PROTEASE ACTIVITY PROFILING VIA PROGRAMMABLE PHAGE DISPLAY OF COMPREHENSIVE PROTEOME-SCALE PEPTIDE LIBRARIES
20200407467 ยท 2020-12-31
Inventors
- Harry B. Larman (Baltimore, MD, US)
- Gabriel Roman-Melendez (Towson, MD, US)
- Thiagarajan Venkataraman (Ellicott City, MD, US)
Cpc classification
C12N2795/10031
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C40B40/10
CHEMISTRY; METALLURGY
C12N2795/10022
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C40B50/00
CHEMISTRY; METALLURGY
C40B40/08
CHEMISTRY; METALLURGY
C12N15/1037
CHEMISTRY; METALLURGY
C12N2795/10021
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
C07K17/06
CHEMISTRY; METALLURGY
International classification
C07K17/06
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to the field of proteases. More specifically, the present invention provides compositions and methods useful for profiling protease activity using phage display. In one embodiment, a display vector useful for profiling protease activity comprises a nucleic acid sequence encoding (a) a peptide to be displayed on the surface of the vector; (b) a first affinity tag C-terminal to the peptide; and (c) a second affinity tag N-terminal to the peptide. The display vector can comprise a virus, bacteriophage, yeast, bacteria, retrovirus, ribosome or mRNA. In particular embodiments, the peptide comprises a human peptidome library peptide.
Claims
1. A bacteriophage display vector comprising a nucleic acid sequence encoding: (a) a peptide to be displayed on the surface of the bacteriophage; (b) a first affinity tag C-terminal to the peptide; and (c) a second affinity tag N-terminal to the peptide.
2. The bacteriophage display vector of claim 1, wherein the first affinity tag comprises a biotin labeling tag.
3. The bacteriophage display vector of claim 1, wherein the second affinity tag comprises at least one FLAG tag.
4. The bacteriophage display vector of claim 3, wherein the second affinity tag comprises a 3 FLAG tag.
5. The bacteriophage display vector of claim 1, further comprising an enterokinase cleavage site N-terminal to the peptide.
6. The bacteriophage display vector of claim 1, wherein the peptide comprises a human peptidome library peptide.
7. The bacteriophage display vector of claim 1, wherein the bacteriophage is T7 or M13.
8. The bacteriophage display vector of claim 1, further comprising an epitope tag between the peptide and the first affinity tag.
9. The bacteriophage display vector of claim 8, wherein the epitope tag comprises a V5 tag.
10. The bacteriophage display vector of claim 1, further comprising a protease cleavage site between the peptide and the first affinity tag.
11. The bacteriophage display vector of claim 10, wherein the protease comprises the TEV protease.
12. A bacteriophage peptide display library comprising a plurality of bacteriophage display vectors each comprising a nucleic acid sequence encoding (a) a peptide to be displayed on the surface of the bacteriophage; (b) a first affinity tag C-terminal to the peptide; and (c) a second affinity tag N-terminal to the peptide.
13. The bacteriophage peptide display library of claim 12, wherein the first affinity tag comprises a biotin labeling tag.
14. The bacteriophage peptide display library of claim 12, wherein the second affinity tag comprises at least one FLAG tag.
15. The bacteriophage peptide display library of claim 13, wherein the second affinity tag comprises a 3 FLAG tag.
16. The bacteriophage peptide display library of claim 12, wherein the plurality of bacteriophage display vectors further comprise an enterokinase cleavage site N-terminal to the peptide.
17. The bacteriophage peptide display library of claim 12, wherein the bacteriophage is T7 or M13.
18. The bacteriophage peptide display library of claim 12, wherein the plurality of bacteriophage display vectors further comprise an epitope tag between the peptide and the first affinity tag.
19. The bacteriophage peptide display library of claim 18, wherein the epitope tag comprises a V5 tag.
20. The bacteriophage peptide display library of claim 12, wherein the plurality of bacteriophage display vectors further comprise a protease cleavage site between the peptide and the first affinity tag.
21. The bacteriophage peptide display library of claim 20, wherein the protease comprises the TEV protease.
22. The bacteriophage peptide display library of claim 12, wherein the displayed peptides comprise the human peptidome.
23. The bacteriophage peptide display library of claim 12, wherein the displayed peptides comprise at least 10 proteins.
24. The bacteriophage peptide display library of claim 12, wherein the displayed peptides are each less than 100, 200 or 300 amino acids long.
25. The bacteriophage peptide display library of claim 12, wherein each displayed peptide comprises a common adapter region appended to the end of the nucleic acid sequence encoding the peptide.
26. A method for profiling protease activity comprising the steps of: (a) contacting a reaction sample comprising the bacteriophage peptide display library of claim 12, with a capture agent that specifically binds the first affinity tag to form an immobilized bacteriophage peptide display library; (b) contacting the immobilized bacteriophage peptide display library with a sample comprising at least one protease under conditions that would allow the at least one protease to cleave at least one displayed peptide, thereby releasing a population of at least one composition comprising the bacteriophage particle, the second affinity tag N-terminal to the peptide and a first portion of the cleaved peptide; (c) isolating the population of step (b) with a capture agent that specifically binds the second affinity tag; and (d) amplifying deoxyribonucleic acid (DNA) within the bacteriophage particle that encodes the displayed peptide.
27. The method of claim 26, further comprising the step of (e) sequencing the amplified DNA of step (d).
28. The method of claim 27, wherein the sequencing step comprises next generation sequencing.
29. The method of claim 26, further comprising the step of (e) performing microarray hybridization to detect the amplified sequences of step (d).
30. The method of claim 26, wherein step (d) comprises real-time polymerase chain reaction (PCR).
31. The method of claim 27, wherein the amplified DNA of step (d) further comprises a DNA proxy.
32. The method of claim 31, wherein the DNA proxy is a peptide-specific barcode sequence.
33. The method of claim 26, wherein in step (a), the binding of the capture agent to the first affinity tag forms an irreversibly immobilized bacteriophage peptide display library.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
DETAILED DESCRIPTION OF THE INVENTION
[0043] It is understood that the present invention is not limited to the particular methods and components, etc., described herein, as these may vary. It is also to be understood that the terminology used herein is used for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention. It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to a protein is a reference to one or more proteins, and includes equivalents thereof known to those skilled in the art and so forth.
[0044] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Specific methods, devices, and materials are described, although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention.
[0045] All publications cited herein are hereby incorporated by reference including all journal articles, books, manuals, published patent applications, and issued patents. In addition, the meaning of certain terms and phrases employed in the specification, examples, and appended claims are provided. The definitions are not meant to be limiting in nature and serve to provide a clearer understanding of certain aspects of the present invention.
I. Definitions
[0046] As used herein, the term display library refers to a library comprising a plurality of peptides that are displayed on the surface of a virus or cell e.g., bacteriophage, yeast, or bacteria. Methods for using such phage, yeast or bacterial display libraries are well known to those of skill in the art. In some embodiments, the peptides are derived from the human peptidome. Moreover, the term display library includes, but is not limited to, a viral display library, a bacteriophage display library, a yeast display library, and a bacterial display library, as well as a retroviral display library, a ribosome display library or an mRNA display library. A bacteriophage may comprise any type of bacteriophage including, but not limited to, T7 and M13. Although the description herein may refer to a bacteriophage library, it is understood that such a term applies to other type of display libraries and that one of skill in the art can apply the teachings herein with respect to bacteriophage libraries to the construction and use of other types of display libraries.
[0047] As used herein, the term to the protein from which it is derived refers to a step of correlating or mapping at least one displayed peptide to a sequence in the known sequences of the proteins, thereby identifying the protein that comprises the peptide sequence.
[0048] As used herein, the term enriched indicates that a peptide is represented at a higher proportion in the display library after cleavage with a protease, compared to its representation in the starting library or the library after mock cleavage no protease was input into the reaction. In some embodiments, the peptides are enriched by at least 10% as compared to the general population. In other embodiments, the peptides are enriched by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, at least 1-fold, at least 2-fold, at least 5-fold, at least 10-fold, at least 25-fold, at least 50-fold, at least 100-fold, at least 1000-fold, or more, compared to the general population.
[0049] As used herein the term oligonucleotide primers refers to nucleic acid sequences that are 5 to 100 nucleotides in length, preferably from 17 to 45 nucleotides, although primers of different length are of use. Primers for synthesizing cDNAs are preferably 10-45 nucleotides, while primers for amplification are preferably about 17-25 nucleotides. Primers useful in the methods described herein are also designed to have a particular melting temperature (Tm) by the method of melting temperature estimation. Commercial programs, including OLIGO, Primer Design and programs available on the internet, including PRIMERS and OLIGO CALCULATOR can be used to calculate a Tm of a polynucleotide sequence useful according to the methods and assays described herein. Preferably, the Tm of an amplification primer useful according to the invention, as calculated for example by OLIGO CALCULATOR, is preferably between about 45 and 65 C. In other embodiments, the Tm of the amplification primer is between about 50 and 60 C.
[0050] As used herein, the term sample refers to a biological material which is isolated from its natural environment and contains at least one protease. A sample according to the methods described herein, may consist of a purified or isolated protease, or it may comprise a biological sample such as a tissue sample, a biological fluid sample, or a cell sample comprising a protease. A biological fluid includes, but is not limited to, blood, plasma, sputum, urine, cerebrospinal fluid, lavages, and leukaphoresis samples, for example.
[0051] As used herein the term adapter sequence refers to a nucleic acid sequence appended to a nucleic acid sequence encoding a phage-displayed peptide. In one embodiment, the identical adaptor sequence is appended to the end of each phage-displayed peptide encoding DNA in the phage display library; that is, the adaptor sequence is a common sequence on each nucleic acid of the plurality of nucleic acids encoding a peptide in the phage display library. In one embodiment, the adaptor sequence is of sufficient length to permit annealing of a common PCR primer. For example, adaptor sequences useful with the methods described herein are preferably heterologous or artificial nucleotide sequences of at least 15, and preferably 20 to 30 nucleotides in length. An adapter sequence may comprise a barcode sequence.
[0052] The term specifically binds refers to an agent, compound or, in certain embodiments, an antibody that recognizes and binds a peptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which may comprise a peptide of the invention. The term specifically refers to the binding of an affinity tag to a corresponding capture agent to which it specifically binds (e.g., biotin-streptavidin).
[0053] As used herein, the term amplified product refers to polynucleotides which are copies of a portion of a particular polynucleotide sequence and/or its complementary sequence, which correspond in nucleotide sequence to the template polynucleotide sequence and its complementary sequence. An amplified product, can be DNA or RNA, and it may be double-stranded or single-stranded.
[0054] A recited range is meant to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
II. Displayed Peptides
[0055] The displayed peptides may comprise all or a portion of the human peptidome. One of skill in the art can design synthetic oligonucleotide libraries to encode peptide tiles that together span a library of protein sequences (entire proteomes, for example). The result is a comprehensive and normalized (uniform in abundance) representation of the encoded peptides, which is referred to as the peptidome.
[0056] In some embodiments, the peptide sequences of the phage display library are at least 1 amino acids long; in other embodiments the peptide sequences are at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 450 amino acids or more in length. In particular embodiments, the peptide sequences are 90-mer.
[0057] In some embodiments, each peptide of the phage library will overlap at least one other peptide by at least 5 amino acids. In other embodiments, each peptide of the phage library will overlap at least one other peptide by at least 10, at least 15, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 32, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 100 amino acids or more. In particular embodiments, the peptides overlap by 45 amino acids.
III. Production of a Phage Display Library
[0058] General methods for producing a phage display library are known to those of skill in the art and/or are described in, for example, Larman et al., 29(6) N
[0059] Unlike the conventional art, contemplated herein are phage display libraries that comprise a plurality of peptides derived from the human peptidome. In one embodiment, it is contemplated herein that the plurality of peptides will represent a substantially complete set of peptides from the human peptidome.
[0060] In some embodiments, the phage display library comprises less than 10,000 peptide sequences. In other embodiments, the phage display library comprises less than 9000, less than 8000, less than 7000, less than 6000, less than 5000, less than 4000, less than 3000, less than 2000, less than 1000, less than 750, less than 500, less than 250, less than 100, less than 50 or less than 25 peptide sequences. In other embodiments, the phage display library comprises at least 100, at least 200, at least 500, at least 1000, at least 5000, at least 10,000 peptide sequences or more. It will be appreciated by one of ordinary skill in the art that as the length of the individual peptide sequences increases, the total number of peptide sequences in the library can decrease without loss of any protein sequences (and vice versa).
[0061] In some embodiments, the phage display library comprises peptides derived from at least 10 protein sequences, at least 20 protein sequences, at least 30 protein sequences, at least 40 protein sequences, at least 50 protein sequences, at least 60 protein sequences, at least 70 protein sequences, at least 80 protein sequences, at least 90 protein sequences, at least 100 protein sequences, at least 200 protein sequences, at least 300 protein sequences, at least 400 protein sequences, at least 500 protein sequences, at least 600 protein sequences, at least 700 protein sequences, at least 800 protein sequences, at least 900 protein sequences, at least 1000 protein sequences, at least 2000 protein sequences, at least 3000 protein sequences, at least 4000 protein sequences, at least 5000 protein sequences, at least 6000 protein sequences, at least 6500 protein sequences, at least 7000 protein sequences, at least 7500 protein sequences, at least 8000 protein sequences, at least 8500 protein sequences, at least 9000 protein sequences, at least 10,000 protein sequences or more.
[0062] In some embodiments, the phage display library comprises a plurality of peptide sequences that have less than 90% shared identity; in other embodiments the plurality of peptide sequences have less than 85% shared identity, less than 80% shared identity, less than 75% shared identity, less than 70% shared identity, less than 65% shared identity, less than 60% shared identity, less than 55% shared identity, less than 50% shared identity or even less.
[0063] In some embodiments, the phage display library comprises peptide sequences from at least 3 unique proteins or at least 5 unique proteins; in other embodiments the library comprises peptide sequences from at least 10, at least 20, at least 50, at least 75, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000 unique proteins.
[0064] In some embodiments, the phage display library comprises at least 2 peptides from the human peptidome. In other embodiments, the display library comprises at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 2000, at least 3000, at least 4000, at least 5000, at least 6000, at least 7000, at least 8000, at least 9000, at least 10000, at least 11000, at least 12000, at least 13000, at least 14000, at least 15000, at least 16000, at least 17000, at least 18000, at least 19000 peptides or more as selected in any desired combination from the human peptidome. In some embodiments, the display library comprises all of the peptides in the human peptidome.
[0065] Again, while the disclosure specifically recites phage display libraries, it is specifically contemplated herein that other display libraries can be used with the methods and assays described herein including, but not limited to, a yeast display library, a bacterial display library, a retroviral display library, a ribosome display library or an mRNA display library. It is within the skills of one of ordinary skill in the art to apply the methods and assays exemplified herein using a phage display library to the use of a different type of display library.
IV. Reaction Samples
[0066] As used herein, the term reaction sample refers to a sample that, at a minimum, comprises a phage display library, for example, a phage display library described herein.
[0067] In particular embodiments, reaction sample comprising the phage display library is contacted with a capture agent that specifically binds to the first affinity tag displayed on the surface of the bacteriophage. For example, in a specific embodiment, the first affinity tag comprises a biotin labeling tag. The capture agent may comprise avidin, streptavidin, neutravidin, captavidin, and the like. In particular embodiments, the capture agent can be coated onto a solid surface (e.g., beads) and used to create an immobilized phage display library. In such embodiments, the immobilized phage display library is ready to be contacted with a sample comprising at least one protease.
[0068] The reaction sample can also comprise additional buffers, salts, osmotic agents, etc., to facilitate the cleavage of peptides in the phage display library when the reaction sample is contacted with a biological sample comprising protease. A biological sample as that term is used herein refers to a fluid or tissue sample derived from a subject that comprises or is suspected of comprising at least one protease. Alternatively, a sample may comprise a solution that comprises or is suspected of comprising at least one protease.
[0069] A biological sample can be obtained from any organ or tissue in the individual to be tested, provided that the biological sample comprises, or is suspected of comprising, an antibody. Typically, the biological sample will comprise a blood sample, however other biological samples are contemplated herein, for example, mucosal secretions.
[0070] In some embodiments, a biological sample is treated to remove cells or other biological particulates. Methods for removing cells from a blood or other biological sample are well known in the art and can include, e.g., centrifugation, ultrafiltration, immune selection, sedimentation, etc. Antibodies can be detected from a biological sample or a sample that has been treated as described above or as known to those of skill in the art. Some non-limiting examples of biological samples include a blood sample, a urine sample, a semen sample, a lymphatic fluid sample, a cerebrospinal fluid sample, a plasma sample, a serum sample, a pus sample, an amniotic fluid sample, a bodily fluid sample, a stool sample, a biopsy sample, a needle aspiration biopsy sample, a swab sample, a mouthwash sample, a cancer sample, a tumor sample, a tissue sample, a cell sample, a synovial fluid sample, or a combination of such samples. For the methods described herein, it is preferred that a biological sample is from whole blood, plasma, saliva, serum, and/or urine. In one embodiment, the biological sample is serum.
[0071] In some embodiments, samples can be obtained from an individual with a disease. In certain embodiments, samples from a normal demographically matched individual and/or from a patient not having the disease are used in the analysis to provide controls. The samples can comprise a plurality of sera or plasma from individuals sharing a trait. For example, the trait shared can be gender, age, genotype, disease state, and the like.
V. Recovery of Phage Displaying Peptides Cleaved During the Assay
[0072] In particular embodiments, the immobilized phage display library is contacted with a sample comprising at least one protease. The protease cleaves at least one displayed peptide, releasing a population of at least one composition comprising the bacteriophage particle, the second affinity tag N-terminal to the peptide and a first portion of the cleaved peptide. The reaction sample also comprises a population of at least one composition comprising a second portion of the cleaved peptide and the first affinity tag bound to the capture agent. The reaction sample further comprises uncleaved immobilized bacteriophage page display library members, wherein the at least one protease in the reaction sample did not cleave the displayed peptide.
[0073] In certain embodiments, it is desirable to capture phage particles that were released into solution during the cleavage step of the assay. This post cleavage recovery is accomplished via binding of a flanking peptide sequence (e.g., the second affinity tag) that is positioned between the phage and the protease-cleaved peptide. Post cleavage recovery results in (i) concentrating the released phage for downstream analysis, and (ii) removing phage particles and genomes that were nonspecifically released into solution during the cleavage step, via dislocation of the displayed peptide or particle breakage.
[0074] The affinity tag (first and/or second) can be any affinity tag known in the art and includes, but is not limited to, polyhistidine, Glutathione S-transferase, biotin, antigen, HA (YPYDVPDYA (SEQ ID NO:46)) c-Myc (EQKLISEED (SEQ ID NO:47)), FLAG (DYKDDDK (SEQ ID NO:48)), V5 (GKPIPNPLLGLDST (SEQ ID NO:49)), Maltose binding protein, and HaloTag. Capture agents the specifically bind such affinity tags are known in the art and include, but are not limited to, metal ions, glutathione, streptavidin, anti-HA antibody or antigen-binding fragment thereof, anti-Myc antibody or antigen-binding fragment thereof, anti-FLAG antibody or antigen-binding fragment thereof, anti-V5 antibody or antigen-binding fragment thereof, maltose and halo.
[0075] In some embodiments, a capture agents can be conjugated to a solid surface or support that can be manipulated for recovery. For example, a capture agent can be coated on to magnetic beads for post cleavage recovery of released phage displaying a second affinity tag and a cleaved peptide. In a specific embodiment, M2 FLAG antibody coated protein G magnetic beads can be used to capture released phage displaying a FLAG tag (second affinity tag) and a cleaved peptide.
[0076] As used herein, the term magnetic bead means any solid support that is attracted by a magnetic field; such solid supports include, without limitation, DYNABEADS, BIOMAG Streptavidin, MPG7 Streptavidin, Streptavidin MAGNESPHERE, Streptavidin Magnetic Particles, AFFINITIP, any of the MAGA line of magnetizable particles, BIOMAG Superparamagnetic Particles, or any other magnetic bead to which a molecule (e.g., a capture agent the binds a first or second affinity tag) may be attached or immobilized.
[0077] A solid surface or solid support can comprise magnetic beads (e.g., micron-sized magnetic beads), Sepharose beads, agarose beads, a nitrocellulose membrane, a nylon membrane, a column chromatography matrix, a high performance liquid chromatography (HPLC) matrix or a fast performance liquid chromatography (FPLC) matrix.
VI. Methods for Peptide Detection
[0078] Following a step of capturing phage particles cleaved by a protease present in the sample, the DNA encoding the peptides can be subjected to an amplification step. In particular embodiments, the sample is subjected to conditions that will permit lysis of the phage (e.g., heat denaturation). In a specific embodiment, the nucleic acids from the lysed phage is subjected to an amplification reaction, such as a PCR reaction. In a more specific embodiment, the PCR reaction comprises a denaturation step that lyses the phage. In another embodiment, the nucleic acids encoding a phage-displayed peptide comprise a common adapter sequence for PCR amplification. In such embodiments, a PCR primer is designed to bind to the common adapter sequence for amplification of the DNA corresponding to a phage-displayed peptide.
[0079] In particular embodiments, the amplified DNA encoding the peptide can be detected by sequencing. In certain embodiments, a microarray hybridization approach can be used. In another embodiment, real time PCR amplification of specific DNA sequences can be used.
[0080] In certain embodiments, one of the PCR primers contains a common adaptor sequence which can be amplified in a second PCR reaction by another set of primers to prepare the DNA for high throughput sequencing. Unique barcoded oligonucleotides in the second PCR reaction can be used to amplify different samples and pool them together in one sequencing run to, for example, reduce cost and/or permit simultaneous detection of multiple phage-displayed peptides.
[0081] In some embodiments, the detection of a phage-displayed peptide comprises PCR with barcoded oligonucleotides. As used herein, the term barcode refers to a unique oligonucleotide sequence that allows a corresponding nucleic acid base and/or nucleic acid sequence to be identified. In certain aspects, the nucleic acid base and/or nucleic acid sequence is located at a specific position on a larger polynucleotide sequence (e.g., a polynucleotide covalently attached to a bead). In certain embodiments, barcodes can each have a length within a range of from about 4 to about 36 nucleotides, or from about 6 to about 30 nucleotides, or from about 8 to about 20 nucleotides. In certain aspects, the melting temperatures of barcodes within a set are within about 10 C. of one another, within about 5 C. of one another, or within about 2 C. of one another. In other aspects, barcodes are members of a minimally cross-hybridizing set. That is, the nucleotide sequence of each member of such a set is sufficiently different from that of every other member of the set that no member can form a stable duplex with the complement of any other member under stringent hybridization conditions. In one aspect, the nucleotide sequence of each member of a minimally cross-hybridizing set differs from those of every other member by at least two nucleotides. Barcode technologies are known in the art and are described in e.g., Winzeler et al., 285 S
[0082] In some embodiments, a detectable label is used in the amplification reaction to permit detection of different amplification products. As used herein, label or detectable label refers to any atom or molecule which can be used to provide a detectable (in some embodiments, quantifiable) signal, and which can be operatively linked to a polynucleotide, such as a PCR primer or proxy DNA sequence (often referred to as a DNA barcode). Labels may provide signals detectable by fluorescence, radioactivity, colorimetry, gravimetry, X-ray diffraction or absorption, magnetism, enzymatic activity, mass spectrometry, binding affinity, hybridization radiofrequency, nanocrystals and the like. A primer of the present invention may be labeled so that the amplification reaction product may be detected by detecting the detectable label. Qualitative or quantitative detection refers to visual or automated assessments based upon the magnitude (strength) or number of signals generated by the label. A labeled polynucleotide (e.g., an oligonucleotide primer) according to the methods of the invention can be labeled at the 5 end, the 3 end, or both ends, or internally. The label can be direct, e.g., a dye, or indirect, e.g., biotin, digoxin, alkaline phosphatase (AP), horse radish peroxidase (HRP). For detection of indirect labels it is necessary to add additional components such as labeled antibodies, or enzyme substrates to visualize the captured, released, labeled polynucleotide fragment.
[0083] In specific embodiments, an oligonucleotide primer is labeled with a fluorescent label. Labels include, but are not limited to, light-emitting, light-scattering, and light-absorbing compounds which generate or quench a detectable fluorescent, chemiluminescent, or bioluminescent signal. See, e.g., Garman A., Non-Radioactive Labeling, Academic Press (1997) and Kricka, L., Nonisotopic DNA Probe Techniques, Academic Press, San Diego (1992). Fluorescent reporter dyes useful as labels include, but are not limited to, fluoresceins (see, e.g., U.S. Pat. Nos. 6,020,481; 6,008,379; and 5,188,934), rhodamines (see, e.g., U.S. Pat. No. 6,191,278; 6,051,719; 5,936,087; 5,847,162; and 5,366,860), benzophenoxazines (see, e.g., U.S. Pat. No. 6,140,500), energy-transfer fluorescent dyes, comprising pairs of donors and acceptors (see, e.g., U.S. Pat. Nos. 5,945,526; 5,863,727; and 5,800,996; and), and cyanines (see, e.g., WO 9745539), lissamine, phycoerythrin, Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX (Amersham Biosciences, Inc. (Piscataway, N.J.)), Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5, 6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, SYPRO, TAMRA, Tetramethylrhodamine, and/or Texas Red, as well as any other fluorescent moiety capable of generating a detectable signal. Examples of fluorescein dyes include, but are not limited to, 6-carboxyfluorescein; 2,4,1,4,-tetrachlorofluorescein, and 2,4,5,7,1,4-hexachlorofluorescein. In certain aspects, the fluorescent label is selected from SYBR-Green, 6-carboxyfluorescein (FAM), TET, ROX, VICTM, and JOE. For example, in certain embodiments, labels are different fluorophores capable of emitting light at different, spectrally-resolvable wavelengths (e.g., 4-differently colored fluorophores); certain such labeled probes are known in the art and described above, and in U.S. Pat. No. 6,140,054. A dual labeled fluorescent probe that includes a reporter fluorophore and a quencher fluorophore is used in some embodiments. It will be appreciated that pairs of fluorophores are chosen that have distinct emission spectra so that they can be easily distinguished.
[0084] In further embodiments, labels are hybridization-stabilizing moieties which serve to enhance, stabilize, or influence hybridization of duplexes, e.g., intercalators and intercalating dyes (including, but not limited to, ethidium bromide and SYBR-Green), minor-groove binders, and cross-linking functional groups (see, e.g., Blackburn et al., eds. DNA and RNA Structure in Nucleic Acids in Chemistry and Biology (1996)).
[0085] In certain embodiments, the detection of a phage-displayed peptide comprises high throughput detection of a plurality of peptides simultaneously, or near simultaneously. In some embodiments, the high-throughput systems use methods similar to DNA sequencing techniques. Any conventional DNA sequencing technique may be used.
[0086] A number of DNA sequencing techniques are known in the art, including fluorescence-based sequencing methodologies (See, e.g., Birren et al., Genome Analysis: Analyzing DNA, 1, Cold Spring Harbor, N.Y.). In some embodiments, automated sequencing techniques understood in the art are utilized. In some embodiments, the high-throughput systems described herein use methods that provide parallel sequencing of partitioned amplicons (e.g., WO2006084132). In some embodiments, DNA sequencing is achieved by parallel oligonucleotide extension (See, e.g., U.S. Pat. Nos. 5,750,341, and 6,306,597). Additional examples of sequencing techniques include the Church polony technology (Mitra et al., 320 A
[0087] Next-generation sequencing (NGS) methods share the common feature of massively parallel, high-throughput strategies, with the goal of lower costs in comparison to older sequencing methods (see, e.g., Voelkerding et al., 55 C
[0088] In pyrosequencing (Voelkerding et al. (2009)); MacLean et al, Nature Rev. Microbial., 7:287-296; U.S. Pat. Nos. 6,210,891; 6,258,568), template DNA is fragmented, end-repaired, ligated to adaptors, and clonally amplified in-situ by capturing single template molecules with beads bearing oligonucleotides complementary to the adaptors. Each bead bearing a single template type is compartmentalized into a water-in-oil microvesicle, and the template is clonally amplified using a technique referred to as emulsion PCR. The emulsion is disrupted after amplification and beads are deposited into individual wells of a picotitre plate functioning as a flow cell during the sequencing reactions. Ordered, iterative introduction of each of the four dNTP reagents occurs in the flow cell in the presence of sequencing enzymes and luminescent reporter such as luciferase. In the event that an appropriate dNTP is added to the 3 end of the sequencing primer, the resulting production of ATP causes a burst of luminescence within the well, which is recorded using a CCD camera. It is possible to achieve read lengths greater than or equal to 400 bases, resulting in up to 500 million base pairs (Mb) of sequence.
[0089] In certain embodiments, nanopore sequencing is employed (see, e.g., Astier et al., 128(5) J. A
[0090] In certain embodiments, HELISCOPE by HELICOS BIOSCIENCES is employed (Voelkerding et al. (2009); MacLean et al. (2009); U.S. Pat. Nos. 7,169,560; 7,282,337; 7,482,120; 7,501,245: 6,818,395; 6,911,345: 7,501,245). Template DNA is fragmented and polyadenylated at the 3 end, with the final adenosine bearing a fluorescent label. Denatured polyadenylated template fragments are ligated to poly(dT) oligonucleotides on the surface of a flow cell. Initial physical locations of captured template molecules are recorded by a CCD camera, and then label is cleaved and washed away. Sequencing is achieved by addition of polymerase and serial addition of fluorescently-labeled dNTP reagents. Incorporation events result in fluor signal corresponding to the dNTP, and signal is captured by a CCD camera before each round of dNTP addition. Sequence read length ranges from about 25-50 nucleotides with overall output exceeding 1 billion nucleotide pairs per analytical run.
[0091] The Ion Torrent technology is a method of DNA sequencing based on the detection of hydrogen ions that are released during the polymerization of DNA (see, e.g., 327(5970) SCIENCE 1190 (2010); U.S. Patent Appl. Pub. Nos. 20090026082, 20090127589, 20100301398, 20100197507, 20100188073, and 20100137143). A microwell contains a template DNA strand to be sequenced. Beneath the layer of microwells is a hypersensitive ISFET ion sensor. All layers are contained within a CMOS semiconductor chip, similar to that used in the electronics industry. When a dNTP is incorporated into the growing complementary strand a hydrogen ion is released, which triggers a hypersensitive ion sensor. If homopolymer repeats are present in the template sequence, multiple dNTP molecules will be incorporated in a single cycle. This leads to a corresponding number of released hydrogens and a proportionally higher electronic signal. This technology differs from other sequencing technologies in that no modified nucleotides or optics are used. The per base accuracy of the Ion Torrent sequencer is about 99.6% for 50 base reads, with 100 Mb generated per run. The read-length is 100 base pairs. The accuracy for homopolymer repeats of 5 repeats in length is about 98%.
[0092] Another example of a nucleic acid sequencing approach that can be adapted for use with the methods described herein was developed by STRATOS GENOMICS, Inc. and involves the use of XPANDOMERS. This sequencing process typically includes providing a daughter strand produced by a template-directed synthesis. The daughter strand generally includes a plurality of subunits coupled in a sequence corresponding to a contiguous nucleotide sequence of all or a portion of a target nucleic acid in which the individual subunits comprise a tether, at least one probe or nucleobase residue, and at least one selectively cleavable bond. The selectively cleavable bond(s) is/are cleaved to yield an XPANDOMER of a length longer than the plurality of the subunits of the daughter strand. The XPANDOMER typically includes the tethers and reporter elements for parsing genetic information in a sequence corresponding to the contiguous nucleotide sequence of all or a portion of the target nucleic acid. Reporter elements of the XPANDOMER are then detected. Additional details relating to XPANDOMER-based approaches are described in, for example, U.S. Pat. Pub No. 20090035777, entitled HIGH THROUGHPUT NUCLEIC ACID SEQUENCING BY EXPANSION, filed Jun. 19, 2008, which is incorporated herein in its entirety.
[0093] Other single molecule sequencing methods include real-time sequencing by synthesis using a VISIGEN platform (Voelkerding et al. (2009); U.S. Pat. No. 7,329,492: U.S. Pat. No. 7,668,697; WO2009014614) in which immobilized, primed DNA template is subjected to strand extension using a fluorescently-modified polymerase and florescent acceptor molecules, resulting in detectible fluorescence resonance energy transfer (FRET) upon nucleotide addition.
[0094] Another real-time single molecule sequencing system developed by PACIFIC BIOSCIENCES (Voelkerding et al. (2009); MacLean et al. (2009); U.S. Pat. Nos. 7,170,050; 7,302,146; 7,313,308; 7,476,503) utilizes reaction wells 50-100 nm in diameter and encompassing a reaction volume of approximately 20 zeptoliters (10.sup.21 L). Sequencing reactions are performed using immobilized template, modified phi29 DNA polymerase, and high local concentrations of fluorescently labeled dNTPs. High local concentrations and continuous reaction conditions allow incorporation events to be captured in real time by fluor signal detection using laser excitation, an optical waveguide, and a CCD camera.
[0095] In certain embodiments, the single molecule real time (SMRT) DNA sequencing methods using zero-mode waveguides (ZMWs) developed by Pacific Biosciences, or similar methods, are employed. With this technology, DNA sequencing is performed on SMRT chips, each containing thousands of zero-mode waveguides (ZMWs). A ZMW is a hole, tens of nanometers in diameter, fabricated in a 100 nm metal film deposited on a silicon dioxide substrate. Each ZMW becomes a nanophotonic visualization chamber providing a detection volume of just 20 zeptoliters (10.sup.21 L). At this volume, the activity of a single molecule can be detected amongst a background of thousands of labeled nucleotides. The ZMW provides a window for watching DNA polymerase as it performs sequencing by synthesis. Within each chamber, a single DNA polymerase molecule is attached to the bottom surface such that it permanently resides within the detection volume. Phospholinked nucleotides, each type labeled with a different colored fluorophore, are then introduced into the reaction solution at high concentrations which promote enzyme speed, accuracy, and processivity. Due to the small size of the ZMW, even at these high, biologically relevant concentrations, the detection volume is occupied by nucleotides only a small fraction of the time. In addition, visits to the detection volume are fast, lasting only a few microseconds, due to the very small distance that diffusion has to carry the nucleotides. The result is a very low background.
[0096] Processes and systems for such real time sequencing that can be adapted for use with the methods described herein include, for example, but are not limited to U.S. Pat. Nos. 7,405,281, 7,315,019, 7,313,308, 7,302,146, 7,170,050, U.S. Pat, Pub. Nos. 20080212960, 20080206764, 20080199932, 20080176769, 20080176316, 20080176241, 20080165346, 20080160531, 20080157005, 20080153100, 20080153095, 20080152281, 20080152280, 20080145278, 20080128627, 20080108082, 20080095488, 20080080059, 20080050747, 20080032301, 20080030628, 20080009007, 20070238679, 20070231804, 20070206187, 20070196846, 20070188750, 20070161017, 20070141598, 20070134128, 20070128133, 20070077564, 20070072196, 20070036511, and Koriach et al., 105(4) P
VII. Sequence Analysis
[0097] Subsequently, in some embodiments, the data produced from the assay comprises sequence data from multiple barcoded DNAs. Using the known association between the barcode and the source of the DNA, the data can be deconvoluted to assign sequences to the source subjects, samples, organisms, etc.
[0098] Some embodiments include a processor, data storage, data transfer, and software comprising instructions to assign genotypes. Some embodiments of the technology provided herein further comprise functionalities for collecting, storing, and/or analyzing data. For example, some embodiments comprise the use of a processor, a memory, and/or a database for, e.g., storing and executing instructions, analyzing data, performing calculations using the data, transforming the data, and storing the data. In some embodiments, the processor is configured to calculate a function of data derived from the sequences and/or genotypes determined. In some embodiments, the processor performs instructions in software configured for medical or clinical results reporting and in some embodiments the processor performs instructions in software to support non-clinical results reporting. In some embodiments, there is a non-tangible computer-readable product that contains instructions to cause a computing device to perform any of the methods described herein.
VIII. Other Specific Embodiments of the Present Invention
[0099] One embodiment of the present invention is a vector encoding a displayed peptide molecule comprising a first flanking peptide that attaches to a solid surface, a second middle peptide used to detect protease activity in a sample, and a third flanking peptide for post-cleavage recovery. The second peptide may be positioned C-terminal of the first flanking peptide and N-terminal to the third flanking peptide, or the second peptide may be positioned N-terminal of the first flanking peptide and C-terminal to the third flanking peptide. The third peptide is used to recover a nucleic acid sequence that identifies the second peptide sequence. An example of a suitable second peptide is a peptide from a peptidome. An example of a suitable peptidome is a human peptidome. An example of a first flanking peptide is a biotinylation sequence or a functional portion thereof. An example of a third flanking peptide is an epitope tag sequence or a functional portion thereof.
[0100] Another embodiment of the present invention is a bacteriophage comprising any one of the vectors described in herein. In some embodiments, a bacteriophage of the present invention comprises a vector that expresses a single copy of the peptide molecule on the surface of the bacteriophage.
[0101] Another embodiment of the present invention is a method of protease activity profiling. The method comprises the following steps of providing a bacteriophage library comprising members displaying a peptide molecule comprising a first flanking peptide that attaches to a solid surface, a second middle peptide used to detect protease activity in a sample, and a third flanking peptide for post-cleavage recovery of a nucleic acid sequence identifier. Combining the bacteriophage library with a first solid surface so that the first flanking peptide is able to attach to the first solid surface forming an immobilized bacteriophage library. Combining a sample thought to contain one or more proteases with the attached bacteriophage library. Allowing cleavage of the second peptide so that one part of the second peptide remains attached to the first solid surface and a second part of the second peptide is released into solution along with the third flanking peptide sequence and the bacteriophage particle forming released particles. Combining the released particles displaying the second part of the second peptide and the third flanking peptide with a second solid surface capable of binding the third flanking peptide forming a population of immobilized bacteriophage particles enriched for sequences encoding peptides that were cleaved during the assay. Methods of the present invention may further comprise the step of amplifying DNA encoding the second part of the second peptide from the immobilized bacteriophage particles forming amplified DNA. Methods of the present invention may further comprise the step of sequencing the amplified DNA. In addition, the DNA encoding the second part of the second peptide may comprise a DNA sequence proxy. If a DNA sequence proxy is present, then the methods of the present invention may further comprise a step of amplifying the DNA sequence proxy of a second part of a second peptide from the immobilized bacteriophage particles forming amplified DNA. An example of a DNA sequence proxy used in the present invention is a barcode. The methods of the present invention may further comprise the step of sequencing the amplified DNA.
[0102] Another embodiment of the present invention is a kit comprising one or more aliquots of a composition of the present invention selected from a group consisting of the vector of claim 1, a phage display bacteriophage library comprising the vector of claim 1, or a combination thereof.
[0103] Without further elaboration, it is believed that one skilled in the art, using the preceding description, can utilize the present invention to the fullest extent. The following examples are illustrative only, and not limiting of the remainder of the disclosure in any way whatsoever.
EXAMPLES
[0104] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how the compounds, compositions, articles, devices, and/or methods described and claimed herein are made and evaluated, and are intended to be purely illustrative and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.) but some errors and deviations should be accounted for herein. Unless indicated otherwise, parts are parts by weight, temperature is in degrees Celsius or is at ambient temperature, and pressure is at or near atmospheric. There are numerous variations and combinations of reaction conditions, e.g., component concentrations, desired solvents, solvent mixtures, temperatures, pressures and other reaction ranges and conditions that can be used to optimize the product purity and yield obtained from the described process. Only reasonable and routine experimentation will be required to optimize such process conditions.
Example 1: Protease Activity Profiling Via Programmable Phage Display of Comprehensive Proteome-Scale Peptide Libraries
Materials and Methods
[0105] Materials.
[0106] All materials not described below were purchased from commercial suppliers and were of the highest grade available. Caspase-1, ADAM17, Thrombin, and PreScission proteases were purchased from BioVision, RnD Systems, SignalChem, and GE Life Sciences respectively.
[0107] Construction of T7 SEPARATE Phage Vector.
[0108] The SEPARATE vector (T7-SEPARATE) was constructed by cloning a custom-designed gBlock gene fragment (IDT) into the BamHI/SalI site of the low-copy T7Select1-2b phage vector (Millipore). The gBlock fragment is based on a 90-amino acid -lactoglobulin peptide sequence containing two PreScission protease cleavage sites (LEVLFQGP) (SEQ ID NO:1)..sup.42 C-terminal to the peptide is a V5 tag, followed by a TEV cleavage sequence, and then an AviTag.sup.43 biotinylation sequence (GLNDIFEAQKIEWHE) (SEQ ID NO:2), which is enzymatically conjugated with a single biotin moiety in vivo during phage replication in E. coli. N-terminal to the displayed peptide is a 3-FLAG tag followed by an enterokinase cleavage site. Restriction sites EcoRI/XhoI were placed upstream and downstream of the engineered -lactoglobulin peptide to allow for library subcloning into the T7-SEPARATE vector.
[0109] Subcloning the Human Peptidome Library into the T7-SEPARATE Vector. T7-Pep2,.sup.44 a complete human proteome library was restriction cloned into the T7-SEPARATE vector using the EcoRI/XhoI sites..sup.44,45 The library was packaged in vitro using the T7Select Packaging Kit (Millipore Sigma) and expanded by plate lysate amplification to obtain an average clonal representation of 100 plaques per peptide. To select for AviTag-displaying peptides, the initial expansion of this library was immobilized on streptavidin beads, washed to remove unbound phage particles (to remove prematurely truncated or out-of-frame peptides which will lack the downstream AviTag), digested with enterokinase, and re-expanded by plate lysate amplification at >100-times representation per peptide. Bacterial debris and large particulates were removed by centrifugation, followed by filtration through a 0.22 m PES membrane, and the clarified library pool was stored at 80 C. in 10% DMSO. The quality of the library peptides was assessed by Sanger sequencing of individual plaques from the packaging expansion and the clonal distribution assessed by Illumina sequencing.
[0110] SEPARATE Assay: Immobilization of the T7-SEPARATE Library.
[0111] Streptavidin-coupled magnetic beads (Dynabeads M-280 Streptavidin, ThermoFisher Scientific) were washed (TBS, pH 7.4, 0.01% NP40) and resuspended in binding buffer (TBS, pH 7.4, 0.001% NP40) containing 2E9 plaque forming units per 10 l of bead slurry. End-over-end mixing at room temperature was performed for one hour. Phage-coated beads were washed three times with wash buffer and transferred into two protein LoBind Eppendorf tubes blocked with TBS, pH 7.4 containing 1% BSA.
[0112] SEPARATE Assay: Protease Digestion.
[0113] Protease digestions was performed in 50 l of appropriate buffer alone or containing the protease: (a) Caspase-1/PreScission: 1TBS, pH 7.4, 0.01% NP40, 1 mM DTT; (b) Thrombin: TBS, pH 7.4, 0.01% NP40; (c) ADAM17: Tris, pH 8.0, ZnCl2 2.5 uM, 0.005% Tween 20. Digestion occurred overnight at room temperature with end-over-end rotation. Digest reactions were quenched by addition of 100 l TBS, pH 7.4, 0.01% NP40 containing AEBSF (2 mM), Aprotinin (0.3 M), Bestatin (116 M), E-64 (14 M), Leupeptin (1 M), and EDTA (1 mM) for thirty minutes at room temperature. To remove any residual biotinylated phage that may have been nonspecifically released, the 150 l supernatant of the quenched digest reaction is then incubated with a fresh 10 l of slurry volume M280 streptavidin beads (pre-washed three times with wash buffer) in a LoBind Eppendorf tube blocked with TBS, pH 7.4 containing 1% BSA at room temperature for one hour with end-over-end rotation.
[0114] SEPARATE Assay: Recapture of Cleaved Phage Clones.
[0115] 10 l slurry volume of protein G magnetic dynabeads were washed in buffer (TBS, pH 7.4, 0.01% NP40) and then resuspended in 50 l TBS, pH 7.4, 0.01% NP40 containing 4 g of M2 FLAG antibody for thirty minutes at room temperature with end-over-end rotation. The 150 l quenched digest reaction is added to the 10 l FLAG-coated Protein G beads and incubated for 60 minutes at room temperature with end-over-end rotation to capture phage particles released at the protease digest step. Beads are rinsed once with 100 l wash buffer and stored at 80 C. until PCR amplification.
[0116] SEPARATE Assay: Amplification and Sequencing of Recaptured Phage Clones.
[0117] Library PCR preparation, high-throughput DNA sequencing, and peptide read count data generation was performed as described previously..sup.44 Briefly, library peptide inserts are amplified by resuspending 10 l of FLAG-coated Protein G beads in PCR1 master mix containing the T7-Pep2 PCR1 F forward primer (ATAAAGGTGAGGGTAATGTC) (SEQ ID NO:3) and a T7-SEPARATE vector specific reverse primer (CTGGAGTTCAGACGTGTGCTCTTCCGATCAACCCCTCAAGACCCGTTTA) (SEQ ID NO:4), which includes an adapter sequence for sample-specific barcoding and Illumina P7 adapter incorporation during a subsequent PCR2 reaction. The PCR2 amplicons are pooled and sequenced using an Illumina NextSeq instrument in standard output mode to obtain single-end 50 nucleotide reads. Dual indexed sample demultiplexing and clonal read count determination were performed using exact sequence matching. Read counts were normalized using a random peptide normalization method, which attempts to make data comparable between samples by calculating a normalization factor based on background recaptured phage clones. To calculate the normalization factor, 100 peptides were randomly selected from the mock digest conditions with a read count ranging between 10 and 40. The median read count value for these 100 peptides is calculated for each sample. The random peptide selection and median calculation is performed 20 times and the average of the 20 median values is calculated for each sample. Finally, the normalization factor is calculated by dividing the average median value for each sample by that for one of the mock digest conditions. Read counts are then converted to normalized read counts by dividing each sample's read count values by the normalization factor. Fold enrichments are calculated for each peptide by dividing their normalized read counts in the digest condition by the normalized read counts in the mock digest condition. The fold enrichments can be visualized in an MA plot by transforming the normalized read count data into a log ratio (M, on the y-axis) and a mean average (A, on the x-axis) between the digest and mock digest conditions.
[0118] THP1 Cell Culture.
[0119] THP-1 cells were cultured in RPMI-1640 media with Glutamax (Gibco, ThermoFisher, Cat #61870127), supplemented with 10% FBS (Hyclone SH30071, GE Life Sciences), and 1 Antibiotic-Antimycotic (Gibco, ThermoFisher, Cat #15240062), referred to as complete RPMI. To differentiate THP-1 cells into macrophages, 110.sup.6 THP-1 cells were added per well of a 6-well plate in complete RPMI medium containing 50 ng/ml Phorbol 12-myristate 13-acetate (PMA, diluted in RPMI medium from a 1 mg/ml PMA stock in DMSO, Millipore Sigma, Cat. No. P1585). After 48 hours when the cells become adherent, the medium with PMA was removed, cells washed in 1PBS once, and fresh complete RPMI was added. Cells were allowed to rest for an additional 24 hours before inflammasome activation with LPS and Nigericin.
[0120] In Vitro Stimulation of the Inflammasome in THP-1 Cells.
[0121] A 6-well plate of PMA differentiated THP-1 cells were treated with 0, 1 or 0.1 g/ml LPS (Millipore Sigma, Cat. No. LPS25) for 3.5 hours. After 3.5 hours, cells were treated with 2.5 M Nigericin for an additional 30 minutes to activate the inflammasome. Cells were washed in 1PBS and lysed in 1 mammalian cell extraction buffer (BioVision, Cat. No. K269) containing 2 M Dithiothreitol (DTT). Nuclei were spun down by centrifugation (10,000 rpm, 5 minutes, 4 C.) and the cleared supernatant was used to perform Western blots.
[0122] HUWE1 Cleavage Assay Using Recombinant Caspase-1.
[0123] Recombinant Caspase-1 (rCaspase-1) was diluted to 0.1 U/l in 1 mammalian cell extraction buffer containing 2 M Dithiothreitol (DTT). This buffer preserves enzymatic activity of proteases. Unstimulated, PMA differentiated THP-1 cells were also lysed in 1 mammalian cell extraction buffer with 200 l of buffer to lyse one well of a 6-well plate (110.sup.6 cells). Protease digests were set up with 50 l of lysate (250,000 cells).
[0124] Western Blot Analysis.
[0125] 30 l of protein lysates were mixed with 10 l of 4 NuPage LDS sample loading buffer (Thermo Fisher, Cat. No. NP0007, final concentration to 1). 4-12% NuPage Bis-Tris gels (Thermo Fisher, Cat. No. NP0321) were loaded with 35 l of each sample along with high molecular weight standards (HiMark protein ladder, Thermo Fisher, Cat. No. LC5699) and resolved in 1 NuPAGE MES SDS Running Buffer (Thermo Fisher, Cat. No. NP0002) at 150V for 50-60 minutes. After suitable resolution of proteins, the gels were transferred to a PVDF membrane by the wet transfer method using 1 NuPage transfer buffer (Thermo Fisher, Cat. No. NP00061) overnight at 4 C., 50 mA constant current. After transfer is complete, the membranes were washed in 1 tris buffered saline containing 0.01% Tween-20 (TBS-T), blocked for 30 minutes with 5% milk in TBS-T and probed with primary antibodies and HRP conjugated secondary antibodies with TBS-T washing in between. After probing with secondary antibody, the membranes were washed 3 times, 5 minutes each with TBS-T, treated with Pierce ECL Plus Western Blotting Substrate (Thermo Fisher, Cat. No. 32132) for 5 minutes and exposed to Hyperfilm ECL (Millipore Sigma, Cat. No. GE28-9068-38). Anti-HUWE1 antibody (Thermo Fisher, Cat. No. A300-486A) was diluted 1:1000 in 5% milk and used to probe membranes overnight at 4 C. Anti-GSDMD antibody (Thermo Fisher, Cat. No. 20770-1-AP) was diluted 1:1,000 in 5% milk and used to probe membranes 2-4 hours at room temperature before the addition of secondary antibody. Secondary antibody (antirabbit IgG, Cell Signaling, Cat. No. 7074S) was diluted to 1:5,000 in 5% milk and probed 2 hours at room temperature.
Results and Discussion
[0126] Proteases catalyze the irreversible hydrolysis of peptide bonds with consequences that include target destruction, protein maturation, and signal transduction. These enzymes participate in diverse biological functions, including tissue remodeling and morphogenesis, infection, blood coagulation, neoplasia, and cancer metastasis..sup.1-4 Their enzymatic activities can therefore serve both as valuable diagnostic biomarkers and as therapeutic targets..sup.5-9 There are 1,252 putative human proteases belonging to five families, accounting for 3.5% of the human proteome..sup.10 Given their importance and diversity, there is an unmet need for unbiased techniques to profile the activity of proteases, both in isolation and as components of complex biological mixtures. The physiological substrates of only a small fraction of proteases have been characterized in some detail; even for these enzymes, their full complement of substrates remains unknown.
[0127] Currently, unbiased protease profiling approaches are based on mass spectrometry.sup.11,12 and tend to be both cumbersome and expensive. Targeted activity-based profiling techniques.sup.13,14 can detect active proteases, but are typically limited by lower levels of assay multiplexing and are restricted to enzymes with well characterized substrates..sup.15,16 Attempts to characterize cleavage motifs have also utilized the bacteriophage display of random peptide libraries.sup.17-19, but these types of analyses are typically difficult to interpret as they primarily focus on identifying consensus motifs which are then mapped by sequence alignment onto candidate protein substrates. This approach may be useful in identifying some substrates, but will fail to identify substrates. Consensus motifs identified using random libraries may not match well with true protein sequences.
[0128] The present invention describes SEPARATE (Sensing EndoPeptidase Activity via Release and recapture using flAnking Tag Epitopes), a highly multiplexed protease profiling platform that combines a complete human proteome library cloned into a novel T7 phage display vector and quantitative analysis via next generation DNA sequencing (NGS). SEPARATE enables unbiased, low-cost, and high sample throughput characterization of human protease activities, thereby overcoming key limitations of current approaches. 250,000 oligonucleotides encoding 90 amino acid overlapping human peptide tiles, with 45 amino acid overlaps, covering the entire reference human proteome.sup.20, were synthesized and cloned as a pool into the T7-SEPARATE phage display vector (
[0129] Irreversible library pre-immobilization has several advantages, including concentration of the library into small assay volumes, flexible buffer exchange for protease compatibility, and the removal of defective phage clones displaying peptides with frameshift or non-sense mutations. The C-terminal biotinylated AviTag provides near irreversible immobilization to streptavidin coated magnetic beads, which minimizes the amount of non-specific phage particle release and thus the background noise of the assay, even during lengthy digest reactions. Initial experiments revealed that the AviTag is sufficiently biotinylated during phage replication in E. coli cells, even without overexpression of a biotin ligase. A titration experiment was performed to estimate the fraction of biotinylated phage particles captured on streptavidin beads. When 109 phage particles are mixed with 101 of beads, 310.sup.8 particles (30%) remain bound ensuring that each peptide of the 250,000 member human proteome library is represented greater than 1,000 times on average at the start of a digest reaction (
[0130] The present inventors reasoned that monovalent peptide display would enhance detection sensitivity by requiring just a single protease cleavage event to release a target phage particle. To test this hypothesis, positive and negative controls were constructed, which could be monitored via quantitative real-time PCR. A cleavable 90-aa substrate for the commercially available PreScission enzyme (human rhinovirus 3C protease, GE Life Sciences, MA) served as a positive control, whereas a randomly selected 90-aa human peptide from the proteome library served as an uncleavable negative control. Both controls were also subcloned into a mid-copy (multivalent) version of the T7-SEPARATE vector, which displays 10B-fused peptides at a copy number between 5 and 15 per phage particle. At all concentrations of PreScission tested, the monovalent display format provided a substantial increase in the number of phage particles released and recaptured (up to 53% and 43%, respectively, of the total number of pre-immobilized phage particles), in comparison to the same conditions but using the multivalent display format (up to 24% and 22.5%, respectively;
[0131] The human peptidome library was cloned into the T7-SEPARATE vector as described in the methods section. To enrich for full length peptides, the pre-expansion library was first immobilized on streptavidin conjugated beads, washed to remove unbound phage particles, released the bound phage using enterokinase and expanded them to obtain the post-expansion library (
[0132] To assess the performance of a proteomic-scale SEPARATE assay, the PreScission-cleavable clone was spiked into the complete human library at a ratio of 1 to 100. Recapture of the cleavable peptide demonstrated a protease concentration-dependent efficiency, with the highest concentration resulting in a 26-fold increase versus a mock digest or digest with Caspase-1 (
[0133] The present inventors next utilized SEPARATE to identify novel and biologically relevant substrates, even for well-studied proteases. Caspase-1 plays a key effector function as part of the inflammasome complex by producing mature interleukin-1 (IL-1)21 and activating pyroptosis via cleavage of gasdermin D..sup.22,23 In our study, Caspase-1 was found to significantly cleave 250 human peptide sequences corresponding to 230 unique genes. Peptides cleaved by Caspase-1 in the SEPARATE assay were analyzed using a motif detection algorithm, EpitopeFindr, which performs BLAST alignment of all peptides against each other to identify shared stretches of sequence homology..sup.24 The results of this analysis were visualized as a network graph in which peptides were linked based on their alignments (
[0134] Interestingly, three peptides (two overlapping) derived from the protein HECT, UBA and WWE Domain Containing E3 Ubiquitin Protein Ligase 1 (HUWE1) were among the most significantly enriched, yet did not harbor the canonical cleavage motif (
[0135] For SEPARATE to be useful in the analysis of complex cell or tissue lysates, it must have sufficient sensitivity at physiologically relevant enzyme concentrations. To this end, we performed SEPARATE on the human library and specifically focused on previously known substrates of well-characterized recombinant proteases from diverse catalytic classes. Testing serial dilutions of Caspase-1 (a cysteine protease), Thrombin (a serine protease), and ADAM17 (a zinc-dependent metalloprotease), concentration-dependent enrichments of known substrates were indeed detected for each enzyme at or below their reported physiological concentrations (
[0136] The performance of the SEPARATE assay is expected to depend on protease-substrate requirements as well as biophysical features of the peptide library. The present inventors have verified by PCR and Sanger sequencing that 90% of the immobilized human library lacks in-frame mutations. However, the well characterized Caspase-1 substrate Gasdermin-D did not score in the assay, and this was true for other canonical enzyme-substrate pairs such as Thrombin/Fibrinogen. To explore this further, a 56-amino acid mouse peptidome library (unpublished) was used in which both IL-1 and Gasdermin-D cleavage peptides are better represented. Some of the established targets of Caspase-1 were found to score in the mouse peptidome library as well (Table 5). Mouse IL-1 and Gasdermin-D are highly similar to the human versions and can serve as substrates for human Caspase-1. Mouse IL-1 is known to be cleaved by Caspase-1 after the D26 and D117 residues..sup.41 These two regions are covered by three peptides in the mouse peptidome library. Robust enrichments (7-13 fold) is observed for these peptides versus the IL-1 peptides lacking these cleavages sites (
[0137] The SEPARATE assay can also yield false positive results. First, many peptides, which are not normally surface-exposed in the context of their full-length proteins, are presented for protease cleavage in the assay. Second, since the assay is performed outside the cellular context, enzymes and substrates that are typically sequestered in organelles or otherwise physically compartmentalized will be available for cleavage in the assay. Third, enzyme-substrate pairs that are not co-expressed in the same cells or are not expressed concurrently, may also inappropriately interact in the assay. Fourth, the biomolecular environment, including modulators of enzyme activity and posttranslational substrate modifications, may also impact the accuracy of the assay for certain substrate-enzyme pairs. For these reasons, SEPARATE should be viewed as a hypothesis generating technology, and novel candidate substrates must be validated using a more physiologically relevant assay.
[0138] Currently, there are large gaps in the knowledge of protease substrates, even for well-studied enzymes like Caspase-1. The present inventors have therefore developed the SEPARATE system for unbiased, high throughput, inexpensive, and automatable protease activity profiling using peptidome libraries monovalently displayed on phage. While not always able to localize precise cleavage sites, SEPARATE can identify novel substrates and narrows down the recognition motif to 45-90 amino acids. Selecting an appropriate tiling density involves considering the tradeoffs between cleavage site resolution and the costs of library construction and sequencing analysis.
[0139] In a proof-of-concept study, the present inventors detected peptides that together recapitulated a canonical Caspase motif and identified a novel, non-canonical, physiological substrate, HUWE1, which was validated using standard approaches. The SEPARATE methodology is broadly applicable as it can be readily adapted to any soluble endopeptidase of interest, including endogenous and pathogen-associated proteases present within complex biological samples. It is therefore expected that unbiased protease profiling via approaches like SEPARATE will identify valuable new disease biomarkers and therapeutic targets.
TABLE-US-00001 TABLE 1 Characteristics of the human peptidome library. Post-expansion library Loaded on magnetic beads Total number of 259,345 259,345 designed peptides Total read 10,481,974 (40.4X) 7,108,499 (27.4X) counts (TRC) Detected peptides 227,010 (87.53%) 205,026 (79.05%) with TRC > 0
TABLE-US-00002 TABLE 2 Top 20 enriched peptides from human library digest with Caspase-1. Amino acid Caspase1 Gene Name position Caspase1 p_val fold change HUWE1 2296-2485 2.43E04 22.71 Efs 181-270 1.34E03 21.06 LYST 1171-1260 1.06E03 21.04 ERO1L 91-180 6.53E04 19.8 Hyls1 1-90 9.59E04 19.74 Znf462 1-90 3.89E04 19.1 BSN 631-720 9.57E04 18.78 unmapped_NM 91-180 7.81E04 18.72 TNS3 451-540 4.20E04 18.67 C14orf93 91-180 6.86E04 18.22 HUWE1 2251-2340 1.51E03 17.58 hoxa2 271-360 5.52E04 17.06 ZNF469 811-900 9.14E04 16.76 HUWE1 2341-2430 1.31E03 16.55 MAP3K14 496-585 1.42E03 16.5 HMGXB4 226-315 6.29E04 16.49 LOC100287737 496-585 1.70E03 16.43 UHRF1BP1L 991-1080 3.04E03 16.39 ANAPC1 1-90 7.69E04 16.35 Hmcn2 1576-1665 6.90E04 16.27
TABLE-US-00003 TABLE3 Top20enrichedpeptidesfromhumanlibrarydigestwithADAM17. Adam17 Aminoacid Fold GeneName position Sequence Change KCND1 541-630 AIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSR 57.97 DFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNS(SEQIDNO:6) CIC 901-990 QSVSPVQAPPPGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSPPFSVPV 57.55 QNGAQPPSKIIQLTPVPVSTPSGLVPPLSPATLPGPT(SEQIDNO:7) SPATC1 181-270 SPLIAPVMGTVAVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPEAPRLRLAEP 51.48 LRGGPTGPQSPACVVPTATTKVPLSTEPPQSTQDPE(SEQIDNO:8) MUC4 1351-1440 SSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGH 48.17 ATPLLVTDTSSASTGHATPLPVTDASSVSTDHATS(SEQIDNO:9) SMTN 361-450 PARLLGPSLTSTTPASSSSGSSSRGPSDTSSRFSKEQRGVAQPLAQLRSCPQEEG 45.89 PRGRGLAARPLENRAGGPVARSEEPGAPLPVAVGT(SEQIDNO:10) LOC375295 46-135 VLNSGARVWPSASALGLTAPPKDAEDRARPASGLRGARVLSEGREPRASLRV 44.03 QVRPGLDVAAPGVCSLSCPSPPRSSAHPGPRGPLFPAL(SEQIDNO:11) HMCN2 451-540 HSALPFRLQLRRGEARLGEERHFQESGNSSWEILRASKAEEGTYECTAVSRAG 43.29 TGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLSCRV(SEQIDNO:12) MUC4 1666-1755 PVTSTSSASTGHATPLPVTGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLS 41.41 SVSTGDTTPLPVTSPSSASTGHASPLLVTDASSAST(SEQIDNO:13) RBM14 226-315 YVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQ 39.99 PSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASAL(SEQIDNO:14) IL1RAP 541-630 RLALPLRSLSASSGWNESCSSQSDISLDHVQRRRSRLKEPPELQSSERAAGSPP 39.89 APGTMSKHRGKSSATCRCCVTYCEGENHLRNKSRAE(SEQIDNO:15) LOC100293409 1801-1890 ATPGAPGSSTPGEADIGNTSFGKSGKSGHDSLTVLNPAFLRRTPTVSAASTTSS 39.34 PVSKHTDAASATAVTISGSKPGTPGTPGGATSGGKI(SEQIDNO:16) TAF4B 406-495 KAGVVTLHSVGPTAATGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVS 39.07 GTAVTLSLPAVTFGETSGAAICLPSVKPVVSSAGTTS(SEQIDNO:17) PHF21B 1-90 MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTG 38.34 PQVSSLQRLAGQGAAVLPQVRPKTLIPDSLPVAPGRDR(SEQIDNO:18) TTN 271-360 IAAKAQLARQQSPSPIRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRSVRSPLL 37.14 MRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR(SEQIDNO:19) ATP7A 1261-1350 ARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAM 36.03 ANVIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRE(SEQIDNO:20) RFX5 361-450 KVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTEN 35.48 REVGIGGDQGPHDKGVKRTAEVPVSEASGQAPPAKA(SEQIDNO:21) FLYWCH1 226-315 EPEPTPGLVLSKPALEEEEAPRALSLLSLPPKKRSILGLGQARPLEFLRTCYGGS 35.48 FLVHESFLYKREKAVGDKVYWTCRDHALHGCRSRA(SEQIDNO:22) PLEC 91-180 EIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRR 34.93 KELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRV(SEQIDNO:23) NUP210 811-900 STRPVLASIEPELPMQLVSQDDESGQKKLHGLQAILVITEASGTTAITATATGY 34.57 QESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPE(SEQIDNO:24) PRR14L 1081-1170 ARQEKLAFQEDSRSTLSRRELDAAHTGTTGQDSDFPVTAASTVDFLKIKKSCE 34.10 ENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILG(SEQIDNO:25)
TABLE-US-00004 TABLE4 Top20enrichedpeptidesfromhumanlibrarydigestwithThrombin. Thrombi Aminoacid Fold GeneName position Sequence Change TNNT2 46-135 AETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFD 19.08 DIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKD(SEQIDNO:26) TNNT2 1-90 MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETR 17.66 AEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIP(SEQIDNO:27) LOC100290422 181-270 SSALSGSGISRMQRPSSEAQMRMVASSEVDTRMSLERDQAKSETPRVWPRST 15.43 RSTVGGAGTSWHREMLPSRPEDHPQTHLHAVKSSAATA(SEQIDNO:28) NOL7 1-90 MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEED 15.07 EEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRD(SEQIDNO:29) SIPA1L2 1531-1620 PRAHPAPSMGSLRNEFWFSDGSLSDKSKCADPGLMPLPDTATGLDWTHLVD 14.27 AARAFEGLDSDEELGLLCHHTSYLDQRVASFCTLTDMQH(SEQIDNO:30) NSMCE3 1-90 MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTS 12.49 RGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS(SEQIDNO:31) MTIF2 91-180 VEVWIGMTIEELARAMEKNTDYVYEALLNTDIDIDSLEADSHLDEVWIKEVIT 12.32 KAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRS(SEQIDNO:32) NUP35 46-135 PVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDIS 12.05 SPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQS(SEQIDNO:33) TNNT2 1-90 MSDIEEVVEEYEEEEQEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDG 11.56 PMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRM(SEQIDNO:34) PCDH20 91-180 LLPRSAGRPDPQSQLPERTGAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTS 11.53 AQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLELL(SEQIDNO:35) GPALPP1 181-270 DSSKPIVRESWMTELPPEMKDFGEGPRTFKRRADDTSGDRSIWTDTPADRER 11.22 KAKETQEARKSSSKKDEEHILSGRDKRLAEQVSSYNES(SEQIDNO:36) ABL2 1-90 MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQH 11.16 DHFASCVEDGFEGDKTGGSSPEALBRPYGCDVEPQALN(SEQIDNO:37) SLAIN2 46-135 PGSPVRAGASIPSSGAASPRGFPLGLSAKSGGGPGSGPRRTSSEELRDATSLLA 11.10 AGEGGLLDEVEPLRPDELERLSGWEEEEESWLYSSP(SEQIDNO:38) CCNI2 46-135 APLPRSNRSRCPGTRQPGAASLHAASAAVPVRPRRGTAPAGKTADAVPAAAP 10.98 EQAPRPAPQSRKPRNLEGDLDERRLLCHLQLAQDREAR(SEQIDNO:39) ZSCAN10 46-135 LGREQGQPERDGEEVVLLLEGIHREPSHAGPLDFSCNAGKSCPRADVTLEEKG 10.92 CASQVPSHSPKKELPAEEPSVLGPSDEPPRPQPRAAQ(SEQIDNO:40) CCDC86 136-225 SELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSP 10.90 RGQHEPSKPPPAGETVTGGFGAKKRKGSSQAPASK(SEQIDNO:41) MED13L 991-1080 ATFIRDGYNNVPSVGSLADPDYLNTPQMNTPVTENSAAPASNSGAGVLPSPA 10.80 TPRFSVPTPRTPRTPRTPRGGGTASGQGSVKYDSTDQG(SEQIDNO:42) PDLIM2 181-270 AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREG 10.76 RAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSS(SEQIDNO:43) LOC100287196 181-270 SLEALGMPRAYRLPSSFERVPCQTESSGPVPTIDRAGTEFDMAAKHLQSQSTP 10.68 QAQARSKGSVALMNEKQKPHLQGSELRTEKLLSEGL(SEQIDNO:44) TNNT2 1-90 MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAK 10.44 EAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDI(SEQIDNO:45)
TABLE-US-00005 TABLE 5 Selected peptides from mouse library digested with Caspase-1. Gene Name Amino acid position Caspase1 fold change HUWE1 2328-2384 23.12 HUWE1 2291-2347 6.13 IL1B 74-130 13.23 IL1B 75-131 8.80 IL1B 0-56 8.10 GSDMD 259-315 6.78 GSDMD 222-278 4.23
Example 2: SEPARATE Assay Useful in Candidate Drug Candidate Evaluation
[0140] A cell line is treated with a drug or compound that activates or inhibits proteases and cell extracts will be prepared in a buffer that preserves the activity of proteases. The extract is then mixed with an immobilized substrate library and the SEPARATE assay for protease activity profiling of the present invention performed as described in the specification. Fold-enrichment of peptides will be calculated by comparing the drug treated cell line to a control untreated cell line. The mixture of proteases in the cell extract may optionally be deconvoluted using data sets previously generated by analyzing individual proteases or examination of the literature.
Example 3: SEPARATE Assay Performed on Patient Sample
[0141] Patient specimens like tumor resections, biopsies, blood plasma, blood serum, bodily secretions, etc., are solubilized in an appropriate lysis/dilution buffer. These extracts are inputs to the SEPARATE assay for protease activity profiling of the present invention against the human peptidome. Differentially active protease are determined by comparison with matched samples from healthy donor or uninvolved tissue controls. The mixture of proteases detectable in the cell extract may optionally be deconvoluted using data sets previously generated by analyzing individual proteases or examination of the literature.
Example 4: SEPARATE Assay Useful to Profile Viral Proteases
[0142] To utilize the SEPARATE assay to profile viral proteases, a permissive cell line is infected with a virus and cell extracts prepared at different times post infection. The extracts are used to perform the SEPARATE assay for protease activity profiling of the present invention as described herein. Comparisons are made between the infected and negative control uninfected cell line to establish a virus specific protease cleavage signature. The mixture of host protease activities detectable in the cell extract may optionally be deconvoluted using data sets previously generated by analyzing individual proteases or examination of the literature. This can be done separately from the deconvolution of virus-specific protease activities.
REFERENCES
[0143] 1. Lopez-Otin, C. & Bond, J. S. Proteases: Multifunctional Enzymes in Life and Disease. J. Biol. Chem. 283, 30433-30437 (2008). [0144] 2. Tong, L. Viral proteases. Chem. Rev. 102, 4609-4626 (2002). [0145] 3. Ingmer, H. & Brondsted, L. Proteases in bacterial pathogenesis. Res. Microbiol. 160, 704-710 (2009). [0146] 4. Liyanage, C., Fernando, A. & Batra, J. Differential roles of protease isoforms in the tumor microenvironment. Cancer Metastasis Rev. (2019) doi:10.1007/s10555-019-09816-2. [0147] 5. Culp, E. & Wright, G. D. Bacterial proteases, untapped antimicrobial drug targets. J. Antibiot. (Tokyo) 70, 366-377 (2017). [0148] 6. Kaman, W. E., Hays, J. P., Endtz, H. P. & Bikker, F. J. Bacterial proteases: targets for diagnostics and therapy. Eur. J. Clin. Microbiol. Infect. Dis. Off. Publ. Eur. Soc. Clin. Microbiol. 33, 1081-1087 (2014). [0149] 7. Deu, E. Proteases as antimalarial targets: strategies for genetic, chemical, and therapeutic validation. FEBS J. 284, 2604-2628 (2017). [0150] 8. Caughey, G. H. Mast cell proteases as pharmacological targets. Eur.
[0151] J. Pharmacol. 778, 44-55 (2016). [0152] 9. Goard, C. A. & Schimmer, A. D. Mitochondrial matrix proteases as novel therapeutic targets in malignancy. Oncogene 33, 2690-2699 (2014). [0153] 10. Rawlings, N. D., Barrett, A. J. & Bateman, A. MEROPS: the database of proteolytic enzymes, their substrates and inhibitors. Nucleic Acids Res. 40, D343-D350 (2012). [0154] 11. van den Berg, B. H. J. & Tholey, A. Mass spectrometry-based proteomics strategies for protease cleavage site identification. Proteomics 12, 516-529 (2012). [0155] 12. Klingler, D. & Hardt, M. Profiling protease activities by dynamic proteomics workflows. Proteomics 12, 587-596 (2012). [0156] 13. Sanman, L. E. & Bogyo, M. Activity-Based Profiling of Proteases.
[0157] Annu. Rev. Biochem. 83, 249-273 (2014). [0158] 14. Chakrabarty, S., Kahler, J. P., van de Plassche, M. A. T., Vanhoutte, R. & Verhelst, S. H. L. Recent Advances in Activity-Based Protein Profiling of Proteases. Curr. Top. Microbiol. Immunol. 420, 253-281 (2019). [0159] 15. Dudani, J. S., Ibrahim, M., Kirkpatrick, J., Warren, A. D. & Bhatia, S. N. Classification of prostate cancer using a protease activity nanosensor library. Proc. Natl. Acad. Sci. U.S.A 115, 8954-8959 (2018). [0160] 16. Kwon, E. J., Dudani, J. S. & Bhatia, S. N. Ultrasensitive tumour-penetrating nanosensors of protease activity. Nat. Biomed. Eng. 1, (2017). [0161] 17. Matthews, D. J. & Wells, J. A. Substrate phage: selection of protease substrates by monovalent phage display. Science 260, 1113-1117 (1993). [0162] 18. Beck, Z. Q., Hervio, L., Dawson, P. E., Elder, J. H. & Madison, E. L. Identification of efficiently cleaved substrates for HIV-1 protease using a phage display library and use in inhibitor development. Virology 274, 391-401 (2000). [0163] 19. Kretz, C. A., Tomberg, K., Esbroeck, A., Yee, A. & Ginsburg, D. High throughput protease profiling comprehensively defines active site specificity for thrombin and ADAMTS13. Sci. Rep. 8, 2788 (2018). [0164] 20. Xu, G. J. et al. Systematic autoantigen analysis identifies a distinct subtype of scleroderma with coincident cancer. Proc. Natl. Acad. Sci. U.S.A 113, E7526-E7534 (2016). [0165] 21. Franchi, L., Eigenbrod, T., Mufoz-Planillo, R. & Nufez, G. The Inflammasome: A Caspase-1 Activation Platform Regulating Immune Responses and Disease Pathogenesis. Nat. Immunol. 10, 241 (2009). [0166] 22. Shi, J. et al. Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death. Nature 526, 660-665 (2015). [0167] 23. Zhao, Y., Shi, J. & Shao, F. Inflammatory Caspases: Activation and Cleavage of Gasdermin-D In Vitro and During Pyroptosis. Methods Mol. Biol. Clifton N.J. 1714, 131-148 (2018). [0168] 24. Minimal Overlaps from BLAST Alignmentsepitopefindr. https://brandonsie.github.io/epitopefindr/(2019). [0169] 25. Bao, Y. et al. Toward more accurate prediction of caspase cleavage sites: a comprehensive review of current methods, tools and features. Brief. Bioinform. doi:10.1093/bib/bby041. [0170] 26. Kao, S.-H., Wu, H.-T. & Wu, K.-J. Ubiquitination by HUWE1 in tumorigenesis and beyond. J. Biomed. Sci. 25, 67 (2018). [0171] 27. Kurokawa, M. et al. A Network of Substrates of the E3 Ubiquitin Ligases MDM2 and HUWE1 Control Apoptosis Independently of p53. Sci. Signal. 6, ra32-ra32 (2013). [0172] 28. Hall, J. R. et al. Cdc6 Stability Is Regulated by the Huwel Ubiquitin Ligase after DNA Damage. Mol. Biol. Cell 18, 3340-3350 (2007). [0173] 29. Zhong, Q., Gao, W., Du, F. & Wang, X. Mule/ARF-BP1, a BH3-only E3 ubiquitin ligase, catalyzes the polyubiquitination of Mcl-1 and regulates apoptosis. Cell 121, 1085-1095 (2005). [0174] 30. Bertram, A. et al. Circulating ADAM17 Level Reflects Disease Activity in Proteinase-3 ANCA-Associated Vasculitis. J. Am. Soc. Nephrol. JASN 26, 2860-2870 (2015). [0175] 31. Garcia, P. S. et al. Concentration-Dependent Dual Role of Thrombin in Protection of Cultured Rat Cortical Neurons. Neurochem. Res. 40, 2220-2229 (2015). [0176] 32. Allen, G. A. et al. Impact of procoagulant concentration on rate, peak and total thrombin generation in a model system. J. Thromb. Haemost. JTH 2, 402-413 (2004). [0177] 33. Malapeira, J., Esselens, C., Bech-Serra, J. J., Canals, F. & Arribas, J. ADAM17 (TACE) regulates TGF signaling through the cleavage of vasorin. Oncogene 30, 1912-1922 (2011). [0178] 34. Katrukha, I. A. et al. Thrombin-Mediated Degradation of Human Cardiac Troponin T. Clin. Chem. 63, 1094-1100 (2017). [0179] 35. Malapeira, J., Esselens, C., Bech-Serra, J. J., Canals, F. & Arribas, J. ADAM17 (TACE) regulates TGF signaling through the cleavage of vasorin. Oncogene 30, 1912-1922 (2011). [0180] 36. Gooz, M. ADAM-17: the enzyme that does it all. Crit. Rev.
[0181] Biochem. Mol. Biol. (2010) doi:10.3109/10409231003628015. [0182] 37. Mishra, H. K., Ma, J. & Walcheck, B. Ectodomain Shedding by ADAM17: Its Role in Neutrophil Recruitment and the Impairment of This Process during Sepsis. Front. Cell. Infect. Microbiol. 7, (2017). [0183] 38. Mezyk, R., Bzowska, M. & Bereta, J. Structure and functions of tumor necrosis factor-alpha converting enzyme. Acta Biochim. Pol. 50, 625-645 (2003). [0184] 39. VASNVasorin precursorHomo sapiens (Human)VASN gene & protein. https://www.uniprot.org/uniprot/Q6EMK4. [0185] 40. Katrukha, I. A. et al. Thrombin-Mediated Degradation of Human Cardiac Troponin T. Clin. Chem. 63, 1094-1100 (2017). [0186] 41. Howard, A. D. et al. IL-1-CONVERTING ENZYME REQUIRES ASPARTIC ACID RESIDUES FOR PROCESSING OF THE IL-1/3 PRECURSOR AT TWO DISTINCT SITES AND DOES NOT CLEAVE 31-kDa IL-Ia. 7. [0187] 42. Waugh, D. S. An overview of enzymatic reagents for the removal of affinity tags. Protein Expr. Puri/. 80, 283-293 (2011). [0188] 43. Fairhead, M. & Howarth, M. Site-specific biotinylation of purified proteins using BirA. Methods Mol. Biol. Clinton N.J. 1266, 171-184 (2015). [0189] 44. Mohan, D. et al. PhIP-Seq characterization of serum antibodies using oligonucleotide-encoded peptidomes. Nat. Protoc. 13, 1958-1978 (2018). [0190] 45. Larman, H. B. et al. Autoantigen discovery with a synthetic human peptidome. Nat. Biotechnol. 29, 535-541 (2011).