild infusion reaction in two patients both of whom had not received pre-infusion clemastine. In addition, we observed no toxicity related to CRS or rhabdomyolysis as can be seen with other RTA-based immunotoxins..sup.37,38 Investigators did consider hypoalbuminemia, microangiopathy, and thrombocytopenia as possibly related to CD3/CD7-IT. However, these events primarily consisted of worsening of pre-existing conditions. Investigators deemed these events more likely related to the underlying SR-GVHD and/or the concomitant use of a calcineurin inhibitor. Nevertheless, given the potential toxic effects of immunotoxins, it remains possible that CD3/CD7-IT may have contributed to these events and attention will need to be paid to this possibility in future studies.

    [0305] As expected for this clinical setting, infections were relatively common; however, the incidence of infection did not differ substantially from previous reports or from our institutional controls. The multifaceted immune defects due to the presenceand treatmentof GvHD itself, the disruption in the mucosal barrier due to GI-GvHD, and/or dysbiosis can explain the majority of these infections, particularly the Clostridium difficile infections and enterococcal bacteremia..sup.41 Although only half of our patients received mold-active antifungal prophylaxis, we observed no cases of IFD. More importantly, despite the profound depletion of I-cells and NK-cells, the incidence of EBV/CMV infections (15%) appeared to be relatively low,.sup.21,39 and no cases of post-transplant lymphoproliferative disorder or CMV disease occurred in our patients. This may be explained by the fact that virus-specific T-cells were relatively spared by the treatment and by the fact that immune reconstitution occurred within 6 months after starting treatment. In the second week of treatment, the T-cell and NK-cell counts began to rise, particularly in patients who achieved remission of their SR-aGvHD; at 3 months, these cell counts were similar to those normally seen following HSCT..sup.42 This increase in cell numbers was also accompanied by a simultaneous and significant increase in the diversity of T-cell clones. Thus, therapy with CD3/CD7-IT allows the patient's immune system to recover after remission is achieved, and the immune reconstitution after therapy seems favorable compared to other treatment modalities that rely on in-vivo T-cell depletion (for example anti-thymocyte globulins and alemtuzumab)..sup.42, 44

    [0306] Other immunotoxin-based treatments, such as H65-RTA (anti-CD5, ricin A chain) and denileukin diftitox (CD25, diphtheria toxin), have been clinically evaluated for treating aGvHD..sup.13,45 CD3/CD7-IT may offer advantages compared to these prior therapies. First, the combination targets multiple antigens on the same target cell, a strategy that tends to be more efficacious than using single immunotoxins..sup.46-53 In addition, CD3/CD7-IT has a clear preference for recently activated T-cells as well as the NK-cells that may play a role in the efferent phase of aGvHD..sup.17 Finally, CD3/CD7-IT has a dual mechanism of action in that the anti-CD3 mAb SPV-T3a provides added immunosuppression by binding to the CD3/TCR complex via a mechanism independent of RTA-induced cell killing (FIG. 12).sup.37.

    [0307] In summary, we report the results of a phase I/II study involving patients with high-risk SR-aGvHD, showing that CD3/CD7-IT provides a high rate of clinical remissions and rapid immune reconstitution following treatment. Based on these results, a phase III study is currently being designed in order to examine the potential value of including CD3/CD7-IT in the treatment of SR-aGvHD.

    TABLE-US-00018 TABLE 1 Patients characteristics and HSCT and GvHD features. N % Characteristics Number of patients 20 100 Age in years, median 53 NA (range) (18-74) Sex, M/F 9/11 45/55 Diagnosis Myeloid malignancy 15 75 Lymphoid malignancy 5 25 Donor MUD 13 65 MRD 5 25 MMUD 1 5 Haploid 1 5 Stem cell source PBSCs 19 95 BM 1 5 Disease risk index Low 0 0 Intermediate 5 25 High 15 75 Conditioning regimen.sup.a MAC 6 30 RIC 5 25 NMA 9 45 GvHD prophylaxis CyA 5 25 CyA/MTX 1 5 CyA/MMF (post-CyA) 13 65 (1) Acute GvHD Post-HSCT 19 95 Post-DLI 1 5 aGvHD grade at enrollment II 3 15 III 11 55 IV 6 30 Organ (s) involved Skin 15 75 Liver 5 25 Intestinal 18 90 2 organs involved 16 80 Biomarker score at start of CD3/CD7-IT High Risk p > 0.291 11 55 Time to aGvHD in days 40 NA median (range) (10-308) Time to treatment with 8 NA CD3/CD7-IT in days (5-16) median (range) .sup.b .sup.aConditioning regimen: NMA conditioning consisted of Flu-TBI; RIC regimen were Flu-Bus and Flu-Mel based; MAC regimen were Cyclo-TBI, Flu-Mel-TBI or FLAMSA based. .sup.b Relative to the initial corticosteroid treatment. Notes: aGvHD = acute graft-versus-host disease; BM = bone marrow; CyA = cyclosporin A; DLI = donor lymphocyte infusion; Haploid = haploidentical related donor; MAC = myeloablative conditioning; MMF = mycophenolate mofetil; MMUD = mismatched unrelated donor; MRD = matched related donor; MTX = methotrexate; MUD = matched unrelated donor; NA = not applicable; NMA = non-myeloablative conditioning; PhAT = Pharmacological Audit Trail; PBSCs = peripheral blood stem cells; RIC = reduced intensity conditioning. .sup.aRelative to the initial corticosteroid treatment.

    TABLE-US-00019 TABLE 2 Summary of adverse events potentially related to treatment. Grade 2.sup.a Grade 3 Grade 4 Anemia (1) .sup.b Thrombocytopenia (3) Thrombo- Abdominal pain (1) Neutropenia (1) cytopenia (5) Thrombocytopenia (1) Elevated bilirubin (2) Neutropenia (1) Myopathy (1) Microangiopathy (1) Microangiopathy (1) Chills (2) Hypoalbuminemia (1) Capillary leak syndrome (1) Hypoalbuminemia (1) .sup.aGrading of each AE is based on version 4.0 of the Common Terminology Criteria for AEs, with the exception of capillary leak syndrome, which was graded using the system described by Messmann et al..sup.24 .sup.b The numbers in parentheses refer to the number of patients who experienced the indicated adverse event.

    REFERENCES FOR EXAMPLE 7

    [0308] 1. Martin P J, Inamoto Y, Flowers M E, Carpenter P A. Secondary treatment of acute graft-versus-host disease: a critical review. Biol Blood Marrow Transplant. 2012; 18:982-988. [0309] 2. Calmettes C, Vigouroux S, Labopin M, et al. Risk Factors for Steroid-Refractory Acute Graft-versus-Host Disease after Allogeneic Stem Cell Transplantation from Matched Related or Unrelated Donors. Biol Blood Marrow Transplant. 2015; 21:860-865. [0310] 3. Martin P J, Rizzo J D, Wingard J R, et al. First- and second-line systemic treatment of acute graft-versus-host disease: recommendations of the American Society of Blood and Marrow Transplantation. Biol Blood Marrow Transplant. 2012; 18:1150-1163. [0311] 4. Deeg H J. How I treat refractory acute GVHD. Blood. 2007; 109:4119-4126. [0312] 5. Socie G, Blazar B R. Acute graft-versus-host disease: from the bench to the bedside. Blood. 2009; 114:4327-4336. [0313] 6. Zeiser R, Blazar B R. Acute Graft-versus-Host DiseaseBiologic Process, Prevention, and Therapy. N Engl J Med. 2017; 377:2167-2179. [0314] 7. Holtan S G, Pasquini M, Weisdorf D J. Acute graft-versus-host disease: a bench-to-bedside update. Blood. 2014; 124:363-373. [0315] 8. Blazar B R, Murphy W J, Abedi M. Advances in graft-versus-host disease biology and therapy. Nature reviews. Immunology. 2012; 12:443-458. [0316] 9. Meunier M, Bulabois C E, Thiebaut-Bertrand A, et al. Alemtuzumab for severe steroid-refractory gastrointestinal acute craft-versus-host disease. Biol Blood Marrow Transplant. 2014; 20:1451-1454. [0317] 10. Arai S, Margolis J, Zahurak M, Anders V, Vogelsang G B. Poor outcome in steroid-refractory graft-versus-host disease with antithymocyte globulin treatment. Biol Blood Marrow Transplant. 2002; 8:155-160. [0318] 11. Martinez C, Solano C, Ferra C, et al. Alemtuzumab as treatment of steroid-refractory acute graft-versus-host disease: results of a phase II study. Biol Blood Marrow Transplant. 2009; 15:639-642. [0319] 12. Schwartz D M, Kanno Y, Villarino A, Ward M, Gadina M, O'Shea J J. JAK inhibition as a therapeutic strategy for immune and inflammatory diseases. Nature reviews. Drug discovery. 2017; 16:843-862. [0320] 13. Martin P J, Nelson B J, Appelbaum F R, et al. Evaluation of a CD5-specific immunotoxin for treatment of acute graft-versus-host disease after allogeneic marrow transplantation. Blood. 1996; 88:824-830. [0321] 14. Byers V S, Henslee P J, Kernan N A, et al. Use of an anti-pan T-lymphocyte ricin a chain immunotoxin in steroid-resistant acute craft-versus-host disease. Blood. 1990; 75:1426-1432. [0322] 15. Schindler J, Gajavelli S, Ravandi F, et al. A phase I study of a combination of anti-CD19 and anti-CD22 immunotoxins (Combotox) in adult patients with refractory B-lineage acute lymphoblastic leukaemia. Br J Haematol. 2011; 154:471-476. [0323] 16. van Oosterhout Y V, van Emst J L, Bakker H H, et al. Production of anti-CD3 and anti-CD7 ricin A-immunotoxins for a clinical pilot study. Int J Pharm 2001; 221:175-186. [0324] 17. van Oosterhout Y V, van Emst L, Schattenberg A V, et al. combination of anti-CD3 and anti-CD7 ricin A-immunotoxins for the in vivo treatment of acute graft versus host disease. Blood. 2000; 95:3693-3701. [0325] 18. Bryant J, Day R. Incorporating toxicity considerations into the design of two-stage phase II clinical trials. Biometrics. 1995; 51:1372-13E3. [0326] 19. Andersen J T, Daba M B, Berntzen G, Michaelsen T E, Sandlie I. Cross-species binding analyses of mouse and human neonatal Fc receptor show dramatic differences in immunoglobulin G and albumin binding. J Biol Chem. 2010; 285:4826-4836. [0327] 20. Harris A C, Young R, Devine S, et al. International, Multicenter Standardization of Acute Graft-versus-Host Disease Clinical Data Collection: A Report from the Mount Sinai Acute GVHD International Consortium. Biol Blood Marrow Transplant. 2016; 22:4-10. [0328] 21. van Groningen L F, Liefferink A M, de Haan A F, et al. Combination Therapy with Inolimomab and Etanercept for Severe Steroid-Refractory Acute Graft-versus-Host Disease. Biol Blood Marrow Transplant. 2016; 22:179-182. [0329] 22. MacMillan M L, DeFor T E, Weisdorf D J. What predicts high risk acute graft-versus-host disease (GVHD) at onset?: identification of those at highest risk by a novel acute GVHD risk score. Br J Haematol. 2012; 157:732-741. [0330] 23. Lee S J. Classification systems for chronic graft-versus-host disease. Blood. 2017; 129:30-37. [0331] 24. Messmann R A, Vitetta E S, Headlee D, et al. A phase I study of combination therapy with immunotoxins IgG-HD37-deglycosylated ricin A chain (dgA) and IgG-RFB4-dgA (Combotox) in patients with refractory CD19(+), CD22(+) B cell lymphoma. Clin Cancer Res. 2000; 6:1302-1313. [0332] 25. de Pauw B, Walsh T J, Donnelly J P, et al. Revised definitions of invasive fungal disease from the European Organization for Research and Treatment of Cancer/Invasive Fungal Infections Cooperative Group and the National Institute of Allergy and Infectious Diseases Mycoses Study Group (EORTC/MSG) Consensus Group. Clin Infect Dis 2008; 46:1813-1821. [0333] 26. Styczynski J, van der Velden W, Fox C P, et al. Management of Epstein-Barr Virus infections and post-transplant lymphoproliferative disorders in patients after allogeneic hematopoietic stem cell transplantation: Sixth European Conference on Infections Leukemia (ECIL-6) guidelines. Haematologica. 2016; 101:803-811. [0334] 27. Ljungman P, Boeckh M, Hirsch H H, et al. Definitions of Cytomegalovirus Infection and Disease in Transplant Patients for Use in Clinical Trials. Clin Infect Dis. 2017; 64:87-91. [0335] 28. Chetie V, Swindell E, Uhr J W, Vitetta E S. Purification and properties of immunotoxins containing one vs. two deglycosylated ricin A chains. J Immunol Methods. 1993; 166:117-122. [0336] 29. Major-Monfried H, Renteria A S, Pawarode A, et al. MAGIC biomarkers predict long-term outcomes for steroid-resistant acute GVHD. Blood. 2018; 131:2846-2855. [0337] 30. Matos T R, de Rie M A, Teunissen M B M. Research Techniques Made Simple: High-Throughput Sequencing of the T-Cell Receptor. J Invest Dermatol. 2017; 137:e131-e138. [0338] 31. Lefranc M P. IMGT, the International ImMunoGeneTics Information System. Cold Spring Harb Protoc. 2011; 2011:595-603. [0339] 32. Emerson R O, DeWitt W S, Vignali M, et al. Immunosequencing identifies signatures of cytomegalovirus exposure history and HLA-mediated effects on the T cell repertoire. Nature genetics. 2017; 49:659-665. [0340] 33. DeWitt W S, Emerson R O, Lindau P, et al. Dynamics of the cytotoxic T cell response to a model of acute viral infection. Journal of virology. 2015; 89:4517-4526. [0341] 34. Lee D W, Gardner R, Porter D L, et al. Current concepts in the diagnosis and management of cytokine release syndrome. Blood. 2014; 124:188-195. [0342] 35. Hay K A, Hanafi L A, Li D, et al. Kinetics and biomarkers of severe cytokine release syndrome after CD19 chimeric antigen receptor-modified T-cell therapy. Blood. 2017; 130:2295-2306. [0343] 36. Chen Y B, Perales M A, Li S, et al. Phase 1 multicenter trial of brentuximab vedotin for steroid-refractory acute graft-versus-host disease. Blood. 2017; 129:3256-3261. [0344] 37. Schindler J, Sausville E, Messmann R, Uhr J W, Vitetta E S. The toxicity of deglycosylated ricin A chain-containing immunotoxins in patients with non-Hodgkin's lymphoma is exacerbated by prior radiotherapy: a retrospective analysis of patients in five clinical trials. Clin Cancer Res. 2001; 7:255-258. [0345] 38. Stone M J, Sausville E A, Fay J W, et al. A phase I study of bolus versus continuous infusion of the anti-CD19 immunotoxin, IgG-HD37-dgA, in patients with B-cell lymphoma. Blood. 1996; 88:1188-1197. [0346] 39. Socie G, Vigouroux S, Yakoub-Agha I, et al. A phase 3 randomized trial comparing inolimomab vs usual care in steroid-resistant acute GVHD. Blood. 2017; 129:643-649. [0347] 40. Garcia-Cadenas I, Rivera I, Martino R, et al. Patterns of infection and infection-related mortality in patients with steroid-refractory acute graft versus host disease. Bone Marrow Transplant. 2017; 52:107-113. [0348] 41. Taur Y, Xavier J B, Lipuma L, et al. Intestinal domination and the risk of bacteremia in patients undergoing allogeneic hematopoietic stem cell transplantation. Clin Infect Dis. 2012; 55:905-914. [0349] 42. Alho A C, Kim H T, Chammas M J, et al. Unbalanced recovery of regulatory and effector T cells after allogeneic stem cell transplantation contributes to chronic GVHD. Blood. 2016; 127:646-657. [0350] 43. Mohty M. Mechanisms of action of antithymocyte globulin: T-cell depletion and beyond. Leukemia. 2007; 21:1387-1394. [0351] 44. Willemsen L, Jol-van der Zijde C M, Admiraal R, et al. Impact of serotherapy on immune reconstitution and survival outcomes after stem cell transplantations in children: thymoglobulin versus alemtuzumab. Biology of blood and marrow transplantation: journal of the American Society for Blood and Marrow Transplantation. 2015; 21:473-482. [0352] 45. Shaughnessy P J, Bachier C, Grimley M, et al. Denileukin diftitox for the treatment of steroid-resistant acute graft-versus-host disease. Biol Blood Marrow Transplant. 2005; 11:188-193. [0353] 46. Herrera L, Farah R A, Pellegrini V A, et al. Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000; 14:853-858. [0354] 47. Preijers F W, Tax W J, Wessels J M, Capel P J, De Witte I, Haanen C. Different susceptibilities of normal T cells and T cell lines to immunotoxins. Scandinavian journal of immunology. 1988; 27:533-540. [0355] 48. Preijers F W, De Witte T, Rijke-Schilder G P, et al. Human T lymphocyte differentiation antigens as target for immunotoxins or complement-mediated cytotoxicity. Scandinavian journal of immunology. 1988; 28:185-194. [0356] 49. Derocq J M, Laurent G, Casellas P, et al. Rationale for the selection of ricin A-chain anti-T immunotoxins for mature T cell depletion. Transplantation. 1987; 44:763-769. [0357] 50. Yu Y H, Crews J R, Cooper K, et al. Use of immunotoxins in combination to inhibit clonogenic growth of human breast carcinoma cells. Cancer Res. 1990; 50:3231-3238. [0358] 51. Crews J R, Maier L A, Yu Y H, et al. A combination of two immunotoxins exerts synergistic cytotoxic activity against human breast-cancer cell lines. Int J Cancer. 1992; 51:772-779. [0359] 52. Dean G S, Pusztai L, Xu F J, et al. Cell surface density of p185(c-erbB-2) determines susceptibility to anti-p185(c-erbB-2)-ricin A chain (RTA) immunotoxin therapy alone and in combination with anti-p170(EGFR)-RTA in ovarian cancer cells. Clin Cancer Res. 1998; 4:2545-2550. [0360] 53. Engert A, Gottstein C, Bohlen H, et al. Cocktails of ricin A-chain immunotoxins against different antigens on Hodgkin and Sternberg-Reed cells have superior anti-tumor effects against H-RS cells in vitro and solid Hodgkin tumors in mice. Int J Cancer. 1995; 63:304-309.

    [0361] All references cited herein are incorporated herein by reference in their entirety and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety.

    [0362] The specific embodiments described herein are offered by way of example, not by way of limitation. Any sub-titles herein are included for convenience only, and are not to be construed as limiting the disclosure in any way.