AXL-SPECIFIC ANTIBODY-DRUG CONJUGATES FOR CANCER TREATMENT
20200397913 · 2020-12-24
Inventors
- Julia BOSHUIZEN (Amsterdam, NL)
- Kirstine JACOBSEN (Odense, DK)
- Esther Breij (Utrecht, NL)
- Louise KOOPMAN (Utrecht, NL)
- David Satijn (Utrecht, NL)
- Edward van den Brink (Utrecht, NL)
- Dennis Verzijl (Amstelveen, NL)
- Rob de Jong (Utrecht, NL)
- Riemke Van Dijkhuizen Radersma (Zeist, NL)
- Daniel Simon PEEPER (Amstelveen, NL)
- Henrik Jørn DITZEL (Skanderborg, DK)
- Paul Parren (Odijk, NL)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K47/6801
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K39/001102
HUMAN NECESSITIES
A61K47/6857
HUMAN NECESSITIES
A61K47/6869
HUMAN NECESSITIES
A61K47/6851
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/732
CHEMISTRY; METALLURGY
A61K47/6803
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
A61K47/6855
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
International classification
A61K47/68
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present disclosure relates to antibody-drug conjugates (ADCs) binding to human AXL for therapeutic use, particularly for treatment of resistant or refractory cancers.
Claims
1-84. (canceled)
85. A method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of an antibody-drug conjugate (ADC) comprising an antibody that binds to human AXL, wherein the cancer is resistant to at least one therapeutic agent selected from the group consisting of a tyrosine kinase inhibitor, a serine/threonine kinase inhibitor and a chemotherapeutic agent.
86. The method of claim 85, wherein the tyrosine kinase inhibitor is selected from the group consisting of erlotinib, afatinib, gefitinib, lapatinib, osimertinib, rociletinib, imatinib, sunitinib, crizotinib, midostaurin (PKC412) and quizartinib (AC220); the serine/threonine kinase inhibitor is a BRAF-inhibitor or a MEK-inhibitor; and the chemotherapeutic agent is selected from the group consisting of paclitaxel, docetaxel, cisplatin, metformin, doxorubicin, etoposide, carboplatin, or a combination thereof.
87. The method of claim 85, wherein the cancer is selected from a melanoma, a non-small cell lung cancer (NSCLC), a cervical cancer, an endometrial cancer, an ovarian cancer, a squamous cell carcinoma of the head and neck (SCCHN), a breast cancer, a gastrointestinal stromal tumor (GIST), a renal cancer, a prostate cancer, a neuroblastoma, a pancreatic cancer, an oesophageal cancer, a rhabdomyosarcoma, an acute myeloid leukaemia (AML), or a chronic myeloid leukaemia (CML).
88. The method of claim 85, wherein the cancer is an AXL-expressing melanoma which is (a) resistant to vemurafenib or a therapeutically effective analog or derivative thereof, or (b) resistant to dabrafenib or a therapeutically effective analog or derivative thereof, wherein the melanoma exhibits a mutation in BRAF.
89. The method of claim 85, wherein the cancer is an AXL-expressing cervical cancer which is resistant to paclitaxel or a therapeutically effective analog or derivative thereof, such as docetaxel.
90. The method of claim 85, wherein the ADC comprises a cytotoxic agent, a chemotherapeutic drug or a radioisotope linked to the antibody.
91. The method of claim 90, wherein the cytotoxic agent is linked to the antibody with a cleavable linker or non-cleavable linker
92. The method of claim 91, wherein the linker is mc-vc-PAB and the cytotoxic agent is MMAE.
93. The method of claim 85, wherein the antibody does not compete with Growth Arrest-Specific 6 (Gas6) for binding to human AXL.
94. The method of claim 85, wherein the ADC comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 39, GAS, and 40, respectively, [107]; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 49, AAS, and 50, respectively, [148]; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 117, DAS, and 118, respectively, [733]; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 55, GAS, and 56, respectively, [154]; (e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 55, GAS, and 56, respectively, [154-M103L]; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 60, GAS, and 61, respectively, [171]; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 65, GAS, and 66, respectively, [172]; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 70, GAS, and 71, respectively, [181]; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 76, ATS, and 77, respectively, [183]; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 76, ATS, and 77, respectively, [183-N52Q]; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 81, AAS, and 82, respectively, [187]; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 86, GAS, and 87, respectively, [608-01]; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 91, GAS, and 92, respectively, [610-01]; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 96, GAS, and 97, respectively, [613]; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 101, DAS, and 102, respectively, [613-08]; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 106, GAS, and 107, respectively, [620-06]; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 112, AAS, and 113, respectively, [726]; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 112, AAS, and 113, respectively, [726-M101L]; (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 44, AAS, and 45, respectively, [140]; (t) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 93, 94, and 95, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 128, XAS, wherein X is D or G, and 129, respectively, [613/613-08]; (u) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 49, AAS, and 50, respectively, [148/140]; (v) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 60, GAS, and 61, respectively [171/172/181]; and (w) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 112, AAS, and 113, respectively, [726/187]; and (x) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 96, GAS, and 97, respectively, [613/608-01/610-01/620-06].
95. The method of claim 85, wherein the antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 1 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 2 [107]; (b) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 5 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 6 [148]; (c) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 34 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 35 [733]; (d) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 7 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 9 [154]; (e) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 10 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 11 [171]; (f) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 16 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 18 [183]; (g) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 25 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 26 [613]; (h) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 31 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 33 [726]; (i) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 3 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 4 [140]; (j) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 8 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 9 [154-M103L]; (k) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 12 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 13 [172]; (l) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 14 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 15 [181]; (m) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 17 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 18 [183-N52Q]; (n) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 19 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 20 [187]; (o) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 21 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 22 [608-01]; (p) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 23 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 24 [610-01]; (q) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 27 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 28 [613-08]; (r) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 29 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 30 [620-06]; and (s) a VH region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 32 and a VL region at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to SEQ ID NO: 33 [726-M101L].
96. The method of claim 85, wherein the antibody comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 39, GAS, and 40, respectively, [107], the linker is mc-vc-PAB, and the cytotoxic agent is MMAE.
97. The method of claim 85, wherein the antibody comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 39, GAS, and 40, respectively, [107], the linker is SSP, and the cytotoxic agent is DM1.
98. The method of claim 85, wherein the antibody binds to (a) an epitope within the Ig1 domain of AXL, the epitope comprising or requiring one or more amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL, (b) an epitope within the Ig2 domain of AXL, the epitope comprising or requiring the amino acids corresponding to position D170 or the combination of D179 and one or more amino acids corresponding to positions T182 to R190 of human A, (c) an epitope within the FN1 domain of human AXL, the epitope comprises or requires one or more amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL, or (d) an epitope within the FN2 domain of human AXL, the epitope comprises or requires the amino acids corresponding to positions A359, R386, and one or more amino acids corresponding to positions Q436 to K439 of human AXL.
99. The method of claim 85, wherein the antibody comprises a heavy chain of an isotype selected from the group consisting of IgG1, IgG2, IgG3, and IgG4.
100. The method of claim 85, wherein the antibody is a full-length monoclonal antibody, such as a full-length monoclonal IgG1, antibody, or a single chain antibody.
101. The method of claim 85, wherein the antibody is an effector-function-deficient antibody, a stabilized IgG4 antibody or a monovalent antibody.
102. The method of claim 101, wherein the heavy chain has been modified such that (a) the entire hinge region has been deleted or (b) it does not comprise any acceptor sites for N-linked glycosylation.
103. The method of claim 94, wherein the antibody is a bispecific antibody.
104. The method of claim 103, wherein the bispecific antibody comprises a first and a second heavy chain, each of the first and second heavy chain comprises at least a hinge region, a CH2 and CH3 region, wherein in the first heavy chain at least one of the amino acids in the positions corresponding to positions selected from the group consisting of K409, T366, L368, K370, D399, F405, and Y407 in a human IgG1 heavy chain has been substituted, and in the second heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of F405, T366, L368, K370, D399, Y407, and K409 in a human IgG1 heavy chain has been substituted, and wherein the substitutions of the first and the second heavy chains are not in the same positions.
105. The method of claim 85, wherein the antibody is comprised in a pharmaceutical composition comprising a pharmaceutical acceptable carrier.
Description
LEGENDS TO THE FIGURES
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
DETAILED DISCLOSURE OF THE INVENTION
Therapeutic Applications
[0051] The invention relates to AXL-specific ADCs (also referred to as AXL-ADCs herein) as defined in any aspect or embodiment herein, for use in treating cancers or tumors which are resistant, or which have a high tendency to become resistant, to certain chemotherapeutics, tyrosine kinase inhibitors (e.g., EGFR inhibitors), serine/threonine kinase inhibitors (e.g., BRAF inhibitors), PI3K inhibitors and antagonistic antibodies to receptor tyrosine kinases, as described herein.
[0052] The present invention is based, at least in part, on the discovery that AXL-ADCs are effective both in vitro and in vivo in inducing cytotoxicity in tumor cells resistant to EGFR targeted therapy, BRAF/MEK-targeted therapy or microtubule-targeting agents. For example, NSCLC cells with acquired resistance to the EGFR inhibitors erlotinib, gefitinib and afatinib showed reduced viability upon treatment with AXL-ADC (Example 21), and erlotinib-resistant models with different EGFR gene status showed sensitivity for AXL-ADC (Example 22; Table 17). Notably, in several tumor models where treatment with the EGFR inhibitor erlotinib did not induce anti-tumor activity, treatment with AXL-ADC or a combination of AXL-ADC and erlotinib induced potent anti-tumor activity (Example 22). For example, an erlotinib-resistant cell-line derived from an erlotinib-sensitive cell-line was particularly sensitive to AXL-ADCa stronger anti-tumor activity was obtained at a lower dose (Example 22). In addition, melanoma cell lines resistant to the BRAF-inhibitors PLX4720 (an analog of vemurafenib) or dabrafenib showed enhanced expression of AXL and were sensitive to treatment with AXL-ADC, and AXL-ADC showed strong anti-tumor activity in an in vivo melanoma model resistant to PLX4720 (Example 23). Moreover, AXL-ADC induced complete or partial tumor regression in a tumor model of cervical cancer where tumors had progressed after treatment with paclitaxel (Example 24).
[0053] So, in one aspect, the invention provides an AXL-ADC, e.g., HuMax-AXL-ADC, for use in treating cancer resistant and/or having a high tendency to become resistant to at least one therapeutic agent selected from the group consisting of a tyrosine kinase inhibitor, a PI3K inhibitor, an antagonistic antibody to a receptor tyrosine kinase, a serine/threonine kinase inhibitor and a chemotherapeutic agent. In a particular embodiment, the therapeutic agent is selected from a tyrosine kinase inhibitor, a serine/threonine kinase inhibitor and a chemotherapeutic agent.
[0054] In another aspect, the invention provides an AXL-ADC, e.g., HuMax-AXL-ADC, for use in treating a cancer in combination with a therapeutic agent selected from a chemotherapeutic agent, a tyrosine kinase inhibitor, a PI3K inhibitor, an antagonistic antibody to a receptor tyrosine kinase, and a serine/threonine kinase inhibitor, wherein the ADC and therapeutic agent are administered simultaneously, separately or sequentially. The cancer may be resistant to the therapeutic agent and/or may have a high tendency to become resistant to the therapeutic agent. In a particular embodiment, the therapeutic agent is selected from a tyrosine kinase inhibitor, a serine/threonine kinase inhibitor and a chemotherapeutic agent.
[0055] As used herein, a resistant, treatment-resistant or refractory cancer, tumor or the like, means a cancer or tumor in a subject, wherein the cancer or tumor did not respond to treatment with a therapeutic agent from the onset of the treatment (herein referred to as native resistance) or initially responded to treatment with the therapeutic agent but became non-responsive or less responsive to the therapeutic agent after a certain period of treatment (herein referred to as acquired resistance), resulting in progressive disease. For solid tumors, also an initial stabilization of disease represents an initial response. Other indicators of resistance include recurrence of a cancer, increase of tumor burden, newly identified metastases or the like, despite treatment with the therapeutic agent. Whether a tumor or cancer is, or has a high tendency of becoming, resistant to a therapeutic agent can be determined by a person of skill in the art. For example, the National Comprehensive Cancer Network (NCCN, www.nccn.org) and European Society for Medical Oncology (ESMO, www.esrno.org/Guidelines) provide guidelines for assessing whether a specific cancer responds to treatment. As described in Table 1 below and elsewhere herein, cancers or tumors developing resistance to certain chemotherapeutics (e.g., microtubule-targeting agents (MTAs) such as taxanes), to tyrosine kinase inhibitors (e.g., EGFR inhibitors), to serine/threonine kinase inhibitors (e.g., BRAF- or MEK-inhibitors), to PI3K inhibitors and to antagonistic antibodies have been found to express AXL.
[0056] As used herein, the term subject is typically a human to whom the AXL-ADC is administered, including for instance human patients diagnosed as having a cancer that may be treated by killing of AXL-expressing cells, directly or indirectly.
[0057] As used herein, a cancer which has a high tendency for resistance to a specific therapeutic agent is a cancer which is known to be associated with a high tendency of being or becoming resistant or refractory to treatment with a certain class of drugs. For example, a cancer patient who is being treated or who has been found to eligible for treatment with a therapeutic agent as described herein for which there is a correlation between resistance and enhanced or de novo expression of AXL, suffers from a cancer having a high tendency for resistance. Non-limiting examples of cancers and therapeutic agents known to be associated with enhanced or de novo expression of AXL and which are thus may have a high tendency to become resistant to the therapeutic agent, are shown in Table 1 below. Moreover, as shown in Example 24, AXL-ADC induced complete or partial tumor regression in a tumor model of cervical cancer where tumors had progressed after treatment with paclitaxel. Other cancers and tumor types with native or acquired resistance to a therapeutic agent and sensitive to AXL-ADC treatment are also described elsewhere herein.
TABLE-US-00001 TABLE 1 Examples of therapeutic agents inducing enhanced or de novo expression of AXL Tumor type Compound Target/MoA Class Ref NSCLC Erlotinib EGFR TKI Zhang (2012), Wilson (2014) NSCLC Crizotinib ALK TKI Kim (2013) Breast Lapatinib HER2, EGFR TKI Liu (2009) cancer Breast Afatinib EGFR TKI Zhang (2012) cancer GIST Imatinib, ABL/PDGFR/ TKI Mahadevan sunitinib cKIT (2015) Renal cancer Sunitinib VEGFR/ TKI Zhou (2015) PDGFR/ cKIT Neuro- Crizotinib ALK TKI Debruyne blastoma (2015) AML midostaurin FLT3 TKI Park (2015) (PKC412) AML Quizartinib FLT3 TKI Park (2015) (AC220) CML Imatinib ABL/ TKI Dufies (2011) PDGFR/ cKIT SCCHN Alpelisib PI3K PI3KI Elkabets (BYL719) (2015) SCCHN Cetuximab EGFR mAb/ Brand (2015) rTKI Rhabdomyo- MAB391 IGF-IR mAb/ Huang (2010) sarcoma rTKI Melanoma Vemurafenib BRAF S/Th KI Mller (2014) (PLX4032) BRAF Konieczkowski PLX4720;* MEK (2014) Selumetinib (AZD6244);** VTX11E*** ERK2 Pancreatic Selumetinib MEK S/Th KI Pettazzoni Cancer (AZD6244) (2015) Esophageal Cisplatin DNA Chemo Hong (2013) cancer crosslinking Prostate Metformin Diabetic drug, Chemo Bansal (2015) cancer cytostatic AML Doxorubicin, Upregulation Chemo Hong (2008) etoposide, resistance cisplatin pumps SCCHN Cisplatin/ DNA Chemo Brand (2015) carboplatin crosslinking *N-(3-(5-chloro-1H-pyrrolo[2,3-b]pyridine-3-carbonyl)-2,4-difluorophenyl)propane-1-sulfonamide **6-(4-bromo-2-chloroanilino)-7-fluoro-N-(2-hydroxyethoxy)-3-methylbenzimidazole-5-carboxamide ***4-[2-(2-Chloro-4-fluoroanilino)-5-methylpyrimidin-4-yl]-N-[(1S)-1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
[0058] A tyrosine-kinase inhibitor or TKI as used herein refers to a compound, typically a pharmaceutical, which inhibits tyrosine kinases or down-stream signaling from tyrosine kinases. Tyrosine kinases are enzymes responsible for the addition of a phosphate group to a tyrosine of a protein (phosphorylation), a step that TKIs inhibit, either directly or indirectly. Tyrosine phosphorylation results in the activation of intracellular signal transduction cascades. Many TKIs are useful for cancer therapy. Non-limiting examples of such TKIs and their targets are shown in Table 1 above, and include, e.g., EGFR inhibitors such as erlotinib. In one embodiment, the term tyrosine kinase inhibitor as used herein refer to compounds which specifically inhibit the protein phosphorylation activity of a tyrosine kinase, e.g., the tyrosine kinase activity of the EGFR.
[0059] While many TKIs in clinical use are small molecule pharmaceuticals, there are also receptor tyrosine kinase inhibitors (rTKIs) such as antagonistic antibodies which bind to the extracellular portion of a receptor tyrosine kinase (herein referred to as mAb/rTKIs), thereby inhibiting receptor-mediated signaling. Examples of such antibodies are cetuximab and MAB391.
[0060] A phosphoinositide 3-kinase inhibitor or PI3KI as used herein refers to a compound, typically a pharmaceutical, which inhibits an enzyme in the PI3K/AKT pathway. Examples of PI3KIs include Alpelisib (BYL791).
[0061] A serine/threonine kinase inhibitor or S/Th KI, as used herein, refers to a compound, typically a pharmaceutical, which inhibits serine/threonine kinases such as BRAF or MEK or down-stream signaling pathways from such serine/threonine kinases such as via the BRAF/MEK pathways. Serine/threonine kinases are enzymes responsible for the phosphorylation of the hydroxyl-group of a serine or threonine residue, a step that S/Th KIs inhibit, either directly or indirectly. Phosphorylation of serines or threonines results in the activation of intracellular signal transduction cascades. Examples of S/Th KIs useful for cancer therapy, and their targets, are shown in Table 1 above, and include BRAF-inhibitors such as vemurafenib and analogs or derivatives thereof. In one embodiment, the term serine/threonine kinase inhibitor as used herein refer to compounds which specifically inhibit the protein phosphorylation activity of a serine/threonine kinase, e.g., the serine/threonine kinase activity of a mutant BRAF or MEK.
[0062] Vemurafenib (PLX4032) is an orally bioavailable, ATP-competitive, small-molecule inhibitor of mutated BRAF kinase, which selectively binds to and inhibits BRAF comprising certain mutations, resulting in an inhibition of an over-activated MAPK signaling pathway downstream in the mutant BRAF kinase-expressing tumor cells. BRAF mutations identified in human cancers are generally located in the glycine-rich P loop of the N lobe and the activation segment and flanking regions within the kinase domain. Vemurafenib binds to and inhibits BRAF kinase having certain of these mutations, such as, but not limited to, an amino acid substitution in residue V600 (e.g., V600E), residue L597 (e.g., L597R; Bahadoran et al., 2013); and residue K601 (Dahlman et al., 2012).
[0063] As used herein, a derivative of a drug is a compound that is derived or derivable, by a direct chemical reaction, from the drug. As used herein, an analog or structural analog of a drug is a compound having a similar structure and/or mechanism of action to the drug but differing in at least one structural element. Therapeutically active analogs or derivatives of a drug such as, e.g., vemurafenib or erlotinib, have a similar or improved therapeutic efficacy as compared to the drug but may differ in, e.g., one or more of stability, target specificity, solubility, toxicity, and the like.
[0064] Tables 2 and 3 below show BRAF and EGFR inhibitors which have a similar mechanism of action (BRAF or EGFR inhibition, respectively) as vemurafenib and erlotinib, respectively.
TABLE-US-00002 TABLE 2 BRAF inhibitors Inhibitor Name Vemurafenib (PLX4032) Bollag (2012) (PLX4720 = tool compound) GDC-0879 * Wong (2009) Dabrafenib (GSK2118436) Hong (2012) Encorafenib (LGX818) Li (2016) Sorafenib (BAY 43-9006) Hilger (2002) RAF265 (CHIR-265) Mordant (2010) SB590885 ** King (2006) AZ628 *** Montagut (2008) * (E)-5-(1-(2-hydroxyethyl)-3-(pyridin-4-yl)-1H-pyrazol-4-yl)-2,3-dihydroinclen-1-one oxime ** (E)-5-(2-(4-(2-(dimethylamino)ethoxy)phenyl)-4-(pyridin-4-yl)-1H-imidazol-5-yl)-2,3-dihydroinden-l-one oxime *** 3-(2-cyanopropan-2-yl)-N-(4-methyl-3-(3-methyl-4-oxo-3,4-dihydroquinazolin-6-ylamino)phenyl)benzamide
TABLE-US-00003 TABLE 3 EGFR inhibitors Name Class Erlotinib TKI Pollack (1999) Gefitinib TKI Sirotnak (2000) Afatinib TKI Li (2008) Lapatinib TKI Xia (2002) Icotinib TKI Tan 2012 Vandetanib TKI Herbst (2007) Osimertinib TKI Greig (2016) Rociletinib TKI Sequist (2015) Cetuximab mAb/rTKI Prewett (1996) Panitumumab mAb/rTKI Yang (2001) zalutumumab mAb/rTKI Bleeker (2004) Nimotuzumab mAb/rTKI Talavera (2009) Matuzumab mAb/rTKI Kim (2004) necitumumab mAb/rTKI Li (2008) (IMC-11F8) sym004 mAb/rTKI Pedersen (2010) mab 806 mAb/rTKI Mishima (2001) MM-151 mAb/rTKI Merrimack
[0065] Accordingly, as shown herein, melanoma resistance to vemurafenib, dabrafenib, trametinib or combinations of any two or more thereof; and NSCLC resistance to erlotinib, gefitinib or afatinib, or combinations of any two or more thereof, may be associated with de novo or enhanced expression of AXL by the tumor cells. Thus, such tumors may be eligible for treatment with an AXL-specific ADC.
[0066] In one aspect, the invention provides a method of treating a cancer in a subject, wherein the cancer is resistant to at least one therapeutic agent selected from a tyrosine kinase inhibitor, a serine/threonine kinase inhibitor, and a chemotherapeutic agent, the method comprising administering an AXL-ADC. The cancer may for example, have acquired the resistance during a previous or still on-going treatment with the therapeutic agent. Alternatively, the cancer was resistant from the onset of treatment with the therapeutic agent. In one embodiment, the cancer is an AXL-expressing cancer. In other aspects, the therapeutic agent is a PI3K inhibitor or a mAb/rTKI.
[0067] In one aspect, the invention provides a method of treating a cancer in a subject, the method comprising administering an AXL-ADC in combination with at least one therapeutic agent selected from a chemotherapeutic agent, a tyrosine kinase inhibitor or a serine/threonine kinase inhibitor, wherein the ADC and therapeutic agent are administered simultaneously, separately or sequentially. In one embodiment, the cancer has a high tendency for resistance to the therapeutic agent. In one embodiment, the cancer is resistant to the therapeutic agent. In other aspects, the therapeutic agent is a PI3K inhibitor or a mAb/rTKI.
[0068] As shown by the inventors of the present invention and in Table 1 above, in certain types of cancer, the development of resistance has been associated with increased or de novo expression of AXL. Such cancers may include, but are not limited to, melanoma, non-small cell lung cancer (NSCLC), cervical cancer, ovarian cancer, squamous cell carcinoma of the head and neck (SCCHN), breast cancer, gastrointestinal stromal tumors (GISTs), renal cancer, neuroblastoma, esophageal cancer, rhabdomyosarcoma, acute myeloid leukaemia (AML), an chronic myeloid leukaemia (CML).
[0069] In one embodiment of any preceding aspect or embodiment, the cancer or tumor is selected from cervical cancer, melanoma, NSCLC, SCCHN, breast cancer, GIST, renal cancer, neuroblastoma, esophageal cancer and rhabdomyosarcoma. In another embodiment, the cancer is a hematological cancer selected from AML and CML.
[0070] In a particular embodiment, the cancer or tumor is characterized by at least one mutation in the EGFR amino acid sequence selected from L858R and T790M, such as e.g., L858R or T790M/L858R. For example, the cancer or tumor may be an NSCLC.
[0071] In one embodiment, the at least one therapeutic agent consists of or comprises a TKI inhibitor which is an EGFR antagonist, a HER2 antagonist, an ALK-inhibitor, a FLT3 inhibitor, or a combination of two or more thereof. Non-limiting, preferred TKIs include erlotinib, gefitinib, lapatinib, osimertinib, rociletinib, imatinib, sunitinib, afanitib, crizotinib, midostaurin (PKC412) and quizartinib (AC220). In one embodiment, the TKI is an EGFR inhibitor, such as erlotinib or a therapeutically active analog or derivative thereof, e.g., afatinib, lapatinib, osimertinib, rociletinib, or gefitinib.
[0072] In one particular embodiment, the tyrosine kinase inhibitor is erlotinib and the cancer is an NSCLC, resistant to or having a high tendency for becoming resistant to erlotinib.
[0073] In one particular embodiment, the tyrosine kinase inhibitor is erlotinib and the cancer is a pancreatic cancer, resistant to or having a high tendency for becoming resistant to erlotinib.
[0074] In one particular embodiment, the tyrosine kinase inhibitor is gefitinib and the cancer is an NSCLC, resistant to or having a high tendency for becoming resistant to gefitinib.
[0075] In one particular embodiment, the tyrosine kinase inhibitor is crizotinib and the cancer is a NSCLC, resistant to or having a high tendency for becoming resistant to crizotinib.
[0076] In one particular embodiment, the tyrosine kinase inhibitor is lapatinib and the cancer is a breast cancer, resistant to or having a high tendency for becoming resistant to lapatinib.
[0077] In one particular embodiment, the tyrosine kinase inhibitor is imatinib and the cancer is a CML, resistant to or having a high tendency for becoming resistant to imatinib.
[0078] In one particular embodiment, the tyrosine kinase inhibitor is imatinib and the cancer is a GIST, resistant to or having a high tendency for becoming resistant to imatinib.
[0079] In one particular embodiment, the tyrosine kinase inhibitor is sunitinib and the cancer is a GIST, resistant to or having a high tendency for becoming resistant to sunitinib.
[0080] In one particular embodiment, the tyrosine kinase inhibitor is sunitinib and the cancer is a renal cancer, resistant to or having a high tendency for becoming resistant to sunitinib.
[0081] In one particular embodiment, the tyrosine kinase inhibitor is crizotinib and the cancer is a neuroblastoma, resistant to or having a high tendency for becoming resistant to crizotinib.
[0082] In one particular embodiment, the tyrosine kinase inhibitor is midostaurin (PKC412) and the cancer is AML, resistant to or having a high tendency for becoming resistant to midostaurin.
[0083] In one particular embodiment, the tyrosine kinase inhibitor is quizartinib and the cancer is an AML resistant to or having a high tendency for becoming resistant to quizartinib.
[0084] In one particular embodiment, tyrosine kinase inhibitor is afatinib and the cancer is a breast cancer, resistant to or having a high tendency for becoming resistant to afatinib.
[0085] In one particular embodiment, tyrosine kinase inhibitor is axitinib and the cancer is a renal cancer, resistant to or having a high tendency for becoming resistant to axitinib.
[0086] In one particular embodiment, tyrosine kinase inhibitor is lenvatinib and the cancer is a thyroid cancer, resistant to or having a high tendency for becoming resistant to lenvatinib.
[0087] Particularly contemplated are embodiments where the tyrosine kinase inhibitor is an EGFR-inhibiting agent, such as, e.g., erlotinib or a therapeutically active analog or derivative thereof, preferably wherein the cancer is an NSCLC, resistant to or having a high tendency for becoming resistant to the EGFR-inhibiting agent. In a specific embodiment, the cancer or tumor (e.g., the NSCLC) is characterized by at least one mutation in the EGFR selected from L858R and T790M, or a combination thereof.
[0088] In one embodiment, the at least one therapeutic agent consists of or comprises a PI3K inhibitor. Non-limiting, preferred PI3K inhibitors include alpelisib and therapeutically active analogs and derivatives thereof.
[0089] In one particular embodiment, the PI3Ki is alpelisib (BYL719) and the cancer is a SCCHN, resistant to or having a high tendency for becoming resistant to alpelisib.
[0090] In one embodiment, the at least one therapeutic agent consists of or comprises an antagonistic antibody which binds to the extracellular portion of a receptor tyrosine kinase. Non-limiting, preferred mAb/rTKIs include cetuximab and anti-IGF-IR MAB391 as well as therapeutically active analogs or derivatives of cetuximab and MAB391.
[0091] In one particular embodiment, the mAb/rTKI is cetuximab and the cancer is a SCCHN, resistant to or having a high tendency for becoming resistant to cetuximab.
[0092] In one particular embodiment, the mAb/rTKI is anti-IGF-IR antibody MAB391 and the cancer is an SCCHN, resistant to or having a high tendency for becoming resistant to MAB391.
[0093] In one embodiment, the at least one therapeutic agent consists of or comprises a S/Th KI which is a BRAF-inhibitor, MEK-inhibitor or a combination thereof. In one embodiment, the S/Th KI is a BRAF-inhibitor, such as vemurafenib (PLX4032) or a therapeutically effective derivative or analog thereof, e.g., PLX4720 or dabrafenib; or VTXKIIE. In one embodiment, the S/Th KI is a MEK-inhibitor, such as selumetinib (AZD6244) or trametinib.
[0094] In one particular embodiment, the S/Th KI is vemurafenib and the cancer is a melanoma, resistant to or having a high tendency for becoming resistant to vemurafenib.
[0095] In one particular embodiment, the S/Th KI is vemurafenib and the cancer is a colorectal cancer, resistant to or having a high tendency for becoming resistant to vemurafenib.
[0096] In one particular embodiment, the s/Th KI is dabrafenib and the cancer is a melanoma, resistant to or having a high tendency for becoming resistant to dabrafenib.
[0097] In one particular embodiment, the S/Th KI is dabrafenib and the cancer is a colorectal cancer, resistant to or having a high tendency for becoming resistant to dabrafenib.
[0098] In one particular embodiment, the S/Th KI is selumetinib and the cancer is a pancreatic cancer, resistant to or having a high tendency for becoming resistant to selumetinib.
[0099] In one particular embodiment, the S/Th KI is selumetinib and the cancer is a melanoma, resistant to or having a high tendency for becoming resistant to selumetinib.
[0100] In one particular embodiment, the S/Th KI inhibitor is trametinib and the tumor is a melanoma, resistant to or having a high tendency for becoming resistant to trametinib.
[0101] In one particular embodiment, the S/Th KI is VTXKIIE and the cancer is a melanoma, resistant to or having a high tendency for becoming resistant to VTXKIIE.
[0102] In one particular embodiment, the S/Th KI is PLX4720 and the cancer is a melanoma, resistant to or having a high tendency for becoming resistant to PLX4720.
[0103] In one embodiment, the at least one therapeutic agent consists of or comprises a BRAF inhibitor. In a particular embodiment, the BRAF inhibitor is vemurafenib (PLX4032) or a therapeutically effective analog or derivative thereof, such as dabrafenib or PLX4720. In another particular embodiment, the BRAF inhibitor is vemurafenib or a therapeutically active derivative or analog thereof, and the tumor is a melanoma resistant to or having a high tendency for becoming resistant to vemurafenib. Vemurafenib is an inhibitor of BRAF kinase harboring certain mutations, such as mutations located in the glycine-rich P loop of the N lobe and the activation segment and flanking regions within the kinase domain. In one embodiment, the vemurafenib analog is dabrafenib.
[0104] Accordingly, in one particular embodiment, the AXL-ADC provided by the present disclosure is for use in treating an AXL-expressing melanoma resistant to a therapeutic agent with which the melanoma is being or has been treated, wherein the therapeutic agent is vemurafenib or a therapeutically effective analog or derivative thereof, and wherein the melanoma exhibits a mutation in BRAF. In particular, the melanoma exhibits a mutation in BRAF which renders the BRAF sensitive for inhibition by vemurafenib or the therapeutically effective analog or derivative. Non-limiting mutations include amino acid substitutions, deletions or insertions; preferably, the mutation is an amino acid substitution. Specific residues for such mutations include, but are not limited to, V600 (e.g., V600E, V600K and V600D), residue L597 (e.g., L597R); and residue K601 (K601E). In one embodiment, the mutation is selected from V600E, V600D, V600K, L597R and K601E.
[0105] In one embodiment, the at least one therapeutic agent consists of or comprises a chemotherapeutic agent selected from the group consisting of paclitaxel, docetaxel, cisplatin, doxorubicin, etoposide, carboplatin and metformin. In one embodiment, the therapeutic agent is a microtubule-targeting agent, such as, e.g., paclitaxel, docetaxel or vincristine, or a therapeutically active analog or derivative of any thereof. In one embodiment, the at least one therapeutic agent is a taxane, such as paclitaxel, docetaxel or a therapeutically active analog or derivative of paclitaxel or docetaxel.
[0106] In one particular embodiment, the chemotherapeutic agent is paclitaxel, and the cancer is cervical cancer, resistant to or having a high tendency for becoming resistant to paclitaxel.
[0107] In one particular embodiment, the chemotherapeutic agent is paclitaxel, and the cancer is an NSCLC, resistant to or having a high tendency for becoming resistant to paclitaxel.
[0108] In one particular embodiment, the chemotherapeutic agent is paclitaxel, and the cancer is an ovarian cancer, resistant to or having a high tendency for becoming resistant to paclitaxel.
[0109] In one particular embodiment, the chemotherapeutic is docetaxel and the cancer is a head and neck cancer, resistant to or having a high tendency for becoming resistant to docetaxel.
[0110] In one particular embodiment, the chemotherapeutic is docetaxel and the cancer is a gastric cancer, resistant to or having a high tendency for becoming resistant to docetaxel.
[0111] In one particular embodiment, the chemotherapeutic is docetaxel and the cancer is a breast cancer, resistant to or having a high tendency for becoming resistant to docetaxel.
[0112] In one particular embodiment, the chemotherapeutic is docetaxel and the cancer is a prostate cancer, resistant to or having a high tendency for becoming resistant to docetaxel.
[0113] In one particular embodiment, the chemotherapeutic is docetaxel and the cancer is a NSCLC, resistant to or having a high tendency for becoming resistant to docetaxel.
[0114] In one particular embodiment, the chemotherapeutic agent is cisplatin, and the cancer is an esophageal cancer, resistant to or having a high tendency for becoming resistant to cisplatin.
[0115] In one particular embodiment, the chemotherapeutic agent is cisplatin, and the cancer is an SCCHN, resistant to or having a high tendency for becoming resistant to cisplatin.
[0116] In one particular embodiment, the chemotherapeutic agent is carboplatin, and the cancer is an SCCHN, resistant to or having a high tendency for becoming resistant to carboplatin.
[0117] In one particular embodiment, the chemotherapeutic agent is cisplatin, and the cancer is an AML, resistant to or having a high tendency for becoming resistant to cisplatin.
[0118] In one particular embodiment, the chemotherapeutic agent is doxorubicin, and the cancer is an AML, resistant to or having a high tendency for becoming resistant to doxorubicin.
[0119] In one particular embodiment, the chemotherapeutic agent is etoposide, and the cancer is an AML, resistant to or having a high tendency for becoming resistant to etoposide.
[0120] In one particular embodiment, the chemotherapeutic agent is metformin, and the cancer is a prostate cancer, resistant to or having a high tendency for becoming resistant to metformin.
[0121] In one particular embodiment, the chemotherapeutic agent is cisplatin, and the cancer is an ovarian cancer, resistant to or having a high tendency for becoming resistant to cisplatin.
[0122] In one particular embodiment, the chemotherapeutic agent is doxorubicin, and the cancer is a non-small cell lung cancer (NSCLC), resistant to or having a high tendency for becoming resistant to doxorubicin.
[0123] In one particular embodiment, the chemotherapeutic agent is temozolomide, and the tumor is an astrocytoma, resistant to or having a high tendency for becoming resistant to temozolomide.
[0124] In one particular embodiment, the chemotherapeutic agent is carboplatin, and the tumor is an astrocytoma, resistant to or having a high tendency for becoming resistant to carboplatin.
[0125] In one particular embodiment, the chemotherapeutic agent is vincristine, and the tumor is an astrocytoma, resistant to or having a high tendency for becoming resistant to vincristine.
[0126] So, in one aspect, the invention relates to a method of treating a cancer in a subject in need thereof, wherein the cancer is, or has a high tendency for becoming, resistant to a therapeutic agent selected from a chemotherapeutic agent, a tyrosine kinase inhibitor, a PI3K inhibitor, a mAb/rTKI and a serine/threonine kinase inhibitor, comprising administering to the subject a therapeutically effective amount of an ADC comprising an antibody binding to human AXL. In one embodiment, the therapeutic agent is selected from a chemotherapeutic agent, a tyrosine kinase inhibitor and a serine/threonine kinase inhibitor. For example, the chemotherapeutic agent may be a taxane, the tyrosine kinase inhibitor may be an EGFR-inhibitor, and the serine/threonine kinase inhibitor may be a BRAF- or MEK-inhibitor. In one embodiment, the cancer is an AXL-expressing cancer.
[0127] In one embodiment, the invention relates to a method of treating a NSCLC resistant to erlotinib in a subject, the method comprising administering to the subject an ADC comprising an antibody binding to human AXL. In one embodiment, the method further comprises administering erlotinib, or an analog or derivative thereof, to the subject. In one embodiment, the cancer is an AXL-expressing cancer.
[0128] In one embodiment, the invention relates to a method of treating a melanoma resistant to vemurafenib in a subject, wherein the melanoma exhibits a mutation in BRAF and the mutation providing for vemurafenib inhibition of BRAF kinase activity of the mutant BRAF, the method comprising administering to the subject an ADC comprising an antibody binding to human AXL. In one embodiment, the mutation is an amino acid substitution in residue V600, L597 and/or K601. In one embodiment, the mutation is selected from V600E, V600D, V600K, L597R and K601E. In one embodiment, the method further comprises administering vemurafenib, or an analog or derivative thereof, to the subject. In one embodiment, the analog is dabrafenib. In one embodiment, the cancer is an AXL-expressing cancer.
[0129] In one embodiment, the invention relates to a method of treating a cervical cancer resistant to paclitaxel in a subject, the method comprising administering to the subject an ADC comprising an antibody binding to human AXL. In one embodiment, the method further comprises administering paclitaxel, or an analog or derivative thereof, to the subject. In one embodiment, the cancer is an AXL-expressing cancer.
[0130] As for the AXL-ADC, a physician having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required. In relation hereto, when referring to a pharmaceutical composition it is to be understood also to comprise a composition as such, or vice versa. For example, the physician could start doses of the AXL-ADC employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. In general, a suitable dose will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect according to a particular dosage regimen. Such an effective dose will generally depend upon the factors described above.
[0131] For example, an effective amount for therapeutic use may be measured by its ability to stabilize the progression of disease. The ability of a compound to inhibit cancer may, for example, be evaluated in an animal model system predictive of efficacy in human tumors. Alternatively, this property of a composition may be evaluated by examining the ability of the compound to inhibit cell growth or to induce cytotoxicity by in vitro assays known to the skilled practitioner. A therapeutically effective amount of a therapeutic compound may decrease tumor size, or otherwise ameliorate symptoms in a subject. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected. For example, as already indicated, the National Comprehensive Cancer Network (NCCN, www.nccn.org) and European Society for Medical Oncology (ESMO, www.esmo.org/Guidelines) guidelines for assessing cancer treatments can be used.
[0132] An exemplary, non-limiting range for a therapeutically effective amount of an AXL-ADC of the invention is 0.02-100 mg/kg, such as about 0.02-30 mg/kg, such as about 0.05-10 mg/kg, 0.1-5 mg/kg or 0.1-3 mg/kg, for example about 0.5-3 mg/kg or 0.5-2 mg/kg.
[0133] Administration may e.g. be intravenous, intramuscular, intraperitoneal, or subcutaneous, and for instance administered proximal to the site of the target.
[0134] Dosage regimens in the above methods of treatment and uses are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
[0135] In one embodiment, the efficacy-safety window is optimized by lowering specific toxicity such as for example by lowering the drug-antibody ratio (DAR) and/or mixing of AXL-ADC with unlabeled anti-AXL antibody.
[0136] In one embodiment, the efficacy of the treatment is monitored during the therapy, e.g. at predefined points in time. Methods for measuring efficacy generally depend on the particular type of cancer and are well known to a person skilled in the art. In one embodiment, the efficacy may be monitored, by visualization of the disease area, or by other diagnostic methods described further herein, e.g. by performing one or more PET-CT scans, for example using a labeled anti-AXL antibody, fragment or mini-antibody derived from an AXL-specific antibody.
[0137] If desired, an effective daily dose of a an AXL-ADC may be two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. In another embodiment, the AXL-ADCs are administered by slow continuous infusion over a long period, such as more than 24 hours, in order to minimize any unwanted side effects.
[0138] An effective dose of an AXL-ADC may also be administered using a weekly, biweekly or triweekly dosing period. The dosing period may be restricted to, e.g., 8 weeks, 12 weeks or until clinical progression has been established. In one embodiment, an AXL-ADC is administered either once every 3 weeks (103W) or three administrations over 4 weeks (304W) so that the patient receives sixteen or twelve cycles of AXL-ADC at three week or four-week intervals for, e.g., 48 weeks, extending or repeating the regimen as needed.
[0139] For example, in one embodiment, the AXL-ADC may be administered by infusion in a weekly dosage of between 10 and 500 mg/m.sup.2, such as between 200 and 400 mg/m.sup.2. Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as from 1 to 12 hours.
[0140] In another embodiment, the AXL-ADC is administered by infusion every three weeks in a dosage of between 10 and 500 mg/m.sup.2, such as between 50-200 mg/m.sup.2. Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as from 1 to 12 hours.
[0141] In one embodiment, an AXL-ADC is administered as a single dose of about 0.1-10 mg/kg, such as about 1-3 mg/kg, every week or every third week for up to twelve times, up to eight times, or until clinical progression. The administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as from 1 to 12 hours. Such regimens may be repeated one or more times as necessary, for example, after 6 months or 12 months. The dosage may be determined or adjusted by measuring the amount of compound of the present invention in the blood upon administration by for instance taking out a biological sample and using anti-idiotypic antibodies which target the antigen binding region of the anti-AXL antibodies.
[0142] In one embodiment, the AXL-ADCs are administered as maintenance therapy, such as, e.g., once a week for a period of six months or more. As used herein, maintenance therapy means therapy for the purpose of avoiding or delaying the cancer's progression or return. Typically, if a cancer is in complete remission after the initial treatment, maintenance therapy can be used to avoid to delay return of the cancer. If the cancer is advanced and complete remission has not been achieved after the initial treatment, maintenance therapy can be used to slow the growth of the cancer, e.g., to lengthen the life of the patient.
[0143] As non-limiting examples, treatment according to the present invention may be provided as a daily dosage of a compound of the present invention in an amount of about 0.1-100 mg/kg, such as about 0.1-50 mg/kg, such as about 0.2, 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of days 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of weeks 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 after initiation of treatment, or any combination thereof, using single or divided doses every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof.
[0144] Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
[0145] As described herein, the AXL-ADC can be used in combination with at least one additional therapeutic agent. The at least one additional therapeutic agent may comprise, or consist of, the chemotherapeutic agent, tyrosine kinase inhibitor, PI3K inhibitor, mAb/rTKI and/or serine/threonine kinase inhibitor to which the cancer or tumor is resistant or have a high tendency for developing resistance to, as set forth in the preceding embodiments.
[0146] The AXL-ADC and the one or more therapeutic agents can be administered simultaneously, separately or sequentially. For example, in one embodiment, the combination is used for treating a cancer patient which has not received prior treatment with the at least one therapeutic agent. In another embodiment, the combination is used for treating a cancer patient which has failed prior treatment with the at least one therapeutic agent. Efficient dosages and dosage regimens for the AXL-ADC and therapeutic agent(s) depend on the neoplasm, tumor or cancer to be treated and may be determined by the persons skilled in the art.
[0147] In one embodiment, the dosages and dosage regimens for the one or more therapeutic agents to be used in conjunction with the AXL-ADC are the same or essentially similar to those normally used in the treatment of such neoplasm, tumor or cancer with the one or more therapeutic agents. In one embodiment, the dosages of the therapeutic agent(s) are lower than those normally used, but the dosage regimen is otherwise similar. In one embodiment, the dosages of the therapeutic agent(s) are similar to those normally used, but the dosage regimen adjusted to fewer or less frequent administrations.
[0148] So, in one aspect, the invention relates to a method of treating a cancer in a subject in need thereof, wherein the cancer is, or has a high tendency for becoming, resistant to a therapeutic agent selected from a chemotherapeutic agent, a tyrosine kinase inhibitor and a serine/threonine kinase inhibitor, comprising administering to the subject (i) an ADC comprising an antibody binding to human AXL and (ii) the therapeutic agent. In one embodiment, the chemotherapeutic agent is a taxane, the tyrosine kinase inhibitor is an EGFR-inhibitor, and the serine/threonine kinase inhibitor a BRAF- or MEK-inhibitor. In one embodiment, the cancer is an AXL-expressing cancer. The AXL-ADC may, e.g., be administered in a therapeutically effective amount according to a dosage regimen described in more detail above. For example, as a non-limiting example, the AXL-ADC may be administered in an amount of about 0.02-100 mg/kg, such as about 0.02-30 mg/kg, such as about 0.05-10 mg/kg either every 1 week (1Q1W), every 2 weeks (1Q2W) or every 3 weeks (1Q3W) or three administrations over 4 weeks (3Q4W) so that the patient receives sixteen or twelve cycles of AXL-ADC at three week or four-week intervals for, e.g., 48 weeks, extending, shortening or repeating the regimen as determined by the physician responsible.
[0149] In one embodiment, the invention relates to a method of treating a NSCLC resistant to erlotinib in a subject, the method comprising administering to the subject (i) an ADC comprising an antibody binding to human AXL and (ii) erlotinib, or a therapeutically effective analog or derivative thereof. The erlotinib may, for example, be administered orally at a dose of 50 to 300 mg, such as 100-200 mg, such as about 150 mg, once or twice daily, or every 2 or 3 days. Preferably, the erlotinib is administered once daily at a dose of about 150 mg. In one embodiment, the cancer is an AXL-expressing cancer.
[0150] In one embodiment, the invention relates to a method of treating a melanoma resistant to vemurafenib in a subject, wherein the melanoma exhibits a mutation in BRAF and the mutation providing for vemurafenib inhibition of BRAF kinase activity of the mutant BRAF, the method comprising administering to the subject (i) an ADC comprising an antibody binding to human AXL and (ii) vemurafenib, or a therapeutically effective analog or derivative thereof. In one embodiment, the cancer is an AXL-expressing cancer. In one embodiment, the mutation is an amino acid substitution in residue V600, L597 and/or K601. In one embodiment, the mutation is selected from V600E, V600D, V600K, L597R and K601E. The vemurafenib may, for example, be administered orally at a dose of about 200-2000 mg, 500-1500 mg, such as about 1000 mg per day, e.g., 960 mg, administered as 4240 mg tablets q12 hr (approximately 12 hr apart).
[0151] In one embodiment, the invention relates to a method of treating a melanoma resistant to dabrafenib in a subject, wherein the melanoma exhibits a mutation in BRAF and the mutation providing for dabrafenib inhibition of BRAF kinase activity of the mutant BRAF, the method comprising administering to the subject (i) an ADC comprising an antibody binding to human AXL and (ii) dabrafenib, or a therapeutically effective analog or derivative thereof. In one embodiment, the cancer is an AXL-expressing cancer. In one embodiment, the mutation is an amino acid substitution in residue V600, L597 and/or K601. In one embodiment, the mutation is selected from V600E, V600D, V600K, L597R and K601E. The dabrafenib may, for example, be administered orally to the subject at a dose of about 50-300 mg, such as about 100-200 mg, such as about 150 mg, once or twice daily or every 2 or 3 days. Preferably, the dabrafenib is administered as 150 mg orally twice daily, e.g., at least 1 hr before a meal or at least 2 hrs after a meal.
[0152] In one embodiment, the invention relates to a method of treating a melanoma resistant to dabrafenib, trametinib or both in a subject, wherein the melanoma exhibits a mutation in BRAF and the mutation providing for dabrafenib inhibition of BRAF kinase activity of the mutant BRAF, the method comprising administering to the subject (i) an ADC comprising an antibody binding to human AXL, (ii) dabrafenib, or a therapeutically effective analog or derivative thereof and (iii) trametinib or a therapeutically effective analog or derivative thereof. In one embodiment, the cancer is an AXL-expressing cancer. In one embodiment, the mutation is an amino acid substitution in residue V600, L597 and/or K601. In one embodiment, the mutation is selected from V600E, V600D, V600K, L597R and K601E. The dabrafenib may, for example, be administered orally to the subject at a dose of about 50-300 mg, such as about 100-200 mg, such as about 150 mg, once or twice daily or every 2 or 3 days. Preferably, the dabrafenib is administered as 150 mg orally twice daily, e.g., at least 1 hr before a meal or at least 2 hrs after a meal. The tramatenib may, for example, be administered orally at a dose of about 0.5 to 5 mg, such as about 1 to 4 mg, such as about 2-3 mg, such as about 2 mg, once or twice daily or every 2, 3 or 4 days, such as once daily.
[0153] In one aspect, the invention relates to a method of treating a cervical cancer resistant to a taxane in a subject, the method comprising administering to the subject (i) an ADC comprising an antibody binding to human AXL and (ii) a taxane to the subject. In one embodiment, the cancer is an AXL-expressing cancer. Preferably, the taxane is paclitaxel or a therapeutically effective analog or derivative thereof, such as docetaxel. The paclitaxel may be administered intravenously (iv) to the subject, for example at a dose of about 100-500 mg/m2, such as about 125-400 mg/m2, such as about 135 mg/m2, 175 mg/m2 or 250 mg/m2 over a few hours (e.g., 3 hrs), and the treatment repeated every 1, 2, 3, 4, 5 weeks, such as every 3 weeks. Alternatively, the paclitaxel may be administered intravenously as albumin-bound paclitaxel (nab-paclitaxel), e.g., at a dose of about 50-400 mg/m2, such as about 75-300 mg/m2, such as about 100-200 mg/m2, such as about 125 mg/m2 over a period over 30 min to 1 hr or more and the once per week, and repeating the treatment twice per week, or once every 2 or 3 weeks, e.g., once per week. Docetaxel may, in turn, be administered iv at a dose of about 25-500 mg/m2, such as about 50-300 mg/m2, such as about 75-200 mg/m2, such as about 100 mg/m2 over 30 minutes to 2 hrs, such as 1 hr, and the treatment repeated every 1, 2, 3, 4 or 5 weeks, such as every 3 weeks.
[0154] In a particular embodiment of the preceding aspects, the AXL-ADC is used, alone or in combination with the therapeutic agent, to treat recurrent cancer in a subject, where the cancer recurred after an initial treatment with the therapeutic agent. Should the cancer recur yet again after the initial treatment with AXL-ADC, the AXL-ADC can be used again, alone or together with the therapeutic agent, to treat the recurrent cancer.
[0155] In one aspect, the invention relates to a method of selecting a subject suffering from a cancer for treatment with a combination of an AXL-ADC and a therapeutic agent selected from a chemotherapeutic agent, a TKI, a PI3Ki, a mAb/rTKI and a S/Th KI, comprising determining [0156] (a) whether the subject meets the criteria for treatment with a chemotherapeutic agent, TKI, PI3Ki, mAb/rTKI or S/Th KI; [0157] (b) whether AXL expression in the cancer is associated with resistance to the TKI or S/Th KI; and [0158] (c) selecting a subject meeting the criteria for treatment with the TKI or S/Th KI and suffering from a cancer for which AXL expression is associated with resistance to the TKI or S/Th KI. In one embodiment, the therapeutic agent is a chemotherapeutic agent, a TKI or S/Th KI.
[0159] In one aspect, the invention relates to a method of treating a subject diagnosed with having a melanoma which is, or has a high tendency for becoming, resistant to vemurafenib or a therapeutically effective analog or derivative thereof, comprising administering a therapeutically effective amount of an ADC comprising an antibody binding to human AXL.
[0160] In one aspect, the invention relates to a method of determining if a subject suffering from melanoma is suitable for treatment with a combination of (i) vemurafenib or a therapeutically effective analog or derivative thereof and (ii) an ADC comprising an antibody which binds to human AXL, wherein the subject is undergoing or has undergone treatment with vemurafenib (or the analog or derivative), and is determined or suspected to be resistant to the vemurafenib (or the analog or derivative), thus determining that the subject is suitable for the treatment. In a further aspect it may be determined if the melanoma expresses AXL. In one embodiment, the analog is dabrafenib.
[0161] In one aspect, the invention relates to a method of treating a subject diagnosed with a cervical cancer which is, or has a high tendency for becoming, resistant to paclitaxel or a therapeutically effective analog or derivative thereof, such another taxane (e.g., docetaxel), comprising administering a therapeutically effective amount of an ADC comprising an antibody binding to human AXL.
[0162] In one aspect, the invention relates to a method of determining if a subject suffering from cervical cancer is suitable for treatment with a combination of (i) paclitaxel or a therapeutically effective analog or derivative thereof, such as another taxane (e.g., docetaxel) and (ii) an ADC comprising an antibody which binds to human AXL, wherein the subject is undergoing or has undergone treatment with paclitaxel and is determined or suspected to be resistant to the paclitaxel, thus determining that the subject is suitable for the treatment. In a further aspect it may be determined if the cervical cancer expresses AXL.
[0163] In one embodiment, the resistant neoplasm, tumor or cancer to be treated with an anti-AXL-ADC has been determined to express AXL.
[0164] In one particular embodiment, this is achieved by detecting levels of AXL antigen or levels of cells which express AXL on their cell surface in a sample taken from a patient. The patient may, for example, suffer from a cervical cancer, melanoma or NSCLC. The AXL antigen to be detected can be soluble AXL antigen, cell-associated AXL antigen, or both. The sample to be tested can, for example, be contacted with an anti-AXL antibody under conditions that allow for binding of the antibody to AXL, optionally along with a control sample and/or control antibody binding to an irrelevant antigen. Binding of the antibody to AXL can then be detected (e.g., using an ELISA). When using a control sample along with the test sample, the level of anti-AXL antibody or anti-AXL antibody AXL complex is analyzed in both samples and a statistically significant higher level of anti-AXL antibody or anti-AXL antibody-AXL complex in the test sample shows a higher level of AXL in the test sample compared with the control sample, indicating a higher expression of AXL. Examples of conventional immunoassays useful for such purposes include, without limitation, ELISA, RIA, FACS assays, plasmon resonance assays, chromatographic assays, tissue immunohistochemistry, Western blot, and/or immunoprecipitation.
[0165] A tissue sample may be taken from a tissue known or suspected of containing AXL antigen and/or cells expressing AXL. For example, in situ detection of AXL expression may be accomplished by removing a histological specimen such as a tumor biopsy or blood sample from a patient, and providing the anti-AXL antibody to such a specimen after suitable preparation of the specimen. The antibody may be provided by applying or by overlaying the antibody to the specimen, which is then detected using suitable means.
[0166] In the above assays, the anti-AXL antibody can be labeled with a detectable substance to allow AXL-bound antibody to be detected.
[0167] The level of AXL expressed on cells in a sample can also be determined according to the method described in Example 23, where AXL expression on the plasma membrane of human tumor cell lines was quantified by indirect immunofluorescence using QIFIKIT analysis (DAKO, Cat nr K0078), using a monoclonal anti-AXL antibody (here: mouse monoclonal antibody ab89224; Abcam, Cambridge, UK). Briefly, a single-cell suspension is prepared, and optionally washed. The next steps are performed on ice. The cells are seeded, e.g., at 100,000 cells per well or tube, and thereafter pelleted and resuspended in 50 L antibody sample at a concentration of 10 g/mL, optionally adding a control antibody to a parallel sample. After an incubation of 30 minutes at 4 C., cells are pelleted and resuspended in 150 L FACS buffer, and the amount of AXL determined by FACS analysis using, e.g., a secondary, FITC-labelled antibody binding to the anti-AXL and control antibodies. For each cell line, the antibody binding capacity (ABC), an estimate for the number of AXL molecules expressed on the plasma membrane, was calculated using the mean fluorescence intensity of the AXL antibody-stained cells, based on the equation of a calibration curve as described in Example 23 (interpolation of unknowns from the standard curve). In one embodiment, using the method of Example 23, the level of AXL on AXL-expressing cells is estimated to at least 5000, such as at least 8000, such as at least 13000.
[0168] In one particular embodiment, the presence or level of AXL-expressing cells in a neoplasm, tumor or cancer is assessed by in vivo imaging of detectably labelled anti-AXL antibodies according to methods known in the art. A significantly higher signal from a site, such as the known or suspected site of a tumor, than background or other control indicates overexpression of AXL in the tumor or cancer.
AXL-ADCs
[0169] ADCs suitable for use in the context of the present invention can be prepared from any anti-AXL antibody. Preferred anti-AXL antibodies are characterized by one or more of the AXL-binding properties, variable or hypervariable sequences, or a combination of binding and sequence properties, set out in the aspects and embodiments below. In a particular aspect, the antibody binds to AXL but does not compete for AXL binding with the ligand Growth Arrest-Specific 6 (Gash). Most preferred are the specific anti-AXL antibodies whose sequences are described in Table 4, in particular the antibody designated 107 and antibodies sharing one or more AXL-binding properties or CDR, VH and/or VL sequences with antibody 107.
[0170] So, in one particular embodiment of any preceding aspect or embodiment, the anti-AXL antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40.
[0171] In a preferred embodiment, the ADC comprises such an anti-AXL antibody linked to a cytotoxic agent which is an auristatin or a functional peptide analog or derivate thereof, such as, e.g., monomethyl auristatin E, preferably via a maleimidocaproyl-valine-citrulline-p-aminobenzyloxy-carbonyl (mc-vc-PAB) linker.
[0172] The term antibody as used herein is intended to refer to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological and/or tumor-specific conditions with a half-life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to be internalized). The binding region (or binding domain which may be used herein, both having the same meaning) which interacts with an antigen, comprises variable regions of both the heavy and light chains of the immunoglobulin molecule. The constant regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as C1q, the first component in the classical pathway of complement activation. As indicated above, the term antibody as used herein, unless otherwise stated or clearly contradicted by context, includes fragments of an antibody that retain the ability to specifically interact, such as bind, to the antigen. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term antibody include (i) a Fab or Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains, or a monovalent antibody as described in WO 2007/059782; (ii) F(ab).sub.2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting essentially of the VH and CH1 domains; (iv) an Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., 1989), which consists essentially of a VH domain and is also called domain antibody (Holt et al., 2003); (vi) camelid or nanobodies (Revets et al., 2005) and (vii) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain antibodies or single chain Fv (scFv), see for instance Bird et al. (1988) and Huston et al. (1988). Such single chain antibodies are encompassed within the term antibody unless otherwise noted or clearly indicated by context. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility. These and other useful antibody fragments in the context of the present invention are discussed further herein. It also should be understood that the term antibody, unless specified otherwise, also includes polyclonal antibodies, monoclonal antibodies (mAbs), antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, as well as antibody fragments or fragments thereof retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques, and retaining the ability to be conjugated to a toxin. An antibody as generated can possess any isotype.
[0173] The term immunoglobulin heavy chain or heavy chain of an immunoglobulin as used herein is intended to refer to one of the heavy chains of an immunoglobulin. A heavy chain is typically comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH) which defines the isotype of the immunoglobulin. The heavy chain constant region typically is comprised of three domains, CH1, CH2, and CH3. The term immunoglobulin as used herein is intended to refer to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four potentially inter-connected by disulfide bonds. The structure of immunoglobulins has been well characterized (see for instance Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989). Within the structure of the immunoglobulin, the two heavy chains are inter-connected via disulfide bonds in the so-called hinge region. Equally to the heavy chains each light chain is typically comprised of several regions; a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region typically is comprised of one domain, CL. Furthermore, the VH and VL regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. CDR sequences are defined according to IMGT (see Lefranc et al. (1999) and Brochet et al. (2008)).
[0174] The term antigen-binding region or binding region as used herein, refers to a region of an antibody which is capable of binding to the antigen. The antigen can be any molecule, such as a polypeptide, e.g. present on a cell, bacterium, or virion. The terms antigen and target may, unless contradicted by the context, be used interchangeably in the context of the present invention.
[0175] The term binding as used herein refers to the binding of an antibody to a predetermined antigen or target, typically with a binding affinity corresponding to a K.sub.D of about 10.sup.6 M or less, e.g. 10.sup.7 M or less, such as about 10.sup.8 M or less, such as about 10.sup.9 M or less, about 10.sup.10 M or less, or about 10.sup.11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the protein as the analyte, and binds to the predetermined antigen with an affinity corresponding to a K.sub.D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. The amount with which the affinity is lower is dependent on the K.sub.D of the protein, so that when the K.sub.D of the protein is very low (that is, the protein is highly specific), then the amount with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold. The term K.sub.D (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction, and is obtained by dividing k.sub.d by k.sub.a.
[0176] The term k.sub.d (sec.sup.1), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k.sub.off value or off-rate.
[0177] The term k.sub.a (M.sup.1sec.sup.1), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k.sub.on value or on-rate.
[0178] The term K.sub.A (M.sup.1), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction and is obtained by dividing k.sub.a by k.sub.d.
[0179] The term AXL as used herein, refers to the protein entitled AXL, which is also referred to as UFO or JTK11, a 894 amino acid protein with a molecular weight of 104-140 kDa that is part of the subfamily of mammalian TAM Receptor Tyrosine Kinases (RTKs). The molecular weight is variable due to potential differences in glycosylation of the protein. The AXL protein consists of two extracellular immunoglobulin-like (Ig-like) domains on the N-terminal end of the protein, two membrane-proximal extracellular fibronectin type III (FNIII) domains, a transmembrane domain and an intracellular kinase domain. AXL is activated upon binding of its ligand Gas6, by ligand-independent homophilic interactions between AXL extracellular domains, by autophosphorylation in presence of reactive oxygen species (Korshunov et al., 2012) or by transactivation through EGFR (Meyer et al., 2013), and is aberrantly expressed in several tumor types. In humans, the AXL protein is encoded by a nucleic acid sequence encoding the amino acid sequence shown in SEQ ID NO:130 (human AXL protein: Swissprot P30530; cynomolgus AXL protein: Genbank accession HB387229.1)).
[0180] The term ligand-independent homophilic interactions as used herein, refers to association between two AXL molecules (expressed on neighboring cells) that occurs in absence of the ligand.
[0181] The term antibody binding AXL as used herein, refers to any antibody binding an epitope on the extracellular part of AXL.
[0182] The term epitope means a protein determinant capable of specific binding to an antibody. Epitopes usually consist of surface groupings of molecules such as amino acids, sugar side chains or a combination thereof and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. The epitope may comprise amino acid residues which are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked or covered by the specific antigen binding peptide (in other words, the amino acid residue is within the footprint of the specific antigen binding peptide).
[0183] The term ligand as used herein, refers to a substance, such as a hormone, peptide, ion, drug or protein, that binds specifically and reversibly to another protein, such as a receptor, to form a larger complex. Ligand binding to a receptor may alter its chemical conformation, and determines its functional state. For instance, a ligand may function as agonist or antagonist.
[0184] The term Growth Arrest-Specific 6 or Gas6 as used herein, refers to a 721 amino acid protein, with a molecular weight of 75-80 kDa, that functions as a ligand for the TAM family of receptors, including AXL. Gas6 is composed of an N-terminal region containing multiple gamma-carboxyglutamic acid residues (Gla), which are responsible for the specific interaction with the negatively charged phospholipid membrane. Although the Gla domain is not necessary for binding of Gas6 to AXL, it is required for activation of AXL. Gas6 may also be termed as the ligand to AXL.
[0185] The terms monoclonal antibody, monoclonal Ab, monoclonal antibody composition, mAb, or the like, as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences. The human monoclonal antibodies may be produced by a hybridoma which includes a B cell obtained from a transgenic or transchromosomal non-human animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
[0186] In the context of the present invention the term ADC refers to an antibody drug conjugate, which in the context of the present invention refers to an anti-AXL antibody which is coupled to a therapeutic moiety, e.g., a cytotoxic moiety as described in the present application. It may e.g. be coupled with a linker to e.g. cysteine or with other conjugation methods to other amino acids. The moiety may e.g. be a drug or a toxin or the like.
[0187] As used herein, a therapeutic moiety means a compound which exerts a therapeutic or preventive effect when administered to a subject, particularly when delivered as an ADC as described herein. A cytotoxic or cytostatic moiety is a compound that is detrimental to (e.g., kills) cells. Some cytotoxic or cytostatic moieties for use in ADCs are hydrophobic, meaning that they have no or only a limited solubility in water, e.g., 1 g/L or less (very slightly soluble), such as 0.8 g/L or less, such as 0.6 g/L or less, such as 0.4 g/L or less, such as 0.3 g/L or less, such as 0.2 g/L or less, such as 0.1 g/L or less (practically insoluble). Exemplary hydrophobic cytotoxic or cytostatic moieties include, but are not limited to, certain microtubulin inhibitors such as auristatin and its derivatives, e.g., MMAF and MMAE, as well as maytansine and its derivatives, e.g., DM1.
[0188] In one embodiment, the antibody has a binding affinity (K.sub.D) in the range of 0.310.sup.9 to 6310.sup.9 M to AXL, and wherein said binding affinity is measured using a Bio-layer Interferometry using soluble AXL extracellular domain.
[0189] The binding affinity may be determined as described in Example 2. Thus, in one embodiment, the antibody has a binding affinity of 0.310.sup.9 to 6310.sup.9 M to the antigen, wherein the binding affinity is determined by a method comprising the steps of;
[0190] i) loading anti-human Fc Capture biosensors with anti-AXL antibodies, and
[0191] ii) determining association and dissociation of soluble recombinant AXL extracellular domain by Bio-Layer Interferometry at different concentrations.
[0192] The term soluble recombinant AXL extracellular domain as used herein, refers to an AXL extracellular domain, corresponding to amino acids 1-447 of the full-length protein (SEQ ID NO:130; see Example 1) that has been expressed recombinantly. Due to absence of the transmembrane and intracellular domain, recombinant AXL extracellular domain is not attached to a, e.g. cell surface and stays in solution. It is well-known how to express a protein recombinantly, see e.g. Sambrook (1989), and thus, it is within the knowledge of the skilled person to provide such recombinant AXL extracellular domain.
[0193] In one embodiment, the antibody has a dissociation rate of 6.910.sup.5 s.sup.1 to 9.710.sup.3 s.sup.1 to AXL, and wherein the dissociation rate is measured by Bio-layer Interferometry using soluble recombinant AXL extracellular domain.
[0194] The binding affinity may be determined as described above (and in Example 2). Thus, in one embodiment, the antibody has a dissociation rate of 6.910.sup.5 s.sup.1 to 9.710.sup.3 s.sup.1 to AXL, and wherein the dissociation rate is measured by a method comprising the steps of
[0195] i) loading anti-human Fc Capture biosensors with anti-AXL antibodies, and
[0196] ii) determining association and dissociation of recombinant AXL extracellular domain by Bio-Layer Interferometry at different concentrations.
[0197] The term dissociation rate as used herein, refers to the rate at which an antigen-specific antibody bound to its antigen, dissociates from that antigen, and is expressed as s.sup.1. Thus, in the context of an antibody binding AXL, the term dissociation rate, refers to the antibody binding AXL dissociates from the recombinant extracellular domain of AXL, and is expressed as s.sup.1.
[0198] In one aspect, the ADCs for the use of the present invention comprises an antibody-portion which binds to an extracellular domain of AXL without competing or interfering with Gas6 binding to AXL. In a particular embodiment, the antibody binds to the extracellular domain Ig1domain without competing or interfering with Gas6 binding to AXL. In one embodiment, the antibody binds to the extracellular domain Ig1 and show no more than a 20% reduction in maximal Gas6 binding to AXL. In one embodiment, the antibody show no more than a 15% reduction in maximal Gas6 binding to AXL. In one embodiment, the antibody show no more than a 10% reduction in maximal Gas6 binding to AXL. In one embodiment, the antibody show no more than a 5% reduction in maximal Gas6 binding to AXL. In one embodiment, the antibody show no more than a 4% reduction in maximal Gas6 binding to AXL In one embodiment, the antibody show no more than a 2% reduction in maximal Gas6 binding to AXL. In one embodiment, the antibody show no more than a 1% reduction in maximal Gas6 binding. In one embodiment the antibody binds to the Ig2 domain in the AXL extracellular domain without competing or interfering with Gas6 binding to AXL. In one embodiment, the antibody binds to the Ig2 domain in the AXL extracellular domain and show no more than a 20%, such as no more than 15%, such as no more than 10%, such as no more than 5%, such as no more than 4%, such as no more than 2%, such as no more than 1%, reduction in maximal Gas6 binding to AXL. The embodiment's ability to compete with or reduce Gas6 binding may be determined as disclosed in Example 2 or Example 12. In one embodiment the antibody binds to the Ig2 domain in the AXL extracellular domain without competing or interfering with maximal Gas6 binding to AXL.
[0199] In one embodiment, maximal antibody binding in the presence of Gas6 is at least 90%, such as at least 95%, such as at least 97%, such as at least 99%, such as 100%, of binding in absence of Gas6 as determined by a competition assay, wherein competition between said antibody binding to human AXL and said Gas6 is determined on A431 cells preincubated with Gas6 and without Gas6.
[0200] Competition between anti-AXL and the ligand Gas6 to AXL may be determined as described in Example 2 under the heading Interference of anti-AXL binding with Gas6 binding. Thus, in one embodiment, the antibody does not compete for AXL binding with the ligand Gas6, wherein the competing for binding is determined in an assay comprising the steps of
[0201] i) incubating AXL-expressing cells with Gas6,
[0202] ii) adding anti-AXL antibodies to be tested,
[0203] iii) adding a fluorescently labelled secondary reagent detecting anti-AXL antibodies and
[0204] iv) analyzing the cells by FACS.
[0205] In another embodiment, the antibody does not compete for binding with the ligand Gas6, wherein the competing for binding is determined in an assay comprising the steps of
[0206] i) incubating AXL-expressing cells with anti-AXL antibodies,
[0207] ii) adding Gas6,
[0208] iii) adding a fluorescently labelled secondary reagent detecting Gas6, and
[0209] iv) analyzing the cells by FACS.
[0210] In one embodiment, the antibody modulates AXL-associated signaling in an AXL-expressing cell of the when the cell is contacted with the antibody.
[0211] In one embodiment, the antibody does not modulate AXL-associated signaling in an AXL-expressing cell of the when the cell is contacted with the antibody.
[0212] Non-limiting examples of modulation of AXL-associated signalling includes modulation of intracellular signaling pathways such as the PI3K/AKT, mitogen-activated protein kinase (MAPK), STAT or NE-KB cascades.
[0213] In one embodiment, the anti-AXL antibody or AXL-ADC competes for binding to AXL with an antibody comprising a variable heavy (VH) region and a variable light (VL) region selected from the group consisting of:
[0214] (a) a VH region comprising SEQ ID No:1 and a VL region comprising SEQ ID No:2 [107];
[0215] (b) a VH region comprising SEQ ID No:5 and a VL region comprising SEQ ID No:6 [148];
[0216] (c) a VH region comprising SEQ ID No:34 and a VL region comprising SEQ ID No:35
[0217] (d) a VH region comprising SEQ ID No:7 and a VL region comprising SEQ ID No:9 [154];
[0218] (e) a VH region comprising SEQ ID No:10 and a VL region comprising SEQ ID No:11 [171];
[0219] (f) a VH region comprising SEQ ID No:16 and a VL region comprising SEQ ID No: 18 [183];
[0220] (g) a VH region comprising SEQ ID No:25 and a VL region comprising SEQ ID No:26 [613];
[0221] (h) a VH region comprising SEQ ID No:31 and a VL region comprising SEQ ID No:33 [726];
[0222] (i) a VH region comprising SEQ ID No:3 and a VL region comprising SEQ ID No:4 [140];
[0223] (j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-M103L];
[0224] (k) a VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172];
[0225] (l) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181];
[0226] (m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-N52Q];
[0227] (n) a VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187];
[0228] (o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-01];
[0229] (p) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24 [610-01];
[0230] (q) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28 [613-08];
[0231] (r) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30 [620-06]; and
[0232] (s) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No:33 [726-M101L].
[0233] When used herein in the context of an antibody and a Gas6 ligand or in the context of two or more antibodies, the term competes with or cross-competes with indicates that the antibody competes with the ligand or another antibody, e.g., a reference antibody in binding to an antigen, respectively. Example 2 describes an example of how to test competition of an anti-AXL antibody with the AXL-ligand Gas6. Preferred reference antibodies for cross-competition between two antibodies are those comprising a binding region comprising the VH region and VL region of an antibody herein designated 107, 148, 733, 154, 171, 183, 613, 726, 140, 154-M103L, 172, 181, 183-N52Q, 187, 608-01, 610-01, 613-08, 620-06 or 726-M101L, as set forth in Table 4. A particularly preferred reference antibody is the antibody designated 107.
[0234] In one embodiment, the anti-AXL antibody binds to the same epitope on AXL as any one or more of the antibodies according to the aforementioned embodiment, as defined by their VH and VL sequences, e.g., a VH region comprising SEQ ID No:1 and a VL region comprising SEQ ID No:2 [107].
[0235] Methods of determining an epitope to which an antibody binds are well-known in the art. Thus, the skilled person would know how to determine such an epitope. However, one example of determining whether an antibody binds within any epitope herein described may be by introducing point mutations into the extracellular domain of AXL extracellular domain, e.g., for the purpose of identifying amino acids involved in the antibody-binding to the antigen. It is within the knowledge of the skilled person to introduce point mutation(s) in the AXL extracellular domain and test for antibody binding to point mutated AXL extracellular domains, since the effect of point mutations on the overall 3D structure is expected to be minimal.
[0236] An alternative method was used in Example 3, wherein the AXL domain specificity was mapped by preparing a panel of human-mouse chimeric AXL mutants where the human Ig1, Ig2, FN1 or FN2 domain had been replaced by its murine analog, and determining which mutant an anti-AXL antibody bound to. This method was based on the principle that these human AXL-specific antibodies recognized human but not mouse AXL. So, in separate and specific embodiments, the antibody binds to the Ig1 domain of AXL, the Ig2 domain of AXL, the FN1 domain of AXL, or the FN2 domain of AXL.
[0237] A more high-resolution epitope-mapping method, identifying AXL extracellular domain amino acids involved in antibody binding, was also used in this Example. Specifically, this method analyzed binding of the anti-AXL antibody to a library of AXL sequence variants generated by recombination of AXL sequences derived from species with variable levels of homology with the human AXL sequence (SEQ ID NO:130) in the extracellular domain. This method was based on the principle that these human AXL-specific antibodies recognize human AXL, but not the AXL from any of the other species used in the example.
[0238] So, in one embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and the antibody binding is dependent on one or more or all of the amino acids corresponding to positions L121 to 0129 or one or more or all of T112 to Q124 of human AXL, wherein the numbering of amino acid residues refers to their respective positions in human AXL (SEQ ID NO:130). In one embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and antibody binding is dependent on the amino acids corresponding to positions L121 to 0129 or T112 to Q124 of human AXL. In a preferred embodiment antibody binding is dependent on one or more or all amino acids in position L121, G122, H123, Q124, T125, F126, V127, 5128 and 0129, corresponding to the amino acids involved in the binding of the antibody herein designated 107. In one embodiment, antibody binding is dependent on one or more or all amino acid in position T112, G113, Q114, Y115, Q116, C117, L118, V119, F120, L121, G122, H123 and Q124.
[0239] In another embodiment, the antibody binds to an epitope within the Ig2 domain of AXL, and antibody binding is dependent on one or more or all of the amino acids corresponding to position D170 or the combination of D179 or one or more or all of the amino acids in positions 1182 to R190 of human AXL. In one embodiment antibody binding is dependent on the amino acids in position 1182, A183, P183, G184, H185, G186, P187, Q189 and R190.
[0240] In another embodiment, the antibody binds to an the FN1 domain of human AXL, and antibody binding is dependent on one or more or all of the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL. In one embodiment, antibody binding is dependent on the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL.
[0241] In another embodiment, the antibody binds to the FN2 domain of human AXL and antibody binding is dependent on one or more or all of the amino acids corresponding to positions A359, R386, and Q436 to K439 of human AXL.
[0242] In yet another embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and the epitope comprises or requires one or more or all of the amino acids corresponding to positions L121 to Q129 or one or more or all of T112 to Q124 of human AXL, wherein the numbering of amino acid residues refers to their respective positions in human AXL (SEQ ID NO:130). In one embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and the epitope comprises or requires the amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL. In a preferred embodiment the epitope comprises one or more or all amino acid in position L121, G122, H123, Q124, T125, F126, V127, 5128 and 0129, corresponding to the amino acids involved in the binding of the antibody herein designated 107. In one embodiment, the epitope comprises one or more or all amino acid in position T112, G113, Q114, Y115, Q116, C117, L118, V119, F120, L121, G122, H123 and Q124.
[0243] In another embodiment, the antibody binds to an epitope within the Ig2 domain of AXL, and the epitope comprises or requires one or more or all of the amino acids corresponding to position D170 or the combination of D179 or one or more or all of the amino acids in positions T182 to R190 of human AXL. In one embodiment the epitope comprises or requires the amino acids in position 1182, A183, P183, G184, H185, G186, P187, Q189 and R190.
[0244] In another embodiment, the antibody binds to an epitope within the FN1 domain of human AXL, which epitope comprises or requires one or more or all of the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL. In one embodiment, the epitope comprises or requires the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL.
[0245] In another embodiment, the antibody binds to an epitope within the FN2 domain of human AXL, which epitope comprises or requires one or more or all of the amino acids corresponding to positions A359, R386, and Q436 to K439 of human AXL.
[0246] In one embodiment, the antibody binds to an epitope within the FN1-like domain of human AXL.
[0247] In one embodiment, the antibody binds to an epitope on AXL which epitope is recognized by any one of the antibodies defined by
[0248] a)) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107];
[0249] b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148];
[0250] c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733];
[0251] d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154];
[0252] e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154-M103L];
[0253] f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
[0254] g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172];
[0255] h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181];
[0256] i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183];
[0257] j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
[0258] k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
[0259] l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
[0260] m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01];
[0261] n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613];
[0262] o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 10, DAS, and 102, respectively, [613-08];
[0263] p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06];
[0264] q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726];
[0265] r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
[0266] s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140];
[0267] t) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 128, XAS, wherein X is D or G, and 129, respectively, [613/613-08];
[0268] u) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148/140];
[0269] v) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171/172/181]; and
[0270] w) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively [726/187]; and
[0271] x) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively [613/608-01/610-01/620-06].
[0272] In a particular embodiment, the antibody binds to an epitope on AXL which epitope is recognized by any one of the antibodies defined by comprising a binding region comprising the VH and VL sequences of an antibody selected from those herein designated 107, 061, 137, 148, 154-M103L, 171, 183-N52Q, 511, 613, 726-M102L and 733. As shown in Example 16, these anti-AXL antibodies internalize, and are thus suitable for an ADC approach.
[0273] In one embodiment, the antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: [0274] (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:39, GAS, and 40, respectively, [107]; [0275] (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:49, AAS, and 50, respectively, [148]; [0276] (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:117, DAS, and 118, respectively [733]; [0277] (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:55, GAS, and 56, respectively [154]; [0278] (e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:55, GAS, and 56, respectively [154-M103L]; [0279] (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:60, GAS, and 61, respectively, [171]; [0280] (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:65, GAS, and 66, respectively, [172]; [0281] (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:70, GAS, and 71, respectively, [181]; [0282] (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:76, ATS, and 77, respectively, [183]; [0283] (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:76, ATS, and 77, respectively, [183-N52Q]; [0284] (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:81, AAS, and 82, respectively, [187]; [0285] (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:86, GAS, and 87, respectively, [608-01]; [0286] (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:91, GAS, and 92, respectively, [610-01]; [0287] (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:96, GAS, and 97, respectively, [613]; [0288] (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:101, DAS, and 102, respectively, [613-08]; [0289] (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:106, GAS, and 107, respectively, [620-06]; [0290] (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:112, AAS, and 113, respectively, [726]; [0291] (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:112, AAS, and 113, respectively, [726-M101L]; [0292] (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:44, AAS, and 45, respectively, [140]; [0293] (t) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 94, and 95, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:128, XAS, wherein X is D or G, and 129, respectively, [613/613-08]; [0294] (u) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:49, AAS, and 50, respectively, [148/140]; [0295] (v) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:60, GAS, and 61, respectively [171/172/181]; and [0296] (w) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:112, AAS, and 113, respectively [726/187]; and [0297] (x) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:96, GAS, and 97, respectively [613/608-01/610-01/620-06].
[0298] In one embodiment, the antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: [0299] (a) a VH region comprising SEQ ID No:1 and a VL region comprising SEQ ID No:2 [107]; [0300] (b) a VH region comprising SEQ ID No:5 and a VL region comprising SEQ ID No:6 [148]; [0301] (c) a VH region comprising SEQ ID No:34 and a VL region comprising SEQ ID No:35 [733] [0302] (d) a VH region comprising SEQ ID No:7 and a VL region comprising SEQ ID No:9 [154]; [0303] (e) a VH region comprising SEQ ID No:10 and a VL region comprising SEQ ID No:11 [171]; [0304] (f) a VH region comprising SEQ ID No:16 and a VL region comprising SEQ ID No:18 [183]; [0305] (g) a VH region comprising SEQ ID No:25 and a VL region comprising SEQ ID No:26 [613]; [0306] (h) a VH region comprising SEQ ID No:31 and a VL region comprising SEQ ID No:33 [726]; [0307] (i) a VH region comprising SEQ ID No:3 and a VL region comprising SEQ ID No:4 [140]; [0308] (j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-M103L]; [0309] (k) a VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; [0310] (l) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; [0311] (m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-N52Q]; [0312] (n) a VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; [0313] (o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-01]; [0314] (p) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24 [610-01]; [0315] (q) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28 [613-08]; [0316] (r) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30 [620-06]; and [0317] (s) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No:33 [726-M101L].
[0318] The present invention also provides antibodies comprising functional variants of the VL region, VH region, or one or more CDRs of the antibodies mentioned above. A functional variant of a VL, VH, or CDR used in the context of an AXL antibody still allows the antibody to retain at least a substantial proportion (at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) of the affinity/avidity and/or the specificity/selectivity of the parent antibody and in some cases such an AXL antibody may be associated with greater affinity, selectivity and/or specificity than the parent anti body.
[0319] Such functional variants typically retain significant sequence identity to the parent antibody. The percent identity between two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions/total # of positions100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences may be accomplished using a mathematical algorithm, which is well-known in the art.
[0320] The sequence identity between two amino acid sequences may, for example, be determined using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16: 276-277), preferably version 5.0.0 or later. The parameters used are gap open penalty of 10, gap extension penalty of 0.5, and the EBLOSUM62 (EMBOSS version of BLOSUM62) substitution matrix. The output of Needle labeled longest identity (obtained using the nobrief option) is used as the percent identity and is calculated as follows:
(Identical Residues100)/(Length of AlignmentTotal Number of Gaps in Alignment).
[0321] The VH, VL and/or CDR sequences of variants may differ from those of the parent antibody sequences through mostly conservative substitutions; for instance at least about 35%, about 50% or more, about 60% or more, about 70% or more, about 75% or more, about 80% or more, about 85% or more, about 90% or more, (e.g., about 65-95%, such as about 92%, 93% or 94%) of the substitutions in the variant are conservative amino acid residue replacements.
[0322] The VH, VL and/or CDR sequences of variants may differ from those of the parent antibody sequences through mostly conservative substitutions; for instance 10 or less, such as 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, 2 or less or 1 of the substitutions in the variant are conservative amino acid residue replacements.
[0323] Embodiments are also provided wherein mutations or substitutions of up to five mutations or substitutions are allowed across the three CDR sequences in the variable heavy chain and/or variable light chain of the preceding embodiment. The up to five mutations or substitutions may be distributed across the three CDR sequences of the variable heavy chain and the three CDR sequences of the variable light chain. The up to five mutations or substitutions may be distributed across the six CDR sequences of the binding region. The mutations or substitutions may be of conservative, physical or functional amino acids such that mutations or substitutions do not change the epitope or preferably do not modify binding affinity to the epitope more than 30%, such as more than 20% or such as more than 10%. The conservative, physical or functional amino acids are selected from the 20 natural amino acids found i.e., Arg, His, Lys, Asp, Glu, Ser, Thr, Asn, Gln, Cys, Gly, Pro, Ala, Ile, Leu, Met, Phe, Trp, Tyr and Val.
[0324] So, in one embodiment, the antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of VH and VL sequences at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to: [0325] (a) a VH region comprising SEQ ID No:1 and a VL region comprising SEQ ID No:2 [107]; [0326] (b) a VH region comprising SEQ ID No:5 and a VL region comprising SEQ ID No:6 [148]; [0327] (c) a VH region comprising SEQ ID No:34 and a VL region comprising SEQ ID No:35 [0328] (d) a VH region comprising SEQ ID No:7 and a VL region comprising SEQ ID No:9 [154]; [0329] (e) a VH region comprising SEQ ID No:10 and a VL region comprising SEQ ID No:11 [171]; [0330] (f) a VH region comprising SEQ ID No:16 and a VL region comprising SEQ ID No: 18 [183]; [0331] (g) a VH region comprising SEQ ID No:25 and a VL region comprising SEQ ID No:26 [613]; [0332] (h) a VH region comprising SEQ ID No:31 and a VL region comprising SEQ ID No:33 [726]; [0333] (i) a VH region comprising SEQ ID No:3 and a VL region comprising SEQ ID No:4 [140]; [0334] (j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-M103L]; [0335] (k) a VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; [0336] (l) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; [0337] (m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-N52Q]; [0338] (n) a VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; [0339] (o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-01]; [0340] (p) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24 [610-01]; [0341] (q) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28 [613-08]; [0342] (r) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30 [620-06]; and [0343] (s) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No:33 [726-M101L].
[0344] The present invention also provides antibodies comprising functional variants of the VL region, VH region, or one or more CDRs of the antibodies of the examples. A functional variant of a VL, VH, or CDR used in the context of an AXL antibody still allows the antibody to retain at least a substantial proportion (at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) of the affinity/avidity and/or the specificity/selectivity of the parent antibody and in some cases such an AXL antibody may be associated with greater affinity, selectivity and/or specificity than the parent anti body.
[0345] Such functional variants typically retain significant sequence identity to the parent antibody. The percent identity between two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions/total # of positions100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences may be accomplished using a mathematical algorithm, which is well-known in the art.
[0346] The VH, VL and/or CDR sequences of variants may differ from those of the parent antibody sequences through mostly conservative substitutions; for instance at least about 35%, about 50% or more, about 60% or more, about 70% or more, about 75% or more, about 80% or more, about 85% or more, about 90% or more, (e.g., about 65-95%, such as about 92%, 93% or 94%) of the substitutions in the variant are conservative amino acid residue replacements.
[0347] The VH, VL and/or CDR sequences of variants may differ from those of the parent antibody sequences through mostly conservative substitutions; for instance 10 or less, such as 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, 2 or less or 1 of the substitutions in the variant are conservative amino acid residue replacements.
[0348] Embodiments are also provided wherein mutations or substitutions of up to five mutations or substitutions are allowed across the three CDR sequences in the variable heavy chain and/or variable light chain of the preceding embodiment. The up to five mutations or substitutions may be distributed across the three CDR sequences of the variable heavy chain and the three CDR sequences of the variable light chain. The up to five mutations or substitutions may be distributed across the six CDR sequences of the binding region. The mutations or substitutions may be of conservative, physical or functional amino acids such that mutations or substitutions do not change the epitope or preferably do not modify binding affinity to the epitope more than 30%, such as more than 20% or such as more than 10%. The conservative, physical or functional amino acids are selected from the 20 natural amino acids found i.e., Arg, His, Lys, Asp, Glu, Ser, Thr, Asn, Gln, Cys, Gly, Pro, Ala, Ile, Leu, Met, Phe, Trp, Tyr and Val.
[0349] In one embodiment, the antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of VH and VL sequences at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to: [0350] (t) a VH region comprising SEQ ID No:1 and a VL region comprising SEQ ID No:2 [107]; [0351] (u) a VH region comprising SEQ ID No:5 and a VL region comprising SEQ ID No:6 [148]; [0352] (v) a VH region comprising SEQ ID No:34 and a VL region comprising SEQ ID No:35 [733] [0353] (w) a VH region comprising SEQ ID No:7 and a VL region comprising SEQ ID No:9 [154]; [0354] (x) a VH region comprising SEQ ID No:10 and a VL region comprising SEQ ID No:11 [171]; [0355] (y) a VH region comprising SEQ ID No:16 and a VL region comprising SEQ ID No:18 [183]; [0356] (z) a VH region comprising SEQ ID No:25 and a VL region comprising SEQ ID No:26 [613]; [0357] (aa) a VH region comprising SEQ ID No:31 and a VL region comprising SEQ ID No:33 [726]; [0358] (bb) a VH region comprising SEQ ID No:3 and a VL region comprising SEQ ID No:4 [140]; [0359] (cc) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-M103L]; [0360] (dd) a VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; [0361] (ee) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; [0362] (ff) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-N52Q]; [0363] (gg) a VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; [0364] (hh) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-01]; [0365] (ii) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24 [610-01]; [0366] (jj) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28 [613-08]; [0367] (kk) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30 [620-06]; and [0368] (ll) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No:33 [726-M101L].
[0369] In one embodiment, the antibody comprises at least one binding region comprising the VH and VL CDR1, CDR2, and CDR3 sequences of an anti-AXL antibody known in the art, e.g., an antibody described in any of Leconet et al. (2013), Li et al. (2009), Ye et al. (2010), lida et al. (2014), WO 2012/175691 (INSERM), WO 2012/175692 (INSERM), WO 2013/064685 (Pierre Fabr Medicaments), WO 2013/090776 (INSERM), WO 2009/063965 (Chugai Pharmaceuticals), WO 2010/131733, WO 2011/159980 (Genentech), WO09062690 (U3 Pharma), WO2010130751 (U3 Pharma), WO2014093707 (Stanford University) and EP2228392A1 (Chugai), all of which are incorporated by reference in their entireties. In one specific embodiment, the antibody is murine antibody 1613F12 or a chimeric or a humanized variant thereof as described in WO2014174111 (Pierre Fabre Medicament), wherein the VH and VL sequences of the mouse antibody 1613F12 are presented as SEQ ID:8 and SEQ ID:7, respectively. The VH sequence of the humanized antibody variant of 1613F12 is selected from the sequences disclosed therein as SEQ ID NO:29 to 49 and SEQ ID NO:82, and the VL sequence of the humanized antibody variant of 1613F12 is selected from the sequences disclosed therein as SEQ ID NO:17 to 28 and SEQ ID: 81. One specific antibody comprises the VH and VL sequences disclosed therein as SEQ ID NO:29 and 17, respectively. The VH CDR1, CDR2 and CDR3 sequences of mouse, chimeric and humanized 1613F12 are SEQ ID NO:4, 5 and 6, respectively and the VL CDR1, CDR2 and CDR3 sequences of mouse and humanized 1613F12 are disclosed therein as SEQ ID NO:1, 2, and 3, respectively. In one specific embodiment, the antibody is an antibody described in WO2011159980 (Hoffman-La Roche), which is hereby incorporated by reference in its entirety, particularly paragraphs [0127] through [0229] (pages 28-52). For example, the antibody may comprise the VH and VL hypervariable regions (HVR), or the VH and VL regions, of antibody YW327.6S2, which are disclosed therein as SEQ ID NOS:7, 8 and 9 (VH HVR1, 2 and 3, respectively), SEQ ID NOS:10, 11 and 12 (VL HVR1, 2 and 3, respectively) and SEQ ID NOS:103 and 104 (VH and VL sequences, respectively).
[0370] In one embodiment, the antibody mediates antibody-mediated crosslinking or clustering (e.g., due to the Fc-region of AL-bound antibodies binding to FcR-expressing cells) of AXL molecules on the surface of a cell, which can lead to apoptosis of the cell.
[0371] In one embodiment, the antibody induces an Fc-dependent cellular response such as ADCC or ADCP against an AXL-expressing cell after binding of the AXL-specific antibody to the plasma membrane of the AXL-expressing cell in the presence of effector cells. In this embodiment, the antibody-portion of the antibody is typically full-length and of an isotype leading to an ADCC or ADCP response, such as, e.g., an IgG1, isotype.
[0372] In one embodiment, the antibody induces a CDC response against an AXL-expressing cell after binding of the AXL-specific antibody to the plasma membrane of the AXL-expressing cell in the presence of complement proteins, such as complement proteins present in normal human serum, that may be activated. In this embodiment, the antibody is typically full-length and of an isotype capable of inducing activation of the complement system, such as, e.g., an IgG1, isotype.
[0373] The antibody and/or ADC may further be characterized by internalization upon binding to AXL. Accordingly, in one embodiment, the antibody and/or ADC is internalized and trafficked to lysosomes for specific (i.e. cleavable linker) or non-specific (non-cleavable linker) proteolytic cleavage of the anti-AXL antibody-linker-drug complex.
[0374] In one embodiment, the antibody interferes with AXL-mediated regulation of the innate or adaptive immune response, such as by binding of the antibody to AXL-expressing macrophages, dendritic cells or NK cells.
[0375] In one embodiment, the therapeutic moiety of the ADC is linked to the antibody moiety via a linker allowing for release of the drug once the ADC is internalized, e.g., by a change in pH or reducing conditions. Suitable linker technology is known in the art, as described herein.
[0376] In one embodiment, the antibody comprises a heavy chain of an isotype selected from the group consisting of IgG1, IgG2, IgG3, and IgG4. In a further embodiment, the antibody comprises a heavy chain of an isotype selected from the group consisting of a human IgG1, IgG2, IgG3, and IgG4.
[0377] The term isotype as used herein refers to the immunoglobulin class (for instance IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) or any allotype thereof, such as IgG1m(za) and IgG1m(f)) that is encoded by heavy chain constant region genes. Further, each heavy chain isotype can be combined with either a kappa () or lambda () light chain.
[0378] In one embodiment, the isotype is IgG1, such as human IgG1, optionally allotype IgG1m(f).
[0379] In one embodiment, the antibody is a full-length monoclonal antibody, optionally a full-length human monoclonal IgG1, antibody.
[0380] The term full-length antibody when used herein, refers to an antibody (e.g., a parent or variant antibody) which contains all heavy and light chain constant and variable domains corresponding to those that are normally found in a wild-type antibody of that isotype. A full-length antibody according to the present invention may be produced by a method comprising the steps of (i) cloning the CDR sequences into a suitable vector comprising complete heavy chain sequences and complete light chain sequence, and (ii) expressing the complete heavy and light chain sequences in suitable expression systems. It is within the knowledge of the skilled person to produce a full-length antibody when starting out from either CDR sequences or full variable region sequences. Thus, the skilled person would know how to generate a full-length antibody according to the present invention.
[0381] In one embodiment, the antibody is a human antibody.
[0382] The term human antibody, as used herein, is intended to include antibodies having variable and framework regions derived from human germline immunoglobulin sequences and a human immunoglobulin constant domain. The human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations, insertions or deletions introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term human antibody, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another non-human species, such as a mouse, have been grafted onto human framework sequences.
[0383] As used herein, a human antibody is derived from a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, for instance by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library, and wherein the selected human antibody is at least 90%, such as at least 95%, for instance at least 96%, such as at least 97%, for instance at least 98%, or such as at least 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene. Typically, outside the heavy chain CDR3, a human antibody derived from a particular human germline sequence will display no more than 20 amino acid differences, e.g. no more than 10 amino acid differences, such as no more than 9, 8, 7, 6 or 5, for instance no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
[0384] The antibody according to the present invention may comprise amino acid modifications in the immunoglobulin heavy and/or light chains. In a particular embodiment, amino acids in the Fc region of the antibody may be modified.
[0385] The term Fc region as used herein, refers to a region comprising, in the direction from the N- to C-terminal end of the antibody, at least a hinge region, a CH2 region and a CH3 region. An Fc region of the antibody may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system.
[0386] The term hinge region as used herein refers to the hinge region of an immunoglobulin heavy chain. Thus, for example the hinge region of a human IgG1 antibody corresponds to amino acids 216-230 according to the Eu numbering as set forth in Kabat et al. (1991). However, the hinge region may also be any of the other subtypes as described herein.
[0387] The term CH1 region or CH1 domain as used herein refers to the CH1 region of an immunoglobulin heavy chain. Thus, for example the CH1 region of a human IgG1 antibody corresponds to amino acids 118-215 according to the Eu numbering as set forth in Kabat et al. (1991). However, the CH1 region may also be any of the other subtypes as described herein.
[0388] The term CH2 region or CH2 domain as used herein refers to the CH2 region of an immunoglobulin heavy chain. Thus, for example the CH2 region of a human IgG1 antibody corresponds to amino acids 231-340 according to the Eu numbering as set forth in Kabat et al. (1991). However, the CH2 region may also be any of the other subtypes as described herein.
[0389] The term CH3 region or CH3 domain as used herein refers to the CH3 region of an immunoglobulin heavy chain. Thus for example the CH3 region of a human IgG1 antibody corresponds to amino acids 341-447 according to the Eu numbering as set forth in Kabat et al. (1991). However, the CH3 region may also be any of the other subtypes as described herein.
[0390] In another embodiment, the antibody is an effector-function-deficient antibody, a stabilized IgG4 antibody or a monovalent antibody.
[0391] In one particular embodiment, the heavy chain has been modified such that the entire hinge region has been deleted.
[0392] In one embodiment, the sequence of the antibody has been modified so that it does not comprise any acceptor sites for N-linked glycosylation.
[0393] In one embodiment, the antibody is a single-chain antibody.
[0394] In further aspect, the present invention relates to a multispecific antibody comprising at least a first binding region of an antibody according to any aspect or embodiment herein described, and a second binding region which binds a different target or epitope than the first binding region. The term multispecific antibody as used herein, refers to antibodies wherein the binding regions bind to at least two, such as at least three, different antigens or at least two, such as at least three, different epitopes on the same antigen.
[0395] In one embodiment, the present invention relates to the use of an ADC comprising a bispecific antibody comprising a first binding region of an antibody according to any aspect or embodiments herein described, and a second binding region which binds a different target or epitope than the first binding region.
[0396] The term bispecific as used herein, refers to binding molecules, such as antibodies wherein the binding regions of the binding molecule bind to two different antigens or two different epitopes on the same antigen.
[0397] The term bispecific antibody refers to an antibody having specificities for at least two different, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells, cell types or structures, such as extracellular tissue.
[0398] The term different target as used herein, refers to another protein, molecule or the like than AXL or an AXL fragment.
[0399] Examples of bispecific antibody molecules which may be used in the present invention comprise (i) a single antibody that has two arms comprising different antigen-binding regions, (ii) a single chain antibody that has specificity to two different epitopes, e.g., via two scFvs linked in tandem by an extra peptide linker; (iii) a dual-variable-domain antibody (DVD-Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., 2010); (iv) a chemically-linked bispecific (Fab)2 fragment; (v) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (vi) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (vii) a so called dock and lock molecule (Dock-and-Lock), based on the dimerization and docking domain in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (viii) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fab-arm; and (ix) a diabody.
[0400] In one embodiment, the bispecific antibody of the present invention is a diabody, a cross-body, such as CrossMabs, or a bispecific antibody obtained via a controlled Fab arm exchange (such as described in WO 2011/131746, Genmab A/S).
[0401] Examples of different classes of bispecific antibodies include but are not limited to (i) IgG-like molecules with complementary CH3 domains to force heterodimerization; (ii) recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; (iii) IgG fusion molecules, wherein full length IgG antibodies are fused to extra Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; (v) Fab fusion molecules, wherein different Fab-fragments are fused together, fused to heavy-chain constant-domains, Fc-regions or parts thereof; and (vi) ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, Nanobodies) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, Nanobodies) are fused to each other or to another protein or carrier molecule fused to heavy-chain constant-domains, Fc-regions or parts thereof.
[0402] Examples of IgG-like molecules with complementary CH3 domains molecules include but are not limited to the Triomab (Trion Pharma/Fresenius Biotech, WO/2002/020039), Knobs-into-Holes (Genentech, WO9850431), CrossMAbs (Roche, WO 2009/080251, WO 2009/080252, WO 2009/080253), electrostatically-matched Fc-heterodimeric molecules (Amgen, EP1870459 and WO2009089004; Chugai, US201000155133; Oncomed, WO2010129304), LUZ-Y (Genentech), DIG-body, PIG-body and TIG-body (Pharmabcine), Strand Exchange Engineered Domain body (SEEDbody) (EMD Serono, WO2007110205), Bispecific IgG1 and IgG2 (Pfizer/Rinat, WO11143545), Azymetric scaffold (Zymeworks/Merck, WO2012058768), mAb-Fv (Xencor, WO2011028952), XmAb (Xencor), Bivalent bispecific antibodies (Roche, WO2009/080254), Bispecific IgG (Eli Lilly), DuoBody molecules (Genmab A/S, WO 2011/131746), DuetMab (Medimmune, US2014/0348839), Biclonics (Merus, WO 2013/157953), NovImmune (Bodies, WO 2012/023053), FcAdp (Regeneron, WO 2010/151792), (DT)-Ig (GSK/Domantis), Two-in-one Antibody or Dual Action Fabs (Genentech, Adimab), mAb2 (F-Star, WO2008003116), Zybodies (Zyngenia), CovX-body (CovX/Pfizer), FynomAbs (Covagen/Janssen Cilag), DutaMab (Dutalys/Roche), iMab (Medimmune), Dual Variable Domain (DVD)-Ig (Abbott, U.S. Pat. No. 761,218), dual domain double head antibodies (Unilever; Sanofi Aventis, WO20100226923), Ts2Ab (Medimmune/AZ), BsAb (Zymogenetics), HERCULES (Biogen Idec, U.S. Ser. No. 00/795,1918), scFv-fusions (Genentech/Roche, Novartis, Immunomedics, Changzhou Adam Biotech Inc, CN 102250246), TvAb (Roche, WO2012025525, WO2012025530), ScFv/Fc Fusions, SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS), Interceptor (Emergent), Dual Affinity Retargeting Technology (Fc-DART) (MacroGenics, WO2008/157379, WO2010/080538), BEAT (Glenmark), Di-Diabody (Imclone/Eli Lilly) and chemically crosslinked mAbs (Karmanos Cancer Center), and covalently fused mAbs (AIMM therapeutics).
[0403] Examples of recombinant IgG-like dual targeting molecules include but are not limited to Dual Targeting (DT)-Ig (GSK/Domantis), Two-in-one Antibody (Genentech), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star, WO2008003116), Zybodies (Zyngenia), approaches with common light chain (Crucell/Merus, U.S. Pat. No. 7,262,028), KXBodies (NovImmune) and CovX-body (CovX/Pfizer).
[0404] Examples of IgG fusion molecules include but are not limited to Dual Variable Domain (DVD)-Ig (Abbott, U.S. Pat. No. 7,612,181), Dual domain double head antibodies (Unilever; Sanofi Aventis, WO20100226923), IgG-like Bispecific (ImClone/Eli Lilly), Ts2Ab (MedImmune/AZ) and BsAb (Zymogenetics), HERCULES (Biogen Idec, U.S. Pat. No. 7,951,918), scFv fusion (Novartis), scFv fusion (Changzhou Adam Biotech Inc, CN 102250246) and TvAb (Roche, WO2012025525, WO2012025530).
[0405] Examples of Fc fusion molecules include but are not limited to ScFv/Fc Fusions (Academic Institution), SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS), Dual Affinity Retargeting Technology (Fc-DART) (MacroGenics, WO2008157379 and WO2010080538) and Dual(ScFv)2-Fab (National Research Center for Antibody MedicineChina).
[0406] Examples of Fab fusion bispecific antibodies include but are not limited to F(ab)2 (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech).
[0407] Examples of ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE) (Micromet, Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DART) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack) and COMBODY (Epigen Biotech), dual targeting Nanobodies (Ablynx), dual targeting heavy chain only domain antibodies.
[0408] A bispecific antibody for use as an ADC according the present invention may be generated by introducing modifications in the constant region of the antibody.
[0409] In one particular embodiment, the bispecific antibody comprises a first and a second heavy chain, each of the first and second heavy chain comprises at least a hinge region, a CH2 and CH3 region, wherein in the first heavy chain at least one of the amino acids in the positions corresponding to positions selected from the group consisting of K409, T366, L368, K370, D399, F405, and Y407 in a human IgG1 heavy chain has been substituted, and in the second heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of F405, T366, L368, K370, D399, Y407, and K409 in a human IgG1 heavy chain has been substituted, and wherein the first and the second heavy chains are not substituted in the same positions.
[0410] In one embodiment, in the first heavy chain the amino acid in the position corresponding to K409 in a human IgG1 heavy chain is not K, L or M and optionally the amino acid in the position corresponding to F405 in a human IgG1 heavy chain is F, and in the second heavy chain the amino acid in the position corresponding to F405 in a human IgG1 heavy chain is not F and the amino acid in the position corresponding to K409 in a human IgG1 heavy chain is K.
[0411] In one embodiment, in the first heavy chain, the amino acid in the position corresponding to F405 in a human IgG1 heavy chain is not F, R, and G, and in the second heavy chain the amino acids in the positions corresponding to a position selected from the group consisting of; T366, L368, K370, D399, Y407, and K409 in a human IgG1 heavy chain has been substituted.
[0412] In one embodiment, the amino acid in position corresponding to K409 in a human IgG1 heavy chain is another than K, L or M in the first heavy chain, and in the second heavy chain the amino acid in position corresponding to F405 in a human IgG1 heavy chain is not F and optionally the amino acid in the position corresponding to K409 in a human IgG1 heavy chain is K.
[0413] In one embodiment, the amino acid in the position corresponding to F405 in a human IgG1 heavy chain is L in said first heavy chain, and the amino acid in the position corresponding to K409 in a human IgG1 heavy chain is R in said second heavy chain, or vice versa.
[0414] Thus, in one embodiment, the amino acid in the position corresponding to K409 in a human IgG1 heavy chain is R in the first heavy chain, and the amino acid in the position corresponding to F405 in a human IgG1 heavy chain is L in the second heavy chain.
[0415] Unless otherwise stated or contradicted by context, the amino acids of the constant region sequences are herein numbered according to the Eu-index of numbering (described in Kabat, 1991). The terms Eu-index of numbering and Eu numbering as set forth in Kabat may be used interchangeably and have the same meaning and purpose. Thus, an amino acid or segment in one sequence that corresponds to an amino acid or segment in another sequence is one that aligns with the other amino acid or segment using a standard sequence alignment program such as ALIGN, ClustalW or similar, typically at default settings and has at least 50%, at least 80%, at least 90%, or at least 95% identity to a human IgG1 heavy chain. It is well-known in the art how to align a sequence or segment in a sequence and thereby determine the corresponding position in a sequence to an amino acid position according to the present invention.
[0416] The term amino acid corresponding to position as used herein refers to an amino acid position number in a human IgG1 heavy chain.
[0417] The term amino acid and amino acid residue may herein be used interchangeably, and are not to be understood limiting.
[0418] In the context of the present invention, the amino acid may be defined by conservative or non-conservative amino acids, and may therefore be classified accordingly. Amino acid residues may also be divided into classes defined by alternative physical and functional properties. Thus, classes of amino acids may be reflected in one or both of the following lists:
Amino Acid Residue of Conservative Class:
Acidic Residues: D and E
Basic Residues: K, R, and H
Hydrophilic Uncharged Residues: S, T, N, and Q
Aliphatic Uncharged Residues: G, A, V, L, and I
Non-polar Uncharged Residues: C, M, and P
Aromatic Residues: F, Y, and W
Alternative Physical and Functional Classifications of Amino Acid Residues:
[0419] Alcohol group-containing residues: S and T
Aliphatic residues: I, L, V, and M
Cycloalkenyl-associated residues: F, H, W, and Y
Hydrophobic residues: A, C, F, G, H, I, L, M, R, T, V, W, and Y
Negatively charged residues: D and E
Polar residues: C, D, E, H, K, N, Q, R, S, and T
Positively charged residues: H, K, and R
Small residues: A, C, D, G, N, P, S, T, and V
Very small residues: A, G, and S
Residues involved in turn formation: A, C, D, E, G, H, K, N, Q, R, S, P, and T
Flexible residues: Q, T, K, S, G, P, D, E, and R
[0420] In the context of the present invention, a substitution in an antibody is indicated as:
Original Amino AcidPositionSubstituted Amino Acid;
[0421] Referring to the well-recognized nomenclature for amino acids, the three letter code, or one letter code, is used, including the codes Xaa or X to indicate any amino acid residue. Thus, Xaa or X may typically represent any of the 20 naturally occurring amino acids. The term naturally occurring as used herein refers to any one of the following amino acid residues; glycine, alanine, valine, leucine, isoleucine, serine, threonine, lysine, arginine, histidine, aspartic acid, asparagine, glutamic acid, glutamine, proline, tryptophan, phenylalanine, tyrosine, methionine, and cysteine. Accordingly, the notation K409R or Lys409Arg means, that the antibody comprises a substitution of Lysine with Arginine in amino acid position 409.
[0422] Substitution of an amino acid at a given position to any other amino acid is referred to as: Original amino acidposition; or e.g. K409
[0423] For a modification where the original amino acid(s) and/or substituted amino acid(s) may comprise more than one, but not all amino acid(s), the more than one amino acid may be separated by , or /. For example, the substitution of Lysine with Arginine, Alanine, or Phenylalanine in position 409 is:
[0424] Lys409Arg,Ala,Phe or Lys409Arg/Ala/Phe or K409R,A,F or K409R/A/F or K409 to R, A, or F.
[0425] Such designation may be used interchangeably in the context of the invention but have the same meaning and purpose.
[0426] Furthermore, the term a substitution embraces a substitution into any one or the other nineteen natural amino acids, or into other amino acids, such as non-natural amino acids. For example, a substitution of amino acid K in position 409 includes each of the following substitutions: 409A, 409C, 409D, 409E, 409F, 409G, 409H, 409I, 409L, 409M, 409N, 4090, 409R, 409S, 409I, 409V, 409W, 409P, and 409Y. This is, by the way, equivalent to the designation 409X, wherein the X designates any amino acid other than the original amino acid. These substitutions may also be designated K409A, K409C, etc. or K409A,C, etc. or K409A/C/etc. The same applies by analogy to each and every position mentioned herein, to specifically include herein any one of such substitutions.
[0427] The antibody according to the invention may also comprise a deletion of an amino acid residue. Such deletion may be denoted del, and includes, e.g., writing as K409del. Thus, in such embodiments, the Lysine in position 409 has been deleted from the amino acid sequence.
[0428] In one embodiment, both the first and the second binding region of the bispecific antibody bind AXL. However, the first binding region comprises a different set of CDR sequences than the second binding region. Thus, in a particular embodiment, the bispecific antibody comprising a first and a second binding region, and a first and a second heavy chain, wherein the first and the second binding regions each comprise a VH and VL region selected from the group consisting of; [0429] a) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; [0430] b) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733]; [0431] c) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140]; [0432] d) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 55, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154]; [0433] e) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154-M103L]; [0434] f) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171]; [0435] g) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172]; [0436] h) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181]; [0437] i) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183]; [0438] j) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q]; [0439] k) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187]; [0440] l) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01]; [0441] m) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01]; [0442] n) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 94, 95, and 95, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613]; [0443] o) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 101, DAS, and 102, respectively, [613-08]; [0444] p) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06]; [0445] q) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726]; [0446] r) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L]; [0447] s) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733]; [0448] t) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [107]; [0449] u) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 55, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154]; [0450] v) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154-M103L]; [0451] w) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171]; [0452] x) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172]; [0453] y) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181]; [0454] z) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183]; [0455] aa) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q]; [0456] bb) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187]; [0457] cc) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01]; [0458] dd) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01]; [0459] ee) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 94, 95, and 95, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613]; [0460] ff) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 101, DAS, and 102, respectively, [613-08]; [0461] gg) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06]; [0462] hh) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726]; [0463] ii) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L]; [0464] jj) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140]; [0465] kk) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 55, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154]; [0466] ll) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154-M103L]; [0467] mm) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171]; [0468] nn) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172]; [0469] oo) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181]; [0470] pp) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183]; [0471] qq) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N520]; [0472] rr) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187]; [0473] ss) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01]; [0474] tt) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01]; [0475] uu) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 94, 95, and 95, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613]; [0476] vv) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 101, DAS, and 102, respectively, [613-08]; [0477] ww) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06]; [0478] xx) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CD R1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726]; and [0479] yy) a first VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a second VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
[0480] Antibodies conjugated to a cytotoxic agent, drug or the like are also known as antibody-drug conjugates (ADC). An ADC may have a half-life of sufficient periods of time for the antibody-drug conjugate to be internalized, degraded and induce cell killing by the released toxin.
[0481] Thus, an ADC can comprise an anti-AXL antibody or bispecific antibody and a therapeutic moiety, such as a cytotoxic agent, a chemotherapeutic drug, or the like. The cytotoxic agent, chemotherapeutic drug or the like may be conjugated to the antibody or the bispecific antibody via a linker.
[0482] ADCs are often designed such that the cytotoxic payload is inactive when conjugated to the antibody. The cytotoxic payload may be released intracellularly upon internalization of the ADC after binding to the plasma-membrane of cells, or alternatively in response to proteolytic activity in the tumor microenvironment. The term internalized or internalization as used herein, refers to a biological process in which molecules such as the AXL-ADC are engulfed by the cell membrane and drawn into the interior of the cell. It may also be referred to as endocytosis.
[0483] Accordingly, in some instances it may be desired to use antibodies which undergo internalization. Such antibodies that have good internalization properties may be suited for conjugation to a cytotoxic agent, drug, or the like, optionally via a linker, which is designed to be cleaved intracellularly.
[0484] Once internalized, the ADC may be delivered to lysosomes in most cases, where effective drug release takes advantage of the catabolic environment found with these organelles. It is typically a linker that connects the antibody with a cytotoxic agent. Thus, specialized linkers have been designed to be cleaved only in a specific microenvironment found in or on the target tumor cell or in the tumor microenvironment. Examples include linkers that are cleaved by acidic conditions, reducing conditions, or specific proteases.
[0485] Stability of the antibody-linker-drug in circulation is important because this allows antibody-mediated delivery of the drug to specific target cells. In addition, the long circulating half-life of the ADC provides exposure for several days to weeks post injection. Drugs that are conjugated through non-cleavable linkers and protease-cleavable linkers are generally more stable in circulation than disulfide and hydrazone linkers, although the stability of the latter two linkers can be tuned by altering the neighboring chemical structure (Alley et al., 2010).
[0486] In one embodiment, the therapeutic moiety is a cytotoxic agent. A cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells. Suitable cytotoxic agents for forming ADCs for use in the present invention include taxol, tubulysins, duostatins, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, maytansine or an analog or derivative thereof, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin; calicheamicin or analogs or derivatives thereof; antimetabolites (such as methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine, cladribine), alkylating agents (such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin; as well as duocarmycin A, duocarmycin SA, CC-1065 (a.k.a. rachelmycin), or analogs or derivatives of CC-1065), dolastatin, auristatin, pyrrolo[2,1-c][1,4] benzodiazepins (PDBs), indolinobenzodiazepine (IGNs) or analogues thereof, antibiotics (such as dactinomycin (formerly actinomycin), bleomycin, daunorubicin (formerly daunomycin), doxorubicin, idarubicin, mithramycin, mitomycin, mitoxantrone, plicamycin, anthramycin (AMC)), anti-mitotic agents (e.g., tubulin-targeting agents), such as diphtheria toxin and related molecules (such as diphtheria A chain and active fragments thereof and hybrid molecules); ricin toxin (such as ricin A or a deglycosylated ricin A chain toxin), cholera toxin, a Shiga-like toxin (SLT-I, SLT-II, SLT-IIV), LT toxin, C3 toxin, Shiga toxin, pertussis toxin, tetanus toxin, soybean Bowman-Birk protease inhibitor, Pseudomonas exotoxin, alorin, saporin, modeccin, gelanin, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, and enomycin toxins. Other suitable conjugated molecules include antimicrobial/lytic peptides such as CLIP, Magainin 2, mellitin, Cecropin, and P18; ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, diphtherin toxin, and Pseudomonas endotoxin. See, for example, Pastan et al., Cell 47, 641 (1986) and Goldenberg, Calif. A Cancer Journal for Clinicians 44, 43 (1994). Therapeutic agents that may be administered in combination with anti-AXL antibodies or antibody-drug conjugates for use according to the present invention as described elsewhere herein, such as, e.g., anti-cancer cytokines or chemokines, are also candidates for therapeutic moieties useful for conjugation to an antibody for use according to the present invention.
[0487] The term cytotoxic agent as used herein, refers to any agent that is detrimental to (e.g., kills) cells. For a description of these classes of drugs which are well known in the art, and their mechanisms of action, see Goodman et al. (1990). Additional techniques relevant to the preparation of antibody immunotoxins are provided in for instance Vitetta et al. (1993) and U.S. Pat. No. 5,194,594.
[0488] In one embodiment, the cytotoxic agent is linked to said antibody, or fragment thereof, with a cleavable linker, such as N-succinimydyl 4-(2-pyridyldithio)-pentanoate (SSP), maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB) or AV-1 K-lock valine-citrulline.
[0489] The term cleavable linker as used herein, refers to a subset of linkers that are catalyzed by specific proteases in the targeted cell or in the tumor microenvironment, resulting in release of the cytotoxic agent. Examples of cleavable linkers are linkers based on chemical motifs including disulfides, hydrazones or peptides. Another subset of cleavable linker, adds an extra linker motif between the cytotoxic agent and the primary linker, i.e. the site that attaches the linker-drug combination to the antibody. In some embodiments, the extra linker motif is cleavable by a cleavable agent that is present in the intracellular environment (e. g. within a lysosome or endosome or caveola). The linker can be, e. g. a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including but not limited to, a lysosomal or endosomal protease. In some embodiments, the peptidyl linker is at least two amino acids long or at least three amino acids long. Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside the target cells (see e. g. Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). In a specific embodiment, the peptidyl linker cleavable by an intracellular protease is a Val-Cit (valine-citrulline) linker or a Phe-Lys (phenylalanine-lysine) linker (see e.g. U.S. Pat. No. 6,214,345, which describes the synthesis of doxorubicin with the Val-Cit linker). An advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
[0490] In another embodiment, the cytotoxic agent is linked to said antibody, or fragment thereof, with a non-cleavable linker, such as succinimidyl-4(N-maleimidomethyl)cyclohexane-1-carboxylate (MCC) or maleimidocaproyl (MC).
[0491] The term noncleavable linker as used herein, refers to a subset of linkers which, in contrast to cleavable linkers, do not comprise motifs that are specifically and predictably recognized by intracellular or extracellular proteases. Thus, ADCs based on non-cleavable linkers are not released or cleaved form the antibody until the complete antibody-linker-drug complex is degraded in the lysosomal compartment. Examples of a non-cleavable linker are thioethers. In yet another embodiment, the linker unit is not cleavable and the drug is released by antibody degradation (see US 2005/0238649). Typically, such a linker is not substantially sensitive to the extracellular environment. As used herein, not substantially sensitive to the extracellular environment in the context of a linker means that no more than 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers, in a sample of antibody drug conjugate compound, are cleaved when the antibody drug conjugate compound is present in an extracellular environment (e.g. plasma). Whether a linker is not substantially sensitive to the extracellular environment can be determined for example by incubating with plasma the antibody drug conjugate compound for a predetermined time period (e.g. 2, 4, 8, 16 or 24 hours) and then quantitating the amount of free drug present in the plasma.
[0492] In one embodiment, cytotoxic agent is selected from the group: DNA-targeting agents, e.g. DNA alkylators and cross-linkers, such as calicheamicin, duocarmycin, rachelmycin (CC-1065), pyrrolo[2,1-c][1,4] benzodiazepines (PBDs), and indolinobenzodiazepine (IGN); microtubule-targeting agents, such as duostatin, such as duostatin-3, auristatin, such as monomethylauristatin E (MMAE) and monomethylauristatin F (MMAF), dolastatin, maytansine, N(2)-deacetyl-N(2)-(3-marcapto-1-oxopropyl)-maytansine (DM1), and tubulysin; and nucleoside analogs; or an analogs, derivatives, or prodrugs thereof.
[0493] In one embodiment, the AXL-ADC comprises a combination of;
[0494] i) a cleavable linker and a cytotoxic agent having bystander kill capacity;
[0495] ii) a cleavable linker and a cytotoxic agent not having bystander kill capacity;
[0496] iii) a non-cleavable linker and a cytotoxic agent having bystander kill capacity; or
[0497] iv) a non-cleavable linker and a cytotoxic agent not having bystander kill capacity.
[0498] The term bystander killing effect, bystander kill, bystander kill capacity or bystander cytotoxicity as used herein, refers to the effect where the cytotoxic agent that is conjugated to the antibody by either a cleavable or non-cleavable linker has the capacity to diffuse across cell membranes after the release from the antibody and thereby cause killing of neighboring cells. When the cytotoxic agent is conjugated by a cleavable or non-cleavable linker, it may be either the cytotoxic agent only or the cytotoxic agent with a part of the linker that has the bystander kill capacity. The capacity to diffuse across cell membranes is related to the hydrophobicity of the the cytotoxic agent or the combination of the cytotoxic agent and the linker. Such cytotoxic agents may advantageously be membrane-permeable toxins, such as MMAE that has been released from the antibody by proteases. Especially in tumors with heterogeneous target expression and in solid tumors where antibody penetration may be limited, a bystander killing effect may be desirable.
[0499] The term no bystander kill capacity, no bystander killing effect, no-bystander kill or no bystander cytotoxicity as used herein, refers to the effect where the cytotoxic agent that is conjugated to the antibody by either a cleavable or non-cleavable linker does not have the capacity to diffuse across cell membranes after release from the antibody. Thus, such cytotoxic agents or combinations of the cytotoxic agent with the linker, will not be able to kill neighboring cells upon release from the antibody. It is believed without being bound by theory, that such combinations of a cytotoxic agent and either a cleavable or non-cleavable linker will only kill cells expressing the target that the antibody binds.
[0500] A stable link between the antibody and cytotoxic agent is an important factor of an ADC. Both cleavable and non-cleavable types of linkers have been proven to be safe in preclinical and clinical trials.
[0501] In one embodiment, the cytotoxic agent is chosen from the group of microtubule targeting agents, such as auristatins and maytansinoids.
[0502] The term microtubule-targeting agent as used herein, refers to an agent or drug which inhibits mitosis (cell division). Microtubules are structures that are essential for proper separation of DNA during cell division, and microtubule function critically depends on dynamic instability, i.e. the process in which microtubule structures are continuously elongated and shortened. Microtubule-targeting agents disrupt or stabilize microtubules, which prevents formation of the mitotic spindle, resulting in mitotic arrest and apoptosis. The microtubule-targeting agents can be derived from e.g. natural substances such as plant alkaloids, and prevent cells from undergoing mitosis by disrupting or stabilizing microtubule polymerization, thus preventing formation of the mitotic spindle and subsequent cell division, resulting in inhibition of cancerous growth. Examples of microtubule-targeting agents are paclitaxel, docetaxel, vinblastine, vincristine, vinorelbine, duostatins, auristatins, maytansanoids, tubulysins, and dolastatin.
[0503] In one embodiment, the cytotoxic agent is auristatins or auristatin peptide analogs and derivates (U.S. Pat. Nos. 5,635,483; 5,780,588). Auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis and nuclear and cellular division (Woyke et al., 2001) and have anti-cancer (U.S. Pat. No. 5,663,149) and anti-fungal activity (Pettit, 1998). The auristatin drug moiety may be attached to the antibody via a linker, through the N (amino) terminus or the C (terminus) of the peptidic drug moiety.
[0504] Exemplary auristatin embodiments include the N-terminus-linked monomethyl auristatin drug moieties D.sub.E and D.sub.F, disclosed in Senter et al. (2004) and described in US 2005/0238649.
[0505] In a particular embodiment, the cytotoxic agent is monomethyl auristatin E (MMAE);
##STR00001##
[0506] wherein the antibody is linked to MMAE at the nitrogen (N) on the left-hand side of the chemical structure above by the appropriate linker.
[0507] In one embodiment, the cytotoxic agent monomethyl auristatin E (MMAE) is linked to the antibody via a valine-citrulline (VC) linker.
[0508] In another embodiment, the cytotoxic agent monomethyl auristatin E (MMAE) is linked to the antibody via a valine-citrulline (VC) linker and the maleimidocaproyl (MC)linker, wherein the combination of the cytotoxic agent and the linkers has the chemical structure;
##STR00002##
[0509] wherein MAb is the antibody.
[0510] In one embodiment, the cytotoxic agent is monomethyl auristatin F (MMAF);
##STR00003##
[0511] wherein the antibody is linked to MMAF at the nitrogen (N) on the left-hand side of the chemical structure above by the appropriate linker.
[0512] In one embodiment, the cytotoxic agent monomethyl auristatin F (MMAF) is linked to the antibody via a maleimidocaproyl (mc)-linker, wherein the combination of the cytotoxic agent and linker has the chemical structure;
##STR00004##
[0513] wherein MAb is the antibody.
[0514] In one embodiment, the cytotoxic agent is duostatin3.
[0515] In another particular embodiment, the cytotoxic agent is a DNA-targeting agent.
[0516] The term DNA-targeting agent as used herein, refers to a specific class of cytotoxic agents which are able to alkylate and/or cross-link DNA. An example of such a DNA-acting agent is IGN agents comprising indolino-benzodiazepinedimers and pyrrolo[2,1-c][1,4]benzodiazepines (PBDs) which are highly potent by virtue of their ability to alkylate and cross-link DNA. Another example is IGN agents comprising indolino-benzodiazepinemonomers which are highly potent by virtue of the ability to alkylate only DNA. Duocarmycins are another class of DNA-acting agents. Duocarmycins are small-molecule, synthetic DNA minor groove binding alkylating agents. These compounds are suitable to target solid tumors as well as hematological tumors.
[0517] In one embodiment, the AXL-ADC comprises two to four cytotoxic molecules per antibody. Depending on the chemical properties of the toxin and the linker-toxin combination, two to four cytotoxic molecules per antibody may be superior to more heavily loaded conjugates that are cleared more rapidly from the circulation than less loaded conjugates. The cytotoxic agent loading is represented by p and is the average number of cytotoxic agent moieties per antibody in a molecule (also designated as the drug to antibody ratio, DAR). The cytotoxic agent loading may range from 1 to 20 drug moieties per antibody and may occur on amino acids with useful functional groups such as, but not limited to, amino or sulfhydryl groups, as in lysine or cysteine.
[0518] In one embodiment, the number of cytotoxic agents per antibody is from 1 to 8, such as 2 to 7, such as 2 to 6, such as 2 to 5, such as 2 to 4, and such as 2 to 3.
[0519] In another embodiment, the AXL-ADC comprises four to eight cytotoxic molecules per antibody. In another embodiment, the AXL-ADC comprises six to ten cytotoxic molecules per antibody. In yet another embodiment, the AXL-ADC comprises 10 to 30, such as 15 to 25, such as 20, cytotoxic molecules per antibody.
[0520] Depending on the way of conjugation, p may be limited by the number of attachment sites on the antibody, for example where the attachment is a cysteine thiol or a lysine. Generally, antibodies do not contain many free and reactive cysteine thiol groups which may be linked to a drug moiety as most cysteine thiol residues in antibodies exist as disulfide bridges. Therefore, in those embodiments, where the cytotoxic agent is conjugated via a cysteine thiol, the antibody may be reduced with reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or fully reducing conditions, to generate reactive cysteine thiol groups. In certain embodiments, the drug loading for an ADC of the invention ranges from 1 to about 8, as a maximum of 8 free cysteine thiol groups becomes available after (partial) reduction of the antibody (there are 8 cysteines involved in inter-chain disulfide bonding).
[0521] In one embodiment, the drug linker moiety is vcMMAE. The vcMMAE drug linker moiety and conjugation methods are disclosed in WO 2004/010957; U.S. Pat. Nos. 7,659,241; 7,829,531; and U.S. Pat. No. 7,851,437 (Seattle Genetics; each of which incorporated herein by reference). vcMMAE is formed by conjugation of the linker mc-vc-PAB and the cytotoxic moiety MMAE, and the vcMMAE drug linker moiety is bound to the anti-AXL antibodies at the cysteine residues using a method similar to those disclosed therein, e.g., as described in Example 8.
[0522] In one embodiment, the drug linker moiety is mcMMAF. The mcMMAF drug linker moiety and conjugation methods are disclosed in U.S. Pat. Nos. 7,498,298; 7,994,135 and WO 2005/081711 (Seattle Genetics; each of which incorporated herein by reference), and the mcMMAF drug linker moiety is bound to the anti-AXL antibodies at the cysteine residues using a method similar to those disclosed therein.
[0523] In one embodiment, the cytotoxic agent is linked to 1 or 2 lysines within the antibody amino acid sequence by K-Lock conjugation as described in WO 2013/173391, WO 2013/173392 and WO 2013/173393 (Concortis Biosystems). Duostatin3 (also known as Duo3) may also be bound to the anti-AXL antibodies at the lysine residues using a method similar to those described therein.
[0524] Other linker technologies may be used in the anti-AXL antibody drug conjugates for the use of the invention, such as linkers comprising a hydroxyl group.
[0525] In one embodiment, the linker is attached to free cysteine residues of the anti-AXL antibody obtained by (partial) reduction of the anti-AXL antibody.
[0526] In a particular embodiment, the linker is mc-vc-PAB and the cytotoxic agent is MMAE; or the linker SSP and the cytotoxic agent is DM1.
[0527] In a particular embodiment, the linker is MMC and the cytotoxic agent is DM1; or the linker is MC and the cytotoxic agent is MMAF.
[0528] In a particular embodiment, the linker is the cleavable linker AV1-K lock and the cytotoxic agent is duostatin3.
[0529] In one embodiment the AXL-ADC comprises the linker mc-vc-PAB, the cytotoxic agent MMAE and an antibody wherein the at least one binding region comprises a VH region and a VL region selected from the group consisting of;
[0530] In one embodiment, the antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: [0531] (y) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:39, GAS, and 40, respectively, [107]; [0532] (z) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:49, AAS, and 50, respectively, [148]; [0533] (aa) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:117, DAS, and 118, respectively [733]; [0534] (bb) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:55, GAS, and 56, respectively [154]; [0535] (cc) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:55, GAS, and 56, respectively [154-M103L]; [0536] (dd) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:60, GAS, and 61, respectively, [171]; [0537] (ee) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:65, GAS, and 66, respectively, [172]; [0538] (ff) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:70, GAS, and 71, respectively, [181]; [0539] (gg) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:76, ATS, and 77, respectively, [183]; [0540] (hh) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:76, ATS, and 77, respectively, [183-N52Q]; [0541] (ii) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:78, 79, and 80, respectively; and a VL region comprising the CD R1, CDR2, and CDR3 sequences of SEQ ID Nos.:81, AAS, and 82, respectively, [187]; [0542] (jj) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:83, 84, and 85, respectively; and a VL region comprising the CD R1, CDR2, and CDR3 sequences of SEQ ID Nos.:86, GAS, and 87, respectively, [608-01]; [0543] (kk) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:91, GAS, and 92, respectively, [610-01]; [0544] (ll) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 94, and 95, respectively; and a VL region comprising the CD R1, CDR2, and CDR3 sequences of SEQ ID Nos.:96, GAS, and 97, respectively, [613]; [0545] (mm) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:101, DAS, and 102, respectively, [613-08]; [0546] (nn) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:106, GAS, and 107, respectively, [620-06]; [0547] (oo) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:112, AAS, and 113, respectively, [726]; [0548] (pp) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:112, AAS, and 113, respectively, [726-M101L]; [0549] (qq) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:44, AAS, and 45, respectively, [140]; [0550] (rr) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 94, and 95, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:128, XAS, wherein X is D or G, and 129, respectively, [613/613-08]; [0551] (ss) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:49, AAS, and 50, respectively, [148/140]; [0552] (tt) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171/172/181]; and [0553] (uu) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:112, AAS, and 113, respectively [726/187]; and [0554] (vv) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:96, GAS, and 97, respectively [613/608-01/610-01/620-06].
[0555] In another alternative embodiment, an anti-AXL antibody drug conjugate comprises a conjugated nucleic acid or nucleic acid-associated molecule. In one such embodiment, the conjugated nucleic acid is a cytotoxic ribonuclease, an antisense nucleic acid, an inhibitory RNA molecule (e.g., a siRNA molecule) or an immunostimulatory nucleic acid (e.g., an immunostimulatory CpG motif-containing DNA molecule).
[0556] In another alternative embodiment, an anti-AXL antibody is conjugated to an aptamer or a ribozyme or a functional peptide analog or derivate thereof.
[0557] In another alternative embodiment, anti-AXL antibody drug conjugates comprising one or more radiolabeled amino acids are provided. A radiolabeled anti-AXL antibody may be used for both diagnostic and therapeutic purposes (conjugation to radiolabeled molecules is another possible feature). Non-limiting examples of labels for polypeptides include .sup.3H, .sup.14C, .sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, and .sup.125I, .sup.131I, and .sup.186Re. Methods for preparing radiolabeled amino acids and related peptide derivatives are known in the art (see for instance Junghans et al. (1996); U.S. Pat. Nos. 4,681,581; 4,735,210; 5,101,827; 5,102,990; 5,648,471; and 5,697,902. For example, a halogen radioisotope may be conjugated by a chloramine T method.
[0558] In one embodiment, the antibody is conjugated to a radioisotope or to a radioisotope-containing chelate. For example, the antibody can be conjugated to a chelator linker, e.g. DOTA, DTPA or tiuxetan, which allows for the antibody to be complexed with a radioisotope. The antibody may also or alternatively comprise or be conjugated to one or more radiolabeled amino acids or other radiolabeled molecules. A radiolabeled anti-AXL antibody may be used for both diagnostic and therapeutic purposes. Non-limiting examples of radioisotopes include .sup.3H, .sup.14C, .sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.125I, .sup.111In, .sup.131I, .sup.186Re, .sup.213Bs, .sup.225Ac and .sup.227Th.
[0559] Anti-AXL antibodies may also be chemically modified by covalent conjugation to a polymer to for instance increase their circulating half-life. Exemplary polymers, and methods to attach them to peptides, are illustrated in for instance U.S. Pat. Nos. 4,766,106; 4,179,337; 4,495,285 and 4,609,546. Additional polymers include polyoxyethylated polyols and polyethylene glycol (PEG) (e.g., a PEG with a molecular weight of between about 1,000 and about 40,000, such as between about 2,000 and about 20,000). This may for example be used if the anti-AXL antibody is a fragment.
[0560] Any method known in the art for conjugating the anti-AXL antibody to the conjugated molecule(s), such as those described above, may be employed, including the methods described by Hunter et al. (1974), Pain et al. (1981) and Nygren (1982). Such antibodies may be produced by chemically conjugating the other moiety to the N-terminal side or C-terminal side of the anti-AXL antibody (e.g., an anti-AXL antibody H or L chain) (see, e.g., Kanemitsu, 1994). Such conjugated antibody derivatives may also be generated by conjugation at internal residues or sugars, or non-naturally occurring amino acids or additional amino acids that have been introduced into the antibody constant domain, where appropriate.
[0561] The agents may be coupled either directly or indirectly to an anti-AXL antibody. One example of indirect coupling of a second agent is coupling via a spacer moiety to cysteine or lysine residues in the antibody. In one embodiment, an anti-AXL antibody is conjugated, via a spacer or linker, to a prodrug molecule that can be activated in vivo to a therapeutic drug. After administration, the spacers or linkers are cleaved by tumor cell-associated enzymes or other tumor-specific conditions, by which the active drug is formed. Examples of such pro-drug technologies and linkers are described in WO 2002/083180, WO 2004/043493, WO 2007/018431, WO 2007/089149, WO 2009/017394 and WO 2010/62171 (Syngenta BV; each of which incorporated herein by reference). Suitable antibody-pro-drug technology and duocarmycin analogs can also be found in U.S. Pat. No. 6,989,452 (Medarex; incorporated herein by reference).
[0562] In one embodiment, the anti-AXL antibody is attached to a chelator linker, e.g. tiuxetan, which allows for the antibody to be conjugated to a radioisotope.
Combinations, Compositions and Kits
[0563] The AXL-ADC for use according to the present invention can be administered in the form of a composition. In one aspect, the composition is a pharmaceutical composition comprising the AXL-ADC and a pharmaceutical carrier.
[0564] In one embodiment, the AXL-ADC or pharmaceutical composition comprising the AXL-ADC is for use in treating a neoplasm in combination with the at least one therapeutic agent with which the neoplasm is being or has been treated, i.e., the chemotherapeutic agent, tyrosine kinase inhibitor, PI3K inhibitor, mAb/rTKI and/or serine/threonine kinase inhibitor according to any preceding aspect or embodiment. For example, the therapeutic agent may be a chemotherapeutic agent, a TKI or a S/Th TKI according to any preceding aspect or embodiment. Typically, the AXL-ADC and the therapeutic agent are separately administered.
[0565] In one embodiment, however, the pharmaceutical composition comprising the AXL-ADC further comprises the at least one therapeutic agent with which the neoplasm is being or has been treated, i.e., the chemotherapeutic agent, tyrosine kinase inhibitor, PI3K inhibitor, mAb/rTKI and/or serine/threonine kinase inhibitor according to any preceding aspect or embodiment. For example, the therapeutic agent may be a chemotherapeutic agent, a TKI or a S/Th TKI according to any preceding aspect or embodiment. The AXL-ADCs for use according to the present invention in combination with the at least one therapeutic agent can be also be provided in the form of a kit, for simultaneous, separate or sequential administration, wherein the kit may further comprise instructions for use. The ADC and the at least one therapeutic agent are typically formulated as separate pharmaceutical compositions.
[0566] In one embodiment, the tyrosine kinase inhibitor in the combination, composition or kit is an EGFR antagonist.
[0567] In one embodiment, the tyrosine kinase inhibitor in the combination, composition or kit is selected from the group consisting of erlotinib, gefitinib, lapatinib, imatinib, sunitinib, crizotinib, midostaurin (PKC412) and quizartinib (AC220), such as, e.g., erlotinib or an analog or derivative thereof such as lapatinib, gefitinib or. In a preferred embodiment, the tyrosine kinase inhibitor is erlotinib.
[0568] In one embodiment, the serine/threonine kinase inhibitor in the combination, composition or kit is selected from vemurafenib, dabrafenib, selumetinib (AZD6244), VTX11E, trametinib and PLX4720.
[0569] In one embodiment, the BRAF inhibitor in the combination, composition or kit is vemurafenib (PLX4032) or a therapeutically effective analog or derivative thereof, such as dabrafenib or PLX4720. In one embodiment, the BRAF inhibitor is vemurafenib. In one embodiment, the BRAF-inhibitor is dabrafenib.
[0570] In one embodiment, the serine/threonine kinase inhibitor in the combination, composition or kit comprises at least one BRAF-inhibitor and at least one MEK-inhibitor, wherein the at least one BRAF-inhibitor is selected from vemurafenib, dabrafenib and a combination thereof, and wherein the MEK-inhibitor is selected from selumetinib (AZD6244) and trametinib, and a combination thereof. For example, the combination, composition or kit may comprise dabrafenib and trametinib; vemurafenib and trametinib; dabrafenib, vemurafenib and trametinib; dabrafenib and selumetinib; or vemurafenib and selumetinib.
[0571] In one embodiment, the at least one chemotherapeutic agent in the combination, composition or kit is a taxane, for example selected from paclitaxel and docetaxel.
[0572] In one embodiment, the at least one chemotherapeutic agent in the combination, composition or kit is selected from the group consisting of cisplatin, carboplatin, doxorubicin, etoposide and metformin.
[0573] In one embodiment, the PI3K inhibitor in the combination, composition or kit is alpelisib (BYL719).
[0574] In one embodiment, the mAb/rTKiin the combination, composition or kit is Cetuximab or MAB391.
[0575] The kits can further include, if desired, one or more of various conventional pharmaceutical kit components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers, etc., as will be readily apparent to those skilled in the art. Printed instructions, either as inserts or as labels, indicating quantities of the components to be administered, guidelines for administration, and/or guidelines for mixing the components, can also be included in the kit.
[0576] The pharmaceutical compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in Remington: The Science and Practice of Pharmacy (1995).
[0577] The pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients should be suitable for the AXL-ADC and the chosen mode of administration. Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.) upon antigen binding).
[0578] A pharmaceutical composition may also include diluents, fillers, salts, buffers, detergents (e. g., a nonionic detergent, such as Tween-20 or Tween-80), stabilizers (e.g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
[0579] The actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
[0580] The pharmaceutical composition may be administered by any suitable route and mode. Suitable routes of administering a compound of the present invention in vivo and in vitro are well known in the art and may be selected by those of ordinary skill in the art.
[0581] In one embodiment, the pharmaceutical composition is administered parenterally.
[0582] The terms parenteral administration and administered parenterally as used herein refers to modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intra-arterial, intrathecal, intracapsular, intra-orbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrasternal injection and infusion.
[0583] In one embodiment, the pharmaceutical composition is administered by intravenous or subcutaneous injection or infusion.
[0584] Pharmaceutically acceptable carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption-delaying agents, and the like that are physiologically compatible with an AXL-ADC or therapeutic agent for the use according to the present invention.
[0585] Examples of suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions include water, saline, phosphate-buffered saline, ethanol, dextrose, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, corn oil, peanut oil, cottonseed oil, and sesame oil, carboxymethyl cellulose colloidal solutions, tragacanth gum and injectable organic esters, such as ethyl oleate, and/or various buffers. Other carriers are well known in the pharmaceutical arts.
[0586] Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions is contemplated.
[0587] Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
[0588] Pharmaceutical compositions may also comprise pharmaceutically acceptable antioxidants for instance (1) water-soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal-chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
[0589] Pharmaceutical compositions may also comprise isotonicity agents, such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
[0590] The pharmaceutical compositions may also contain one or more adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition. The AXL-ADCs or therapeutic agents for the uses of the present invention may be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and micro-encapsulated delivery systems. Such carriers may include gelatin, glyceryl monostearate, glyceryl distearate, biodegradable, biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, poly-ortho-esters, and polylactic acid alone or with a wax, or other materials well known in the art. Methods for the preparation of such formulations are generally known to those skilled in the art. See e.g., Robinbson: Sustained and Controlled Release Drug Delivery Systems (1978).
[0591] In one embodiment, the compounds may be formulated to ensure proper distribution in vivo. Pharmaceutically acceptable carriers for parenteral administration include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions is contemplated. Other active or therapeutic compounds may also be incorporated into the compositions.
[0592] Pharmaceutical compositions for injection must typically be sterile and stable under the conditions of manufacture and storage. The composition may be formulated as a solution, micro-emulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier may be an aqueous or a non-aqueous solvent or dispersion medium containing for instance water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. The proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as glycerol, mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g. as enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, examples of methods of preparation are vacuum-drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0593] Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, examples of methods of preparation are vacuum-drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Production of Anti-AXL Antibodies
[0594] The antibodies for use as ADCs according to the invention can be prepared recombinantly in a host cell, using nucleic acid constructs, typically in the form of one or more expression vectors. In one embodiment, the nucleic acid construct encodes one or more sequences set out in Table 1. In a further embodiment, the expression vector further comprises a nucleic acid sequence encoding the constant region of a light chain, a heavy chain or both light and heavy chains of an antibody, e.g. a human IgG1, K monoclonal antibody.
[0595] The expressed anti-AXL antibody may subsequently be conjugated to a moiety as described herein. In another embodiment the anti-AXL antibody may subsequently be used to generate a bispecific antibody as described herein, before conjugation.
[0596] The expression vector may be any suitable vector, including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements). Examples of such vectors include derivatives of SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral nucleic acid (RNA or DNA) vectors. In one embodiment, an anti-AXL antibody-encoding nucleic acid is comprised in a naked DNA or RNA vector, including, for example, a linear expression element (as described in for instance Sykes and Johnson (1997), a compacted nucleic acid vector (as described in for instance U.S. Pat. No. 6,077,835 and/or WO 00/70087), a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119, a midge minimally-sized nucleic acid vector (as described in for instance Schakowski et al. (2001)), or as a precipitated nucleic acid vector construct, such as a calcium phosphate-precipitated construct (as described in for instance WO 00/46147; Benvenisty and Reshef, 1986; Wigler et al., 1978; and Coraro and Pearson, 1981). Such nucleic acid vectors and the usage thereof are well known in the art (see for instance U.S. Pat. Nos. 5,589,466 and 5,973,972).
[0597] In one embodiment, the vector is suitable for expression of the anti-AXL antibody in a bacterial cell. Examples of such vectors include expression vectors such as BlueScript (Stratagene), pIN vectors (Van Heeke and Schuster, 1989), pET vectors (Novagen, Madison Wis.) and the like).
[0598] An expression vector may also or alternatively be a vector suitable for expression in a yeast system. Any vector suitable for expression in a yeast system may be employed. Suitable vectors include, for example, vectors comprising constitutive or inducible promoters such as alpha factor, alcohol oxidase and PGH (reviewed in Ausubel et al., 1987, and Grant et al., 1987).
[0599] A nucleic acid construct and/or vector may also comprise a nucleic acid sequence encoding a secretion/localization sequence, which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media. Such sequences are known in the art, and include secretion leader or signal peptides, organelle targeting sequences (e. g., nuclear localization sequences, ER retention signals, mitochondrial transit sequences, chloroplast transit sequences), membrane localization/anchor sequences (e. g., stop transfer sequences, GPI anchor sequences), and the like.
[0600] In an expression vector, the anti-AXL antibody-encoding nucleic acids may comprise or be associated with any suitable promoter, enhancer, and other expression-facilitating elements. Examples of such elements include strong expression promoters (e.g., human CMV IE promoter/enhancer as well as RSV, SV40, SL3-3, MMTV, and HIV LTR promoters), effective poly (A) termination sequences, an origin of replication for plasmid product in E. coli, an antibiotic resistance gene as selectable marker, and/or a convenient cloning site (e.g., a polylinker). Nucleic acids may also comprise an inducible promoter as opposed to a constitutive promoter such as CMV IE (the skilled artisan will recognize that such terms are actually descriptors of a degree of gene expression under certain conditions).
[0601] In one embodiment, the anti-AXL-antibody-encoding expression vector may be positioned in and/or delivered to the host cell or host animal via a viral vector.
[0602] The host cell can be a recombinant eukaryotic or prokaryotic host cell, such as a transfectoma, which produces an anti-AXL antibody as defined herein or a bispecific molecule of the invention as defined herein. Examples of host cells include yeast, bacterial and mammalian cells, such as CHO or HEK cells or derivatives thereof. For example, in one embodiment, the cell comprises a nucleic acid stably integrated into the cellular genome that comprises a sequence coding for expression of the anti-AXL antibody. In another embodiment, the cell comprises a non-integrated nucleic acid, such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of the anti-AXL antibody.
[0603] The term recombinant host cell (or simply host cell), as used herein, is intended to refer to a cell into which an expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell, but also to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term host cell as used herein. Recombinant host cells include, for example, transfectomas, such as CHO cells, HEK-293 cells, PER.C6, NS0 cells, and lymphocytic cells, and prokaryotic cells such as E. coli and other eukaryotic hosts such as plant cells and fungi.
[0604] The term transfectoma, as used herein, includes recombinant eukaryotic host cells expressing the antibody or a target antigen, such as CHO cells, PER.C6, NS0 cells, HEK-293 cells, plant cells, or fungi, including yeast cells.
[0605] The antibody may alternatively be produced from a hybridoma prepared from murine splenic B cells obtained from mice immunized with an antigen of interest, for instance in form of cells expressing the antigen on the surface, or a nucleic acid encoding an extracellular region of AL. Monoclonal antibodies may also be obtained from hybridomas derived from antibody-expressing cells of immunized humans or non-human mammals such as rabbits, rats, dogs, primates, etc.
[0606] Human antibodies may be generated using transgenic or transchromosomal mice, e.g. HuMAb mice, carrying parts of the human immune system rather than the mouse system. The HuMAb mouse contains a human immunoglobulin gene minilocus that encodes unrearranged human heavy ( and ) and light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous and chain loci (Lonberg et al., 1994a). Accordingly, the mice mount a human antibody response upon immunization, the introduced human heavy and light chain transgenes, undergo class switching and somatic mutation to generate high affinity human IgG, monoclonal antibodies (Lonberg et al., 1994b; Lonberg and Huszar, 1995; Harding and Lonberg, 1995). The preparation of HuMAb mice is described in detail in Taylor et al., 1992; Chen et al., 1993; Tuaillon et al., 1994; and Fishwild et al., 1996. See also U.S. Pat. Nos. 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,877,397; 5,661,016; 5,814,318; 5,874,299; 5,770,429; 5,545,807; WO 98/024884; WO 94/025585; WO 93/001227; WO 92/022645; WO 92/003918; and WO 01/009187. Splenocytes from these transgenic mice may be used to generate hybridomas that secrete human monoclonal antibodies according to well-known techniques. In addition human antibodies may be generated from transgenic mice or rats to produce human-rat chimeric antibodies that can be used as a source for the recombinant production of fully human monoclonal antibodies.
[0607] Further, human antibodies may be identified through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, mammalian display, yeast display and other techniques known in the art, and the resulting molecules may be subjected to additional maturation, such as affinity maturation, as such techniques are well known in the art.
TABLE-US-00004 TABLE4 Sequences SEQID NO: Name Aminoacidsequence Comments 1 107VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGK HCo12-BalbC GLEWVSTTSGSGASTYYADSVKGRFTISRDNSKNTLYLQMNSLR Ig1domain AEDTAVYYCAKIWIAFDIWGQGTMVTVSS bindingAb 2 107VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGSSPYTFGQGTKLEIK 3 140VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMTWVRQAPGK GLEWVSAISISGASTFYADSVKGRFTISRDNSKNTLSLQMNSLRA EDTAVYFCRGYSGYVYDAFDIWGQGTMVTVSS 4 140VL DIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPEKA PKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQ QYNSYPLTFGGGTKVEIK 5 148VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMTWVRQAPGK HCo12-BalbC GLEWVSAISISGGSTFYADSVKGRFTISRDNSKNTLYLQMNSLRA Ig2domain EDTAVYYCRGYSGYVYDAFDFWGQGTMVTVSS bindingAb 6 148VL DIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPEKA PKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQ QYNSYPLTFGGGTKVEIK 7 154VH EVQLLDSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGK HCo12-BalbC GLEWVSAISIGGGNAYYADSVKGRFTISRDNSKNTLYLQMNSLR FN1domain AADTAVYYCAKPGFIMVRGPLDYWGQGALVTVSS bindingAb 8 154-M103LVH EVQLLDSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGK GLEWVSAISIGGGNAYYADSVKGRFTISRDNSKNTLYLQMNSLR AADTAVYYCAKPGFILVRGPLDYWGQGALVTVSS 9 154VL EIVLTQSPGTLSLSPGERATLSCRASQSVSNSYLAWYQQKPGQA PRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QYGSSPYTFGQGTKLEIK 10 171VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGK HCo17-BalbC GLEWVSDISVSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLR Ig2domain AEDTAVYYCAKEGYIWFGESLSYAFDIWGQGTMVTVSS bindingAb 11 171VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGRSFTFGPGTKVDIK 12 172VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGK GLEWVSDISVSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLR AEDTAVYYCAKEGYIWFGESLSYAFDIWGQGTMVTVSS 13 172VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGRSFTFGPGTKVDIK 14 181VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGK GLEWVSDISVSGGSTYYADSVKGRFTISRDNSKNTLYLHMNSLR AEDTAVYYCAKEGYIWFGESLSYAFDIWGQGTMVTVSS 15 181VH EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGRSFTFGPGTKVDIK 16 183VH QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGK HCo17-BalbC GLEWIGEINQSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAA FN1domain DTSVYYCASGNWDHFFDYWGQGTLVTVSS bindingAb 17 183-N52QVH QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGK GLEWIGEIQQSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAA DTSVYYCASGNWDHFFDYWGQGTLVTVSS 18 183VL DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQHKPGKA PKLLIYATSSLQSGVTSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ AKSFPWTFGQGTKVEIK 19 187VH QVPLQQWGAGLLKPSETLSLTCAVYGGSFSGYHWSWIRQPPGK GLEWIGEISHSGRTNYNPSLKSRVTISIDTSKNQFSLKLSSVTAAD TAVYYCASFITMIRGTIITHFDYWGQGTLVTVSS 20 187VL DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKA PKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQ QYHSYPYTFGQGTKLEIK 21 608-01VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQ GLEWMGRIIPIFGIANYVQKFQGRVTITADKSTSTAYMELSSLRA EDTAVYYCARRGDYYGSGSPDVFDIWGQGTMVTVSS 22 608-01VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGSSYTFGQGTKLEIK 23 610-01VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQ GLEWMGRIIPIFGIANYVQKFQGRVTITADKSTSTAYMELSSLRA EDTAVYYCARRGNYYGSGSPDVFDIWGQGTMVTVSS 24 610-01VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGSSYTFGQGTKLEIK 25 613VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWMRQAPG HCo20 QGLEWMGRIIPIFGIVNYAQKFQGRVTLTADKSTSTAYMELSSLR Ig1domain SEDTAVYYCARRGNYYGSGSPDVFDIWGQGTMVTVSS bindingAb 26 613VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQK PGQAPRLLIYGASSRATGIPDRFSGSGSGTOFTLTISRLEPE DFAVYYCQQYGSSYTFGQGTKLEIK 27 613-08VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWMRQAPG QGLEWMGRIIPIFGIVNYAQKFQGRVTLTADKSTSTAYMELSSLR SEDTAVYYCARRGNYYGSGSPDVFDIWGQGTMVTVSS 28 613-08VL EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPR LLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQR SNWLTFGGGTKVEIK 29 620-06VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQ GLEWMGRIIPIFGIANYAQKFQGRVTITADKSTSTAYMELSSLRS EDTAVYYCARRGNYYGSGSPDVFDIWGQGTMVTVSS 30 620-06VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAP RLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGSSYTFGQGTKLEIK 31 726VH QVQLQQWGAGLLKPSETLSLTCAIDGGSFSGYYWSWIRQPPGK HCo17-BalbC GLEWIGEISHSGRTNYNPSLKSRVTISIDTSKNQFSLKLSSVAAAD FN2domain TAVYYCARFITMIRGAIITHFDYWGQGALVTVSS bindingAb 32 726-M101LVH QVQLQQWGAGLLKPSETLSLTCAIDGGSFSGYYWSWIRQPPGK GLEWIGEISHSGRTNYNPSLKSRVTISIDTSKNQFSLKLSSVAAAD TAVYYCARFITLIRGAIITHFDYWGQGALVTVSS 33 726VL DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKA PKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQ QYHSYPYTFGQGTKLEIK 34 733VH QVQLVESGGGVVQPGRSLRLSCAASGFSFSTYAMHWVRQAPG HCo17-BalbC KGLEWVAVISYDGDNKYSADSVKGRFTISRDNSKNTLYLQMNSL FN1domain RAEDTAVYYCARGRKLGIDAFDIWGQGTMVTVSS bindingAb 35 733VL AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPK LLIYDASSLESGVPSRFSGSGSGTDFTLTISGLQPEDFATYYCQQF NSYPFTFGPGTKVDIK 36 107VHCDR1 GFTFSSYA 37 107VHCDR2 TSGSGAST 38 107VHCDR3 AKIWIAFDI 39 107VLCDR1 QSVSSSY 107VLCDR2 GAS 40 107VLCDR3 QQYGSSPYT 41 140VHCDR1 GFTFSSYA 42 140VHCDR2 ISISGAST 43 140VHCDR3 RGYSGYVYDAFDI 44 140VLCDR1 QGISNW 140VLCDR2 AAS 45 140VLCDR3 QQYNSYPLT 46 148VHCDR1 GFTFSSYA 47 148VHCDR2 ISISGGST 48 148VHCDR3 RGYSGYVYDAFDF 49 148VLCDR1 QGISNW 148VLCDR2 AAS 50 148VLCDR3 QQYNSYPLT 51 154VHCDR1 GFTFSSYA 52 154VHCDR2 ISIGGGNA 53 154VHCDR3 AKPGFIMVRGPLDY 54 154-M103LVH AKPGFILVRGPLDY CDR3 55 154VLCDR1 QSVSNSY 154VLCDR2 GAS 56 154VLCDR3 QQYGSSPYT 57 171VHCDR1 GFTFSSYA 58 171VHCDR2 ISVSGGST 59 171VHCDR3 AKEGYIWFGESLSYAFDI 60 171VLCDR1 QSVSSSY 171VLCDR2 GAS 61 171VLCDR3 QQYGRSFT 62 172VHCDR1 GFTFSNYA 63 172VHCDR2 ISVSGGST 64 172VHCDR3 AKEGYIWFGESLSYAFDI 65 172VLCDR1 QSVSSSY 172VLCDR2 GAS 66 172VLCDR3 QQYGRSFT 67 181VHCDR1 GFTFSSYA 68 181VHCDR2 ISVSGGST 69 181VHCDR3 AKEGYIWFGESLSYAFDI 70 181VLCDR1 QSVSSSY 181VLCDR2 GAS 71 181VLCDR3 QQYGRSFT 72 183VHCDR1 GGSFSGYY 73 183VHCDR2 INQSGST 74 183-N52QVH IQQSGST CDR2 75 183VHCDR3 ASGNWDHFFDY 76 183VLCDR1 QGISSW 183VLCDR2 ATS 77 183VLCDR3 QQAKSFPWT 78 187VHCDR1 GGSFSGYH 79 187VHCDR2 ISHSGRT 80 187VHCDR3 ASFITMIRGTIITHFDY 81 187VLCDR1 QGISSW 187VLCDR2 AAS 82 187VLCDR3 QQYHSYPYT 83 608-01VHCDR1 GGTFSSYA 84 608-01VHCDR2 IIPIFGIA 85 608-01VHCDR3 ARRGDYYGSGSPDVFDI 86 608-01VLCDR1 QSVSSSY 608-01VLCDR2 GAS 87 608-01VLCDR3 QQYGSSYT 88 610-01VHCDR1 GGTFSSYA 89 610-01VHCDR2 IIPIFGIA 90 610-01VHCDR3 ARRGNYYGSGSPDVFDI 91 610-01VLCDR1 QSVSSSY 610-01VLCDR2 GAS 92 610-01VLCDR3 QQYGSSYT 93 613VHCDR1 GGTFSSYA 94 613VHCDR2 IIPIFGIV 95 613VHCDR3 ARRGNYYGSGSPDVFDI 96 613VLCDR1 QSVSSSY 613VLCDR2 GAS 97 613VLCDR3 QQYGSSYT 98 613-08VHCDR1 GGTFSSYA 99 613-08VHCDR2 IIPIFGIV 100 613-08VHCDR3 ARRGNYYGSGSPDVFDI 101 613-08VLCDR1 QSVSSY 613-08VLCDR2 DAS 102 613-08VLCDR3 QQRSNWLT 103 620-06VHCDR1 GGTFSSYA 104 620-06VHCDR2 IIPIFGIA 105 620-06VHCDR3 ARRGNYYGSGSPDVFDI 106 620-06VLCDR1 QSVSSSY 620-06VLCDR2 GAS 107 620-06VLCDR3 QQYGSSYT 108 726VHCDR1 GGSFSGYY 109 726VHCDR2 ISHSGRT 110 726VHCDR3 ARFITMIRGAIITHFDY 111 726-M101LVH ARFITLIRGAIITHFDY CDR3 112 726VLCDR1 QGISSW 726VLCDR2 AAS 113 726VLCDR3 QQYHSYPYT 114 733VHCDR1 GFSFSTYA 115 733VHCDR2 ISYDGDNK 116 733VHCDR3 ARGRKLGIDAFDI 117 733VLCDR1 QGISSA 733VLCDR2 DAS 118 733VLCDR3 QQFNSYPFT 119 Ig2domainVH ISISGXST-whereinXisAorG CDR2 120 Ig2domainVH RGYSGYVYDAFDX-whereinXisIorF CDR3 121 FN2domainVH GGSFSGYX-whereinXisHorY CDR1 122 FN2domainVH AX1FITMIRGX2IITHFDY-whereinX1isSorR;and CDR3 X2isTorA 123 FN1domainVH GFTFSXYA-whereinXisSorN CDR1 124 FN1domainVH ISVSGGST CDR2 125 FN1domainVH AKEGYIWFGESLSYAFDI CDR3 126 Ig1domainVH IIPIFGIX-whereinXisAorV CDR2 127 Ig1domainVH ARRGXYYGSGSPDVFDI-whereinXisDorN CDR3 128 Ig1domainVL QSVXSSY-whereinXisSordel CDR1 Ig1domainVL XAS-whereinXisDorG CDR2 129 Ig1domainVL QQX1X2X3X4X5T-whereinX1isRorY;X2isSorG; CDR3 X3isNorS;X4isWorS;andX5isLorY 130 HumanAXL MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGN protein PGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQT (Swissprot QVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVS P30530) QPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLL WLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTT SRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTL QAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGS QAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVT LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQ PVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRK KETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVA VKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSER ESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMA DIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIY NGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMW EIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSR CWELNPODRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGG GYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPST TPSPAQPADRGSPAAPGQEDGA 131 Musmusculus MAWRCPRMGRVPLAWCLALCGWACMYPYDVPDYAAHKDTQ AXL TEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDG QILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQ CMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSC QAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFS CEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPG LSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPH QLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPP ENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEV LMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPL EPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGAVVAAACV LILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTE ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQ LNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVM RLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYL PTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSV CVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSD VWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADC LDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEI LYVNMDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVH PAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA 132 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGN AXL-Mus PGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQT musculusIg1 QVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVS domain QPGYVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLL WLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTT SRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTL QAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGS QAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVT LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQ PVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRK KETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCF QGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQML VKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFG LSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFG VTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLY ALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVN MDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGR YVLCPSTTPSPAQPADRGSPAAPGQEDGA 133 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGN AXL-Mus PGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQT musculusIg2 QVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVS domain QPGYVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLL WLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTT SRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTL QAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGS QAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVT LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQ PVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRK KETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCF QGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQML VKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFG LSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFG VTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLY ALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVN MDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGR YVLCPSTTPSPAQPADRGSPAAPGQEDGA 134 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGN AXL-Mus PGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQT musculusFN1 QVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVS domain QPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLL WLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTT SRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNL QAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTP YHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENISATRNGSQA FVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLE LQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPV HQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKE TRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEK LRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCF QGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQML VKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFG LSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFG VTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLY ALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVN MDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGR YVLCPSTTPSPAQPADRGSPAAPGQEDGA 135 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGN AXL-Mus PGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQT musculusFN2 QVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVS domain QPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLL WLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTT SRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTL QAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENVSAMRNG SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVT LELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQP LHHLVSEPPPRAFSWPWWYVLLGAVVAAACVLILALFLVHRRKK ETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKE KLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAV KTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERE SFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMAD IASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYN GDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEI ATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRC WELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGG YPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTT PSPAQPADRGSPAAPGQEDGA 136 511VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGK Ig2domain GLEWVSGISGSGGHTYHADSVKGRFTISRDNSKNTLYLQMNSLR bindingAb AEDTAVYYCAKDRYDILTGYYNLLDYWGQGTLVTVSS 137 511VHCDR1 GFTFSSYA 138 511VHCDR2 ISGSGGHT 139 511VHCDR3 AKDRYDILTGYYNLLDY 140 511VL DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEEAP KSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ YNSYPLTFGGGAKVEIK 141 511VLCDR1 QGISSW 511VLCDR2 AAS 142 511VLCDR3 QQYNSYPLT 143 061VH QVQLVQSGAEVKKPGASVKVSCKASGYAFTGYGISWVRQAPGQ Ig1domain GLEWIGWISAYNGNTNYVQNLQDRVTMTTDTSTSTAYMELRSL bindingAb RSDDTAVYYCARDHISMLRGIIIRNYWGQGTLVTVSS 144 061VL EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPR LLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRS SWPRLTFGGGTKVEIK 145 137VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSRYAISWVRQAPGQ GLEWMGRIIPIVGIANYAQKFQGRVTLTADKSTSTAYMELSSLRS EDTAVYYCAREAGYSSSWYAEYFQHWGQGTLVTVSS 146 137VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAP RLLIYGASSRATGFPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ YGSSPYTFGQGTKLEIK 147 Cynomolgus AWRCPRMGRVPLAWCLALCGWVCMAPRGTQAEESPFVGNP monkeyAXL GNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQT (GenBank QVPLGEDEQDDWIVVSQLRIASLQLSDAGQYQCLVFLGHQNFV number SQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDL HB387229.1) LWLQDAVPLATAPGHGPQRNLHVPGLNKTSSFSCEAHNAKGVT TSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTL QAVLSDDGMGIQAGEPDPPEEPLTLQASVPPHQLRLGSLHPHTP YHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQ AFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTL ELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQP VHQLVKETSAPAFSWPWWYILLGAVVAAACVLILALFLVHRRKK ETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKE KLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAV KTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERE SFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMAD IASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYN GDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEI ATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRC WELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGG YPEPPGAAGGADPPTQLDPKDSCSCLTSAEVHPAGRYVLCPSTA PSPAQPADRGSPAAPGQEDGA 148- SeeExample3 153
[0608] The present invention is further illustrated by the following examples which should not be construed as further limiting.
EXAMPLES
Example 1Immunization and Generation of AXL Antibodies
Expression Constructs for AXL
[0609] The following codon-optimized constructs for expression of various full-length AXL variants were generated: human (Homo sapiens) AXL (Genbank accession no. NP_068713.2), human-cynomolgus monkey chimeric AXL in which the human extracellular domain (ECD) was replaced with the ECD of cynomolgus monkey (Macaca fascicularis) AXL (translation of Genbank accession HB387229.1; aa 1-447), human-mouse chimeric AXL in which the human ECD was replaced with the ECD of mouse (Mus musculus) AXL (Genbank accession NP_033491.2; aa 1-441), human-mouse chimeric AXL in which the human Ig-like domain I (aa 1-134, also termed Ig1 domain herein) was replaced with the Ig-like domain I of mouse AXL, human-mouse chimeric AXL in which the human Ig-like domain II (aa 148-194, also termed Ig2 domain herein) was replaced by the Ig-like domain II of mouse AXL, human-mouse chimeric ALX in which the human FNIII-like domain I (aa 227-329, also termed FN1 domain herein) was replaced with the FNIII-like domain I of mouse AXL, human-mouse chimeric AXL in which the human FNIII-like domain II (aa 340-444, also termed FN2 domain herein) was replaced by the FNIII-like domain II of mouse AXL. In addition, the following codon-optimized constructs for various AXL ECD variants were generated: the extracellular domain (ECD) of human AXL (aa 1-447) with a C-terminal His tag (AXLECDHis), the FNIII-like domain II of human AXL (aa 327-447) with a N-terminal signal peptide and a C-terminal His tag (AXL-FN2ECDHis), and the Ig1 and Ig2 domains of human AXL (aa 1-227) with a C-terminal His tag (AXL-Ig12ECDHis).
[0610] The constructs contained suitable restriction sites for cloning and an optimal Kozak (GCCGCCACC) sequence (Kozak et al., 1999). The constructs were cloned in the mammalian expression vector pcDNA3.3 (Invitrogen).
AXL Expression in EL4 Cells
[0611] EL4 cells were stable transfected with the pcDNA3.3 vector containing the full human AXL coding sequence and stable clones were selected after selection with the antibiotic agent, G418, (Geneticin).
Purification of His-Tagged AXL
[0612] AXLECDHis, AXL-FN2ECDHis, and AXL-Ig12ECDHis were expressed in HEK-293F cells. The His-tag enables purification with immobilized metal affinity chromatography. In this process, a chelator fixed onto the chromatographic resin is charged with Co.sup.2+ cations. His-tagged protein containing supernatants were incubated with the resin in batch mode (i.e. solution). The His-tagged protein binds strongly to the resin beads, while other proteins present in the culture supernatant do not bind or bind weakly compared to the His-tagged proteins. After incubation the beads are retrieved from the supernatant and packed into a column. The column is washed in order to remove weakly bound proteins. The strongly bound His-tagged proteins are then eluted with a buffer containing imidazole, which competes with the binding of His to Co.sup.2+. The eluent is removed from the protein by buffer exchange on a desalting column.
Immunization
[0613] Antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-183, IgG1-AXL-613, and IgG1-AXL-726 were derived from the following immunizations: HCo12-BalbC (IgG1-AXL-107), HCo17-BalbC (IgG1-AXL-183, IgG1-AXL-726) and HCo20 (IgG1-AXL-061, IgG1-AXL-613) transgenic mice (Medarex, San Jose, Calif., USA) which were immunized alternatingly intraperitoneally (IP) with 20 g of the AXLECDHis protein (IgG1-AXL-511, IgG1-AXL-613, IgG1-AXL-183) et al., 20 pig AXL-FN2ECDHIS plus 20 AXL-Ig12ECDHis (IgG1-AXL-726), or 20 g AXL-Ig12ECDHis (IgG1-AXL-107) and subcutaneously (SC; at the tail base) with the same protein, with an interval of 14 days. In total 8 immunizations were performed: 4 IP and 4 SC immunizations. For most immunizations, the first immunization was performed in complete Freunds' adjuvant (CFA; Difco Laboratories, Detroit, Mich., USA) and all subsequent immunizations in incomplete Freunds' adjuvant (IFA; Difco Laboratories, Detroit, Mich., USA). Antibody IgG1-AXL-183 was derived from immunizations that were all performed in Sigma adjuvant system (Sigma-Aldrich, St. Louis, Mo., USA).
[0614] Antibodies IgG1-AXL-137, IgG1-AXL-148, IgG1-AXL-154, IgG1-AXL-171, and IgG1-AXL-733 were derived from the following immunizations: HCo12-BalbC (IgG1-AXL-137, IgG1-AXL-148), HCo17-BalbC (IgG1-AXL-154, IgG1-AXL-733), and HCo20-BalbC (IgG1-AXL-171) transgenic mice (Medarex, San Jose, Calif., USA) were immunized with 20 pig of the AXLECDHis protein in CFA. Subsequently, mice were immunized alternating intraperitoneally (IP) with EL4 cells transfected with full length human AXL in PBS and subcutaneously (SC; at the tail base) with the AXLECDHis protein in IFA, with an interval of 14 days.
[0615] Mice with at least two sequential AXL specific antibody titers of 200 (serum dilutions of 1/200) or higher, detected in the antigen specific screening FMAT assay as described below, were boosted 3-4 days prior to fusion (10 g of AXL-derived protein in PBS injected intravenously).
Homogeneous Antigen Specific Screening Assay
[0616] The presence of anti-AXL antibodies in sera of immunized mice or HuMab (human monoclonal antibody) hybridoma or transfectoma culture supernatant was determined by homogeneous antigen specific screening assays using Fluorometric Micro volume Assay Technology (FMAT; Applied Biosystems, Foster City, Calif., USA). For this, two different test designs with combinations of either 4 or 8 cell based assays were used.
[0617] The 4 cell based assay test design was used for the testing of sera from immunized mice and as primary screening test for hybridoma or transfectoma culture supernatant. In the 4 assay test design samples were analyzed for binding of human antibodies to A431 (DSMZ) and MDA-MB-231 cells (both expressing AXL at the cell surface) as well as binding to TH1021-AXL (HEK-293F cells transiently expressing full length human AXL; produced as described above) and HEK293 wild-type cells (negative control which does not express AXL), respectively.
[0618] Hybridoma or transfectoma culture supernatant samples were additionally subjected to an 8 cell based assay test design. In the 8 assay test design samples were analyzed for binding of human antibodies to TH1021-hAXL (HEK-293F cells transiently expressing the human AXL), TH1021-cAXL (HEK-293F cells transiently expressing human-cynomolgus AXL chimeras in which the human ECD had been replaced with the ECD of cynomolgus monkey AXL), TH1021-mAXL (HEK-293F cells transiently expressing human-mouse AXL chimeras in which the human ECD had been replaced with the ECD of mouse AXL), TH1021-mIg1 (HEK-293F cells transiently expressing the human AXL with the Ig-like domain I being replaced by the Ig-like domain I of mouse AXL), TH1021-mIg2 (HEK-293F cells transiently expressing human AXL with the Ig-like domain II being replaced by the Ig-like domain II of mouse AXL), TH1021-mFN1 (HEK-293F cells transiently expressing human AXL with the FNIII-like domain I being replaced by the FNIII-like domain I of mouse AXL), TH1021-mFN2 (HEK-293F cells transiently expressing human AXL with the FNIII-like domain II being replaced by the FNIII-like domain II of mouse AXL), and HEK293 wild-type cells (negative control which does not express AXL), respectively.
[0619] Samples were added to the cells to allow binding to AXL. Subsequently, binding of HuMab was detected using a fluorescent conjugate (Goat anti-Human IgG Fc gamma-DyLight649; Jackson ImmunoResearch). The AXL specific humanized mouse antibody A0704P (produced in HEK-293F cells) was used as a positive control and HuMab-mouse pooled serum and ChromPure Human IgG, whole molecule (Jackson ImmunoResearch), respectively, were used as negative controls. The samples were scanned using an Applied Biosystems 8200 Cellular Detection System (8200 CDS) and mean fluorescence was used as read-out. Samples were stated positive when counts were higher than 50 and counts x fluorescence was at least three times higher than the negative control.
HuMab Hybridoma Generation
[0620] The HuMab mouse with sufficient antigen-specific titer development (described above) was sacrificed and the spleen and lymph nodes flanking the abdominal aorta and vena cava were collected. Fusion of splenocytes and lymph node cells to a mouse myeloma cell line (SP2.0 cells) was done by electrofusion using a CytoPulse CEEF 50 Electrofusion System (Cellectis, Paris, France), essentially according to the manufacturer's instructions. Next, the primary wells were sub-cloned using the ClonePix system (Genetix, Hampshire, UK). To this end, specific primary well hybridomas were seeded in semisolid medium made from 40% CloneMedia (Genetix, Hampshire, UK) and 60% HyQ 2 complete media (Hyclone, Waltham, USA). The sub clones were retested according to the antigen-specific binding assay as described above and scanned using the IsoCyte sytem (Molecular Devices, LLC, Sunnyvale, Calif.). IgG levels were measured using an Octet (Fortebio, Menlo Park, USA) in order to select the best producing clone per primary well for further expansion. Further expansion and culturing of the resulting HuMab hybridomas were done based upon standard protocols (e.g. as described in Coligan J. E., Bierer, B. E., Margulies, D. H., Shevach, E. M. and Strober, W., eds. Current Protocols in Immunology, John Wiley & Sons, Inc. et al., 2006). Clones derived by this process were designated PC1021.
Mass Spectrometry of Purified Antibodies
[0621] Small 0.8 ml aliquots of antibody containing hybridoma supernatant from 6-well or Hyperflask stage were purified using PhyTip columns containing Protein G resin (PhyNexus Inc., San Jose, USA) on a Sciclone ALH 3000 workstation (Caliper Lifesciences, Hopkinton, USA). The PhyTip columns were used according to manufacturer's instructions, but buffers were replaced by: Binding Buffer PBS (B. Braun, Medical B. V., Oss, Netherlands) and Elution Buffer 0.1M Glycine-HCl pH 2.7 (Fluka Riedel-de Haen, Buchs, Germany). After purification, samples were neutralized with 2M Tris-HCl pH 9.0 (Sigma-Aldrich, Zwijndrecht, Netherlands). Alternatively, in some cases larger volumes of culture supernatant were purified using Protein A affinity column chromatography.
[0622] After purification, the samples were placed in a 384-well plate (Waters, 100 l square well plate, part#186002631). Samples were deglycosylated overnight at 37 C. with N-glycosidase F. DTT (15 mg/ml) was added (1 l/well) and incubated for 1 h at 37 C. Samples (5 or 6 l) were desalted on an Acquity UPLC (Waters, Milford, USA) with a BEH300 C18, 1.7 m, 2.150 mm column at 60 C. MQ water and LC-MS grade acetonitrile (Biosolve, cat no 01204101, Valkenswaard, The Netherlands) with both 0.1% formic acid (Fluka, cat no 56302, Buchs, Germany), were used as Eluent A and B, respectively. Time-of-flight electrospray ionization mass spectra were recorded on-line on a micrOTOF mass spectrometer (Bruker, Bremen, Germany) operating in the positive ion mode. Prior to analysis, a 900-3000 m/z scale was calibrated with ES tuning mix (Agilent Technologies, Santa Clara, USA). Mass spectra were deconvoluted with DataAnalysis software v. 3.4 (Bruker) using the Maximal Entropy algorithm searching for molecular weights between 5 and 80 kDa.
[0623] After deconvolution the resulting heavy and light chain masses (under reducing conditions) for all samples were compared in order to find duplicate antibodies. In the comparison of the heavy chains the possible presence of C-terminal lysine variants was taken into account. This resulted in a list of unique antibodies, where unique is defined as a unique combination of heavy and light chains. In case duplicate antibodies were found, the results from other tests were used to decide which antibody was the best material to continue experiments with.
Sequence Analysis of the AXL Antibody Variable Domains and Cloning in Expression Vectors
[0624] Total RNA was prepared from 0.2 to 510.sup.6 hybridoma cells and 5-RACE-Complementary DNA (cDNA) was prepared from 100 ng total RNA, using the SMART RACE cDNA Amplification kit (Clontech), according to the manufacturer's instructions. VH and VL coding regions were amplified by PCR and cloned directly, in frame, in the pG1f and pKappa expression vectors, by ligation independent cloning (Aslanidis, C. and P. J. de Jong, Nucleic Acids Res 1990; 18(20): 6069-74). For each antibody, 12 VL clones and 12 VH clones were sequenced. The resulting sequences are shown in Table 4. CDR sequences were defined according to IMGT (Lefranc et al., 1999 and Brochet, 2008). Clones with a correct Open Reading Frame (ORF) were selected for further study and expression. Vectors of all combinations of heavy chains and light chains that were found were transiently co-expressed in Freestyle 293-F cells using 293fectin.
[0625] For antibodies IgG1-AXL-154, IgG1-AXL-183 and IgG1-AXL-726, the following variants with point mutations in the variable domains were generated: IgG1-AXL-154-M103L, IgG1-AXL-183-N52Q and IgG1-AXL-726-M101L. Mutants were generated by site-directed mutagenesis using the Quickchange II mutagenesis kit (Stratagene).
AXL Control Antibodies
[0626] In some of the Examples a comparison antibody against AXL was used (IgG1-YW327.6S2) that has been previously described (EP 2 220 131, U3 Pharma; WO 2011/159980, Genentech). The VH and VL sequences for these AXL-specific antibodies were cloned into the pG1f and pKappa expression vectors.
b12 Antibody
[0627] In some of the examples the antibody b12, a gp120 specific antibody (Barbas, 1993) was used as a negative control.
Expression
[0628] Antibodies were expressed as IgG1,. Plasmid DNA mixtures encoding both heavy and light chains of antibodies were transiently transfected to Freestyle HEK293F cells (Invitrogen, US) using 293fectin (Invitrogen, US) essentially as described by the manufacturer.
Purification of Antibodies
[0629] Culture supernatant was filtered over 0.2 m dead-end filters, loaded on 5 mL MabSelect SuRe columns (GE Health Care) and eluted with 0.1 M sodium citrate-NaOH, pH 3. The eluate was immediately neutralized with 2M Tris-HCl, pH 9 and dialyzed overnight to 12.6 mM NaH2PO4, 140 mM NaCl, pH 7.4 (B.Braun). Alternatively, subsequent to purification, the eluate was loaded on a HiPrep Desalting column and the antibody was exchanged into 12.6 mM NaH2PO4, 140 mM NaCl, pH 7.4 (B.Braun) buffer. After dialysis or exchange of buffer, samples were sterile filtered over 0.2 m dead-end filters. Purity was determined by SDS-PAGE and IgG concentration was measured using an Octet (Fortebio, Menlo Park, USA). Purified antibodies were stored at 4 C. The antibody IgG1-AXL-511 was generated by the following method:
Expression Constructs for AXL
[0630] The following codon-optimized constructs for expression of various full-length AXL variants were generated: human (Homo sapiens) AXL (Genbank accession no. NP_068713.2), human-cynomolgus monkey chimeric AXL in which the human extracellular domain (ECD) was replaced with the ECD of cynomolgus monkey (Macaca fascicularis) AXL (translation of Genbank accession HB387229.1; aa 1-447), human-mouse chimeric AXL in which the human ECD was replaced with the ECD of mouse (Mus musculus) AXL (Genbank accession NP_033491.2; aa 1-441), human-mouse chimeric AXL in which the human Ig-like domain I (aa 1-147, also termed Ig1 domain herein) was replaced with the Ig-like domain I of mouse AXL, human-mouse chimeric AXL in which the human Ig-like domain II (aa 148-227, also termed Ig2 domain herein) was replaced by the Ig-like domain II of mouse AXL, human-mouse chimeric ALX in which the human FNIII-like domain I (aa 228-326, also termed FN1 domain herein) was replaced with the FNIII-like domain I of mouse AXL, human-mouse chimeric AXL in which the human FNIII-like domain II (aa 327-447, also termed FN2 domain herein) was replaced by the FNIII-like domain II of mouse AXL. In addition, the following codon-optimized constructs for various AXL ECD variants were generated: the extracellular domain (ECD) of human AXL (aa 1-447) with a C-terminal His tag (AXLECDHis), the FNIII-like domain II of human AXL (aa 327-447) with a N-terminal signal peptide and a C-terminal His tag (AXL-FN2ECDHis), and the Ig1 and Ig2 domains of human AXL (aa 1-227) with a C-terminal His tag (AXL-Ig12ECDHis).
[0631] The constructs contained suitable restriction sites for cloning and an optimal Kozak (GCCGCCACC) sequence (Kozak et al. (1999) Gene 234: 187-208). The constructs were cloned in the mammalian expression vector pcDNA3.3 (Invitrogen).
AXL Expression in EL4 Cells
[0632] EL4 cells were stable transfected with the pcDNA3.3 vector containing the full length human AXL coding sequence and stable clones were selected after selection with the antibiotic agent, G418, (Geneticin).
Purification of His-Tagged AXL
[0633] AXLECDHis, AXL-FN2ECDHis, and AXL-Ig12ECDHis were expressed in HEK293F cells and purified with immobilized metal affinity chromatography.
Immunization
[0634] Material from 4 transgenic mice expressing human antibody gene sequences was used for selecting antibodies. Mice immunized with various immunization protocols and with various antibody responses and yielding various numbers of antibodies from the traditional hybridoma process were chosen. Mouse A (3.5% hits in the hybridoma process) was an HCo17-BALB/c transgenic mouse (Bristol-Myers Squibb, Redwood City, Calif., USA) was immunized alternatingly intraperitoneally (IP) with 20 g AXL-FN2ECDHIS plus 20 g AXL-Ig12ECDHis) and subcutaneously (SC) at the tail base) with the same protein, with an interval of 14 days. In total 8 immunizations were performed: 4 IP and 4 SC immunizations. For most immunizations, the first immunization was performed in complete Freunds' adjuvant (CFA; Difco Laboratories, Detroit, Mich., USA) and all subsequent immunizations in incomplete Freunds' adjuvant (IFA; Difco Laboratories, Detroit, Mich., USA). Mouse B (0% hits in the hybridoma process) was a HCo12 transgenic mouse (Medarex) immunized with 20 g of the AXLECDHis protein using a similar immunization protocol as mouse A. Mouse C (38% hits in the hybridoma process) was a HCo12-BALB/c mouse immunized alternating intraperitoneally (IP) with EL4 cells transfected with full length human AXL in PBS and subcutaneously (SC; at the tail base) with the AXLECDHis protein in IFA, with an interval of 14 days. Mouse D (0% hits in the hybridoma process) was a HCo12 transgenic mouse (Medarex) immunized with 20 g of the AXL-Ig12ECDHis protein in using a similar immunization protocol as mouse A.
[0635] Mice with at least two sequential AXL specific antibody titers of 200 (serum dilutions of 1/200) or higher, were boosted 3-4 days prior to fusion (10 g of AXL-derived protein in PBS injected intravenously).
Isolation of RNA from Spleen Cells
[0636] Total RNA was isolated from spleen cells using the Mini RNA easy kit (Qiagen). First strand cDNA for 5-RACE was synthesized using 150 ng of RNA using the SMART RACE cDNA Amplification kit (Clontech, Mountain View, Calif., USA), PrimeScript Reverse Transcriptase (Clontech) and the SMART IIA oligo and oligodT as primers. VL encoding regions were amplified by PCR using Advantage 2 polymerase (Clontech), the primers RACEkLIC4shortFW2 (320 nM), RACEkLIC4LongFW2 (80 nM) and RACEkLICRV_PmIA3 (400 nM), performing 35 cycles of 30 seconds at 95 C., and 1 minute at 68 C. VH encoding regions were amplified by PCR using Pfu Ultra II Fusion HS DNA polymerase (Stratagene), the primers RACEG1LIC3shortFW (320 nM), RACEG1LIC3IongFW (80 nM) and RACEG1LIC3RV2 (400 nM), performing 40 cycles of 20 seconds at 95 C. et al., 20 seconds at 66 C. and 30 seconds at 72 C., ending with a finale extension step of 3 minutes at 72 C. VH or VL encoding PCR products were separated using agarose gel electrophoresis and DNA products of the expected size were cut from the gel and purified using the Qiagen MiniElute kit. VH and VL coding regions amplified by PCR were cloned, in frame, in the mammalian expression vectors pG1f (containing the human IgG1 constant region encoding DNA sequence) for the VH region and pKappa (containing the kappa light chain constant region encoding DNA sequence) for the VL region, by ligation independent cloning (Aslanidis, C. and P. J. de Jong, Nucleic Acids Res 1990; 18(20): 6069-74) in E. coli strain DH5T1R (Life technologies), yielding single bacterial colonies each containing a single HC or LC expression vector.
Primer Sequences
[0637]
TABLE-US-00005 Primername Primersequence SMARTIIA 5-AAGCAGTGGTATCAACGCAGAGTACGCGGG(SEQIDNO:154) RACEkLIC4shortFW2 5-ACGGACGGCAGGACCACT(SEQIDNO:155) RACEkLIC4LongFW2 5-ACGGACGGCAGGACCACTAAGCAGTGGTATCAACGCAGA(SEQIDNO:156) RACEkLICRV_PmIA3 5-CAGCAGGCACACCACTGAGGCAGTTCCAGATTTC(SEQIDNO:157) RACEG1LIC3shortFW 5-ACGGACGGCAGGACCAGT(SEQIDNO:158) RACEG1LIC3longF2 5-ACGGACGGCAGGACCAGTAAGCAGTGGTATCAACGCAGAGT(SEQIDNO:159) RACEG1LIC3RV2 5-GGAGGAGGGCGCCAGTGGGAAGACCGA(SEQIDNO:160) CMVPf(RRA2) 5-GCCAGATATACGCGTTGACA(SEQIDNO:161) TKpAR(RRA2) 5-GATCTGCTATGGCAGGGCCT(SEQIDNO:162)
LEE PCR
[0638] Linear expression elements (LEE'S) were produced by amplifying the fragment containing the CMV promoter, HC or LC encoding regions and the poly A signal containing elements from the expression plasmids. For this the regions were amplified using Accuprime Taq DNA polymerase (Life Technologies) and the primers CMVPf(Bsal)2 and TkpA(Bsal)r, performing 35 cycles of 45 seconds at 94 C., 30 seconds at 55 C. and 2 (LC) or 3 (HC) minutes at 68 C., using material of E. coli (strain DH5a) colonies, containing the plasmids, as a DNA template.
Transient Expression in HEK-293 Cells
[0639] Antibodies were expressed as IgG1,. Plasmid DNA mixtures encoding both heavy and light chains of antibodies were transiently transfected in Freestyle 293-F (HEK293F) cells (Life technologies, USA) using 293fectin (Life technologies) essentially as described by Vink, T., et al. (2014) (A simple, robust and highly efficient transient expression system for producing antibodies, Methods, 65 (1), 5-10).
[0640] For LEE expression of Abs 1 l of the HC LEE PCR reaction mixture, 1 l of the LC PCR reaction mixture and 1 l of a 30 ng/l enhancing mix containing a mix of 3 expression enhancing plasmids as described in Vink, T., et al. (2014), were mixed and transfected in HEK293F cells in a total volume of 100 l using 293 fectin as transfection reagent, according to the instructions of the manufacturer (Life technologies), using 96 well plates as vessel, essentially as described supra.
AXLECDHis ELISA
[0641] ELISA plates (Greiner, Netherlands) were coated with 100 l/well of 0.5 g/ml AXLECDHis in Phosphate buffered saline (PBS) and incubated for 16 hours at room temperature (RT). The coating solution was removed and the wells were blocked by adding 150 l PBSTC (PBS containing 0.1% tween-20 and 2% chicken serum) well and incubating for 1 hour at RT. The plates were washed three times with 300 l PBST (PBS containing 0.1% tween-20)/well and 100 l of test solution was added, followed by an incubation of 1 hour at RT. After washing three times with 300 l of PBST/well, 100 l antibody goat anti human IgG coupled with horse radish peroxidase (diluted 1/3000) was added and incubated for 1 hour at RT. After washing three times with 300 l of PBST/well, 100 l of ABTS (1 mg/ml) solution was added and incubated at RT until sufficient signal was observed and the reaction was stopped by adding 100 l of 2% oxalic acid solution. 96 well plates were measured on an ELISA reader at 405 nm.
Diversity Screen
[0642] Samples were analyzed for binding of antibodies to TH1021-hAXL (HEK293F cells transiently expressing the human AXL), TH1021-cAXL (HEK293F cells transiently expressing human-cynomolgus AXL chimeras in which the human ECD had been replaced with the ECD of cynomolgus monkey AXL), TH1021-mAXL (HEK293F cells transiently expressing human-mouse AXL chimeras in which the human ECD had been replaced with the ECD of mouse AXL), TH1021-mIg1 (HEK293F cells transiently expressing the human AXL with the Ig-like domain I being replaced by the Ig-like domain I of mouse AXL), TH1021-mIg2 (HEK293F cells transiently expressing human AXL with the Ig-like domain II being replaced by the Ig-like domain II of mouse AXL), TH1021-mFN1 (HEK293F cells transiently expressing human AXL with the FNIII-like domain I being replaced by the FNIII-like domain I of mouse AXL), TH1021-mFN2 (HEK293F cells transiently expressing human AXL with the FNIII-like domain II being replaced by the FNIII-like domain II of mouse AXL), and HEK293F cells (negative control which does not express AXL), respectively.
[0643] Samples from the LEE expression were added to the cells to allow binding to the various AXL constructs. Subsequently, binding of antibodies was detected using a fluorescent conjugate (Goat anti-Human IgG Fc gamma-DyLight649; Jackson ImmunoResearch). The samples were scanned using an Applied Biosystems 8200 Cellular Detection System (8200 CDS) and mean fluorescence was used as read-out. Samples were stated positive when counts were higher than 50 and counts x fluorescence was at least three times higher than the negative control.
Provision of HC and LC Pools:
[0644] For each mouse, 352 HC expression vector containing bacterial colonies and 384 LC expression vector containing bacterial colonies were picked and amplified by LEE PCR. Part of the LEE reaction was sequenced (AGOWA). The percentage proper VH insert containing constructs differed largely between the 4 mice, mouse A (50%), mouse B (23%), mouse C (90%) and mouse D (14%) and resembled the variation of hits obtained in the hybridoma process, see supra. The HC diversity in the mice with only a limited amount of proper inserts were dominated by a large group of identical HCs, 65/83 in mouse B and 46/49 in mouse D. For mouse B and D the unique HCs (9 for mouse B, 4 for mouse D) were selected. For mouse A and C no selection was made.
Co-Transfection of HCs with a LC Pool
[0645] The single HC encoding LEE's were co-transfected with a pool of 96 LC encoding LEE's using the LEE transfection protocol.
HC Selection of AXL Binding Antibodies
[0646] For mouse B and D, supernatants from the LEE co-transfections of the single HC with the pooled LCs were analyzed for AXL binding of the produced antibody mixtures by the AXL ELISA. 7 of the 9 HCs from mouse B resulted in AXL binding and 4 out of 4 of the HC from mouse D resulted in AXL binding.
[0647] For mouse A and C supernatants from the LEE co-transfections of the single HC with the pooled LCs were analyzed for AXL binding of the produced antibody mixtures by the diversity screen. This screen enabled both the identification of AXL binding HCs and a rough epitope mapping, by identifying the loss of binding of antibodies to AXL variants. From mouse A approximately 40% of the HCs bound to human AXL, most of which lost binding either to the Ig1 or FNIII-2 domain, when these domains were replaced by the mouse equivalent. From mouse C approximately 70% of the HCs bound to human AXL, most of which lost binding either to the Ig1 or Ig2 domain, when these domains were replaced by the mouse equivalent. Based on binding as determined by AXL ELISA or the diversity screen, HC sequence information and loss of binding to specific AXL domains in the diversity screen a total of 12 unique HCs were selected for determination of the best LC.
Co-Transfection of HCs with Single LCs
[0648] Each single HC LEE of the 12 unique selected HCs was co-transfected with 96 single LC LEEs from the LC pool of the corresponding mice.
LC Selection of AXL Binding Antibodies
[0649] Supernatants of the LEE expression of the single HC/LC combinations were analyzed for AXL binding of the produced antibody by the AXL ELISA. For each HC at least 6 LCs were found and a single LC was selected as best, based on both the ELISA results and the LC sequence information. AXL binding antibodies were identified from all 4 mice, even the mice which were not successful in the hybridoma process.
Binding Affinity of Antibody 511
[0650] The affinity of one anti-AXL antibody (clone 511) was determined.
[0651] Affinity was determined using Bio-Layer Interferometry on a ForteBio OctetRED384. Anti-human Fc Capture (AHC) biosensors (ForteBio, Portsmouth, UK; cat no. 18-5064) were loaded for 150 s with hIgG (1 g/mL) aiming at a loading response of 1 nm. After a baseline (150 s) the association (1000 s) and dissociation (2000 s) of AXLECDHis (as described in Example 1) was determined, using a concentration range of 10 g/mL-0.16 g/mL (218 nM-3 nM) with 2-fold dilution steps. For calculations, the theoretical molecular mass of AXLECDHis based on the amino acid sequence was used, i.e. 46 kDa. Experiments were carried out on an OctetRED384, while shaking at 1000 rpm and at 30 C. Each antibody was tested in three independent experiments.
[0652] Data was analyzed with ForteBio Data Analysis Software v7.0.3.1, using the 1:1 model and a global full fit with 1000 s association time and 1000 s dissociation time unless stated otherwise. A dissociation time of 1000 s (instead of the 2000 s dissociation time that was acquired) was used since this resulted in better fits. Data traces were corrected by subtraction of a reference curve (antibody without AXLECDHis), the Y-axis was aligned to the last 5 s of the baseline, and interstep correction as well as Savitzky-Golay filtering was applied.
[0653] The affinity (K.sub.D) of clone 511 for AXL was 23*10.sup.9 M (k.sub.on 1.7*10.sup.5 1/Ms and a k.sub.dis of 3.9*10.sup.3 1/s).
Duostatin-3 Synthesis.
Preparation of Compound 3:
[0654] ##STR00005##
[0655] To a solution of Boc-L-phenylalanine 1 (5.36 g et al., 20.2 mmol) in 30 mL of methylene chloride (DCM), carbonyldiimidazole (CDI, 4.26 g, 26.3 mmol) was added and stirred for 1 hour. Then added a solution of 2 (3.67 g, 30.3 mmol) and 2,4-diaminobutyric acid (DBU, 4.5 mL, 30 mmol) in 15 mL of DCM. The mixture was heated at 40 C. for 16 hours. The mixture was diluted with 60 mL of DCM and 40 mL of water, then neutralized to pH 7 with conc. HCl. The DCM extract was collected, washed with 0.2M HCl (60 mL), then with brine (60 mL), dried over Na2SO4, and evaporated to give 7.47 g of Boc protected sulfonamide. This material was suspended in 40 mL of methanol, then 200 mL of 6N HCl/isopropanol was added and the mixture was stirred for 2 hours. The solvent was evaporated under vacuum, 100 mL of ether was then added. The precipitate was collected by filtration and dried to give compound 3 as HCl salt (5.93 g, 96%); MS m/z 269.1 (M+H).
Preparation of Compound 5:
[0656] ##STR00006##
[0657] To a solution of compound 4 (1.09 g, 1.6 mmol) in 10 mL of N,N-Dimethylformamide (DMF) was added 2-(1H-7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyl uranium hexafluorophosphate (HATU, 0.61 g, 1.6 mmol), diisopropylethylamine (DIEA, 0.56 mL), and compound 3 (0.49 g, 1.6 mmol) in that order. The mixture was stirred for 1 hour and diluted with 100 mL of water and 4 mL of acetic acid. The precipitate was collected by filtration, dried under vacuum and added to 10 mL of 4M HCl/dioxane. After 30 min et al., 200 mL of ether was added and insoluble precipitate was collected and purified by HPLC to give compound 5 as tetrahydrofuran salt (TFA, 1.3 g, 88%); MS m/z 835.5 (M+H). Compound 5 is referred to as duostatin-3 throughout the manuscript.
Preparation of Compound 7:
[0658] ##STR00007##
[0659] To a solution of compound 5 (500 mg, 0.527 mmol) in 5 mL of DMF was added compound 6 (483 mg, 0.631 mmol), N-Hydroxybenzotriazole (HOBt, 40 mg, 0.296 mmol), and DI EA (0.27 mL). The mixture was stirred for 16 hours after which 0.4 mL of piperidine was added. After 1 hour, the mixture was diluted with 100 mL of ether and the precipitate was collected and dried to give compound 7 as HCl salt (640 mg, 95%); MS m/z 1240.7 (M+H).
Preparation of Compound 9:
[0660] ##STR00008##
[0661] To a solution of compound 8 (219 mg, 0.62 mmol) in 5 mL of DMF was added HATU (236 mg, 0.62 mmol), DI EA (0.15 mL), and compound 7 (316 mg, 1.6 mmol), respectively. After 1 hour, 0.2 mL of piperidine was added and the mixture was stirred for 30 min, then purified by HPLC to give compound 9 as TFA salt (235 mg, 64%); MS m/z 1353.8 (M+H).
Preparation of Compound 11:
[0662] ##STR00009##
[0663] To a solution of compound 9 (235 mg, 0.16 mmol) in 2 mL of methanol and 1 mL of water was added a solution of dialdehyde 10 (1.6 mL of 0.3M in iPrOH) and NaCNBH3 (180 mg, 2.85 mmol). The mixture was stirred for 2 hours at RT, and then purified by HPLC giving rise to compound 11 as TFA salt (126 mg, 50%); MS m/z 1465.8 (M+H)
Generation of AXL-Specific Antibody-Drug Conjugates (ADC).
[0664] Purified AXL antibodies IgG1-AXL-148, IgG1-AXL-183 and IgG1-AXL-726 as well as the negative control antibody IgG1-b12 were conjugated with Duostatin-3 by Concortis Biosystems, Inc. (San Diego, Calif.) through covalent conjugation using the K-lock AV1-valine-citruline (vc) linker (WO 2013/173391, WO 2013/173392 and WO 2013/173393 by Concortis Biosystems).
[0665] The anti-AXL antibody drug conjugates were subsequently analyzed for concentration (by absorbance at 280 nm), the drug to antibody ratio (the DAR) by reverse phase chromatography (RP-HPLC) and hydrophobic interaction chromatography (HIC), the amount of unconjugated drug (by reverse phase chromatography), the percentage aggregation (by size-exclusion chromatography, SEC-HPLC) and the endotoxin levels (by LAL). The results were as follows (Table 5):
TABLE-US-00006 TABLE 5 IgG1-AXL- IgG1-AXL- IgG1-AXL- 148- 183- 726- IgG1-b12- vcDuostatin3 vcDuostatin3 vcDuostatin3 vcDuostatin3 Concentration 6.57 3.40 5.93 3.36 (mg/mL) DAR by HIC- 1.71 1.79 1.77 2.05 HPLC % 6.67 4.16 5.38 4.19 unconjugated drug % aggregate 3.71% 3.35 3.42 1.75 by SEC-HPLC
Example 2Binding Characteristics of AXL Antibodies
Binding Affinity of AXL Antibodies
[0666] The affinities of the panel of 9 anti-AXL antibodies as well as 3 variants of these antibodies with single amino acid mutations in the variable domains (IgG1-AXL-154-M103L, IgG1-AXL-183-N52Q, IgG1-AXL-726-M101L), were determined.
[0667] Affinities were determined using Bio-Layer Interferometry on a ForteBio OctetRED384. Anti-human Fc Capture (AHC) biosensors (ForteBio, Portsmouth, UK; cat no. 18-5064) were loaded for 150 s with hIgG (1 g/mL) aiming at a loading response of 1 nm. After a baseline (150 s) the association (1000 s) and dissociation (2000 s) of AXLECDHis (as described in Example 1) was determined, using a concentration range of 10 g/mL-0.16 g/mL (218 nM-3 nM) with 2-fold dilution steps. For calculations, the theoretical molecular mass of AXLECDHis based on the amino acid sequence was used, i.e. 46 kDa. Experiments were carried out on an OctetRED384, while shaking at 1000 rpm and at 30 C. Each antibody was tested in three independent experiments.
[0668] Data was analyzed with ForteBio Data Analysis Software v7.0.3.1, using the 1:1 model and a global full fit with 1000 s association time and 1000 s dissociation time unless stated otherwise. A dissociation time of 1000 s (instead of the 2000 s dissociation time that was acquired) was used since this resulted in better fits. For antibody IgG1-AXL-154 and IgG1-AXL-154-M103L a dissociation time of 500 s was used. For IgG1-AXL-012 and IgG1-AXL-094 dissociation times of 200 s were used. Data traces were corrected by subtraction of a reference curve (antibody without AXLECDHis), the Y-axis was aligned to the last 5 s of the baseline, and interstep correction as well as Savitzky-Golay filtering was applied.
[0669] The affinities (K.sub.D) of the anti-AXL antibodies ranged from 0.3*10.sup.9M to 63*10.sup.9M (Table 6). For mutant IgG1-AXL-183-N520 the K.sub.D was lower than for wild-type IgG1-AXL-183, due to an approximately 2.5-fold higher dissociation rate. The observed kinetics of the other two mutants were similar to the kinetics of the wild-type IgGs.
TABLE-US-00007 TABLE 6 Binding affinity (OCTET) KD Kon Kdis Antibody (M) (1/Ms) (1/s) IgG1-AXL-107 16* 10.sup.9 2.8* 10.sup.5 4.1* 10.sup.3 IgG1-AXL-148 20* 10.sup.9 2.3* 10.sup.5 4.4* 10.sup.3 IgG1-AXL-154 7.2* 10.sup.9 2.6* 10.sup.5 1.9* 10.sup.3 IgG1-AXL-154- 7.8* 10.sup.9 2.7* 10.sup.5 2.0* 10.sup.3 M103L IgG1-AXL-171 17* 10.sup.9 1.1* 10.sup.5 1.8* 10.sup.3 IgG1-AXL-183 10.2* 10.sup.9 4.1* 10.sup.4 4.2* 10.sup.4 IgG1-AXL-183- 24* 10.sup.9 4.2* 10.sup.4 1.0* 10.sup.3 N52Q IgG1-AXL-613 1.5* 10.sup.9 5.4* 10.sup.5 8.0* 10.sup.4 IgG1-AXL-726 0.6* 10.sup.9 2.4* 10.sup.5 1.3* 10.sup.4 IgG1-AXL-726- 0.3* 10.sup.9 2.1* 10.sup.5 6.9* 10.sup.5 M101L IgG1-AXL-733 63* 10.sup.9 1.6* 10.sup.5 9.7* 10.sup.3
Binding of AXL Antibodies to Human, Mouse and Cynomolgus AXL
[0670] HEK293T cells were transiently transfected with expression constructs for full length human AXL, human AXL with a cynomolgus monkey extracellular domain (ECD) or human AXL with a mouse ECD (see Example 1). Binding of HuMab-AXL antibodies to these cells was evaluated by flow cytometry. Transfected HEK293 cells were incubated with serial dilutions of AXL-antibodies (final concentration range 0.0024-10 g/mL) for 30 minutes at 4 C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, Pa.; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide (final volume 100 L). Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
[0671] Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, Calif., USA).
[0672]
TABLE-US-00008 TABLE 7 Binding EC50 (g/mL) human AXL cynomolgus AXL Antibody Average (s.d.) Average (s.d.) IgG1-AXL-107 0.050 (0.004) 0.149 (0.021) IgG1-AXL-154 0.105 (0.003) 0.160 (0.027) IgG1-AXL-154-M103L 0.110 (0.038) 0.161 (0.042) IgG1-AXL-171 0.073 (0.023) 0.157 (0.057) IgG1-AXL-613 0.040 (0.023) 0.146 (0.023) IgG1-AXL-726 0.288 (0.206) 0.349 (0.160) IgG1-AXL-726-M101L 0.184 (0.117) 0.250 (0.066) IgG1-AXL-733 0.176 (0.094) 0.254 (0.114) IgG1-AXL-148 0.094 (0.059) 0.152 (0.080) IgG1-AXL-183 0.526 (0.177) 0.309 (0.086) IgG1-AXL-183-N52Q 0.350 (0.206) 0.324 (0.121)
Competition Between AXL Antibodies and Gas6 for AXL Binding
[0673] It was tested whether the AXL ligand Gas6 interfered with binding of the AXL antibodies to AXL. Therefore, AXL-positive A431 cells were incubated for 15 minutes at 4 C. with 10 g/mL recombinant human Gas6 (R&D Systems, Abingdon, UK; cat. No. 885-GS). Subsequently, serial dilutions of AXL antibodies were prepared (final concentration range 0.014-10 g/mL), added to the cells and incubated for 30 minutes at 4 C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated in 100 L with secondary antibody at 4 C. for 30 min in the dark. As a secondary antibody binding the Fc region, R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, Pa.; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide, was used. Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
[0674] Alternatively, A431 cells were pre-incubated with 10 g/mL AXL antibodies (15 minutes, 4 C.) to assess if the AXL ligand Gas6 could still bind in presence of AXL antibodies. After antibody pre-incubation, serial dilutions of recombinant human Gas6 (R&D Systems, Abingdon, UK; cat. No. 885-GS) were added to the cells at final concentrations of 0.001-20 g/mL and incubated for 30 minutes at 4 C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with mouse anti-Gas6 IgG2a (R&D Systems; cat no. MAB885) at 4 C. for 30 min. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with FITC-labelled goat anti-mouse IgG (Dako, Heverlee, Belgium; cat no. F049702) at 4 C. for 30 min in the dark. Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
[0675] Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, Calif., USA).
[0676] In experiments (n=3) in which A431 cells were pre-incubated with Gas6, the maximal binding values of anti-AXL antibodies was comparable to antibody binding in absence of Gas6 (maximal binding after Gas6 pre-incubation was 90-108% of binding without Gas6 pre-incubation) (Table 7). The EC.sub.50 values for AXL antibody binding with or without Gas6 pre-incubation were in the same range, or somewhat enhanced after Gas6 pre-incubation (Table 8).
[0677] The binding of control AXL antibody YW327.652 to A431 cells was greatly reduced in the presence of Gas6 compared to binding without Gas. Maximal binding of YW327.652 in the presence of Gas6 was 19% of binding without Gas6, and the EC50 value for binding to A431 cells was 21-fold higher when cells had been pre-incubated with Gas6.
[0678] In experiments in which A431 cells were pre-incubated with anti-AXL antibodies, Gas6 binding was evaluated (n=3). Binding of Gas6 to A431 cells was similar with or without pre-incubation with HuMab-AXL antibodies. Average EC50 concentrations of Gas6 binding when cells were pre-incubated with HuMabs (0.34-0.83 g/mL) and maximal Gas6 binding were similar to Gas6 binding in the presence of negative control antibody b12 (EC50 concentration: 0.40 g/mL; 95-115% of Gas6 binding in the presence of the b12 control antibody). The binding of Gas6 to A431 cells was greatly reduced in the presence of control AXL antibody YW327.652 compared to pre-incubation with b12 (the EC50 concentration was 14-fold higher). Maximal binding of Gash in the presence of control antibody YW327.6S2 was 17% of binding in the presence of negative control antibody b12.
TABLE-US-00009 TABLE 8 Antibody binding to A431 cells Gas6 binding to A431 cells Maximal Maximal binding binding in in presence of presence EC50 in AXL antibodies EC50 w/o EC50 in of Gas6 (% presence (% of binding Gas6 presence of binding of AXL in prescence EC50 of Gas6 in absence antibodies of control (g/mL) (g/mL) of Gas6) (g/mL) antibody) Antibody mean (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) IgG1-AXL- 0.16 (0.17) 0.94 (1.18) 91 (5) 0.78 (0.54) 96 (8) 107 IgG1-AXL- 0.11 (0.13) 0.20 (0.30) 93 (5) 0.73 (0.52) 106 (7) 148 IgG1-AXL- 0.42 (0.55) 0.76 (0.78) 99 (13) 0.44 (0.28) 95 (10) 154 IgG1-AXL- 0.18 (0.21) 0.32 (0.40) 95 (5) 0.69 (0.42) 108 (5) 171 IgG1-AXL- 0.69 (0.72) 1.19 (1.11) 90 (19) 0.34 (0.13) 115 (8) 183 IgG1-AXL- 0.12 (0.11) 0.30 (0.31) 93 (15) 0.74 (0.44) 113 (6) 511 IgG1-AXL- 0.09 (0.09) 0.10 (0.10) 108 (22) 0.57 (0.36) 100 (11) 613 IgG1-AXL- 0.32 (0.35) 0.55 (0.69) 97 (10) 0.77 (0.58) 98 (10) 726 IgG1-AXL- 0.49 (0.51) 0.62 (0.23) 93 (5) 0.83 (0.54) 96 (5) 733 YW327.6S2 0.09 (0.09) 1.90 (1.04)* 41 (24) 5.53 (7.09)* 17 (10) b12 n.a..sup.a n.a. n.a. 0.40 (0.11) 100 .sup.an.a., not applicable *EC50 values less accurate due to low binding.
Example 3Epitope Mapping Studies Anti-AXL Antibody Panel
Determining the AXL Domain Specificity Using Human-Mouse AXL Chimeric Molecules
[0679] The AXL domain specificity of the AXL antibodies was determined using a panel of human-mouse chimeric AXL mutants. Five different chimeric AXL molecules were generated, in which either the human Ig-like domain I (Ig1), the Ig-like domain II (Ig2), the human FNIII-like domain I (FN1) or the human FNIII-like domain II domain (FN2) were replaced with their murine homologs.
[0680] The following codon-optimized constructs for expression of the AXL human-mouse chimeras were generated and expressed in HEK293F cells as described in Example 1:
TABLE-US-00010 HomosapiensAXL(p33-HAHs-AXL): (SEQIDNO:148) MAWRCPRMGRVPLAWCLALCGWACMYPYDVPDYAAPRGTQAEESPFVGN PGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLG EDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGL PYFLEEPEDRIVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHG PQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSR QPTELEVAWTPGLSGIYPLTHCTLQAVLSNDGMGIQAGEPDPPEEPLTS QASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPL GPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDI GLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQ PVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRY GEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVM VDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSEL EDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDL HSFLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARN CMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVY TSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCL DGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNM DEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTT PSPAQPADRGSPAAPGQEDGA MusmusculusAXL(p33-HAMm-AXL): (SEQIDNO:149) MAWRCPRMGRVPLAWCLALCGWACMYPYDVPDYAAHKDTQTEAGSPFVG NPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPL GEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEG LPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGH SSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVS RQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLT LQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVP LGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMD IGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQG QPLHHLVSEPPPRAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETR YGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDV MVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSE LEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGD LHSFLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAAR NCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRV YTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADC LDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVN MDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPST TPSPAQPADRGSPAAPGQEDGA HomosapiensAXL-MusmusculusIg1domain(p33- AXL-mIg1): (SEQIDNO:150) MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLTGTLR CELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRI SALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDRTVAAN TPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSS FSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSG IYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQA FVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGS VSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFS WPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVV RYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEG EFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDH PNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVY LPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFG LSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWE IATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNP QDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGG ADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAP GQEDGA HomosapiensAXL-MusmusculusIg2domain(p33- AXL-mIg2): (SEQIDNO:151) MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARG LTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIV VSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPED KAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPG LNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAW TPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQL RLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISAT RNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLE LQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEP STPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALG KTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVC MKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRL GDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSV CVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSF GVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSR CWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEP PGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADR GSPAAPGQEDGA HomosapiensAXL-MusmusculusFN1domain(p33- AXL-mFN1): (SEQIDNO:152) MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARG LTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIV VSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPED RTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPG LNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAW TPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQL RLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENISAT RNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLE LQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEP STPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALG KTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVC MKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRL GDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSV CVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSF GVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSR CWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEP PGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADR GSPAAPGQEDGA HomosapiensAXL-MusmusculusFN2domain(p33- AXL-mFN2): (SEQIDNO:153) MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARG LTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIV VSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPED RTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPG LNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAW TPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQL RLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENVSAM RNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLE LRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEP PPRAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALG KTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVC MKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRL GDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSV CVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSF GVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSR CWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEP PGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADR GSPAAPGQEDGA
[0681] Binding of 1 g/mL anti-AXL antibody to the human-mouse AXL chimeras was determined by flow cytometry, as described in Example 2. IgG1-b12 was included as an isotype control IgG1.
[0682] All anti-AXL antibodies showed binding to human AXL (
[0683] Anti-AXL antibody 107 and 613 showed strongly reduced binding to hsAXL-mmIg1 (
[0684] AXL domain specificity for all anti-AXL antibodies is summarized in Table 9.
TABLE-US-00011 TABLE 9 AXL domain AXL aa's involved in Antibody specificity binding IgG1-AXL-107 Ig1 L121-Q129 IgG1-AXL-148 Ig2 D170-R190 IgG1-AXL-154 Fn1 Q272-A287, G297-P301 IgG1-AXL-154- n.d..sup.a n.d. M103L IgG1-AXL-171 Ig2 P170, T182-R190 IgG1-AXL-183 Fn1 Not resolved IgG1-AXL-183- n.d. n.d. N52Q IgG1-AXL-613 Ig1 T112-Q124 IgG1-AXL-726 Fn2 A359, R386, Q436-K439 IgG1-AXL-726- n.d. n.d. M101L IgG1-AXL-733 Fn1 Not resolved IgG1-AXL-061 Ig1 I97-Q124 IgG1-AXL-137 Ig1 Q57, E92-T105 YW327.6S2 Ig1 G39-D59 .sup.an.d., not determined
High Resolution Epitope Mapping to Identify Amino Acids in the AXL Extracellular Domain Involved in Binding of AXL Antibodies
[0685] To identify amino acids in the AXL extracellular domain involved in binding of anti-AXL antibodies, a library of AXL sequence variants was generated by recombination of AXL sequences derived from species with variable levels of homology with the human AXL sequence in the extracellular domain. Briefly, an expression plasmid encoding human AXL (Hs) was mixed with cloning plasmids encoding Mus musculus (Mm), Monodelphis domestica (Md; opossum) Anolis carolinensis (Ac; lizard) and Tetraodon nigroviridis (Tn; pufferfish) AXL homologs or vice versa. A combination of two primers specific to either the cloning or the expression vector was used to perform a PCR amplifying the AXL extracellular domain (ECD) with abbreviated elongation time, forcing melting and reannealing of nascent DNA replication strands during PCR cycling. Full length ECD was amplified using a nested PCR, again specific to recombination products containing termini originating from both vectors.
[0686] Resulting AXL ECD PCR products were cloned into an expression vector creating full length AXL, and resulting plasmids were sequenced, ranked by maximal difference to the template vectors and selected to create a minimal ensemble with maximal differentiation power. Plasmids encoding AXL homologs from Hs, Mm, Md, Ac and Tn, four human/mouse chimeric plasmids encoding Hs AXL with murine Ig1, Ig2, Fn1 or Fn2 domains, and the sixteen most differentiating plasmids from the recombination library were transfected into HEK293-F cells according to the specifications supplied by the manufacturer (Life technologies). FACS binding data using 1 g/mL anti-AXL antibodies were deconvoluted by scoring per amino acid if mutation did (+1) or did not (1) correlate with loss of binding, after which a baseline correction and normalization to a scale of 5 to +5 was applied, resulting in an impact score per amino acid over the full ECD.
[0687] The deconvoluted binding data is summarized in Table 9 as the amino acids involved in binding. Antibodies whose binding sites could not be mapped to high resolution due to a lack of recombination events in the proximity of the binding site, are indicated as not resolved.
Example 4Fc-Mediated Effector Functions
Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC)
[0688] The ability of anti-AXL antibodies to induce ADCC of A431 epidermoid carcinoma cells was determined as explained below. As effector cells, peripheral blood mononuclear cells from healthy volunteers (UMC Utrecht, The Netherlands) were used.
Labeling of Target Cells
[0689] A431 cells were collected (510.sup.6 cells) in culture medium (RPMI 1640 culture medium supplemented with 10% fetal calf serum (FSC)), to which 100 Ci .sup.51Cr (Chromium-51; Amersham Biosciences Europe GmbH, Roosendaal, The Netherlands) had been added, and the mixture was incubated in a 37 C. water bath for 1 hour (hr) while shaking. After washing of the cells (twice in PBS, 1200 rpm, 5 min), the cells were resuspended in RPMI1640/10% FSC and counted by trypan blue exclusion. Cells were diluted to a density of 110.sup.5 cells/mL.
Preparation of Effector Cells
[0690] Peripheral blood mononuclear cells (healthy volunteers, UMC Utrecht, Utrecht, The Netherlands) were isolated from 45 mL of freshly drawn heparin blood by Ficoll (Bio Whittaker; lymphocyte separation medium, cat 17-829E) according to the manufacturer's instructions. After resuspension of cells in RPMI1640/10% FSC, cells were counted by trypan blue exclusion and diluted to a density of 110.sup.7 cells/mL.
ADCC Set Up
[0691] 50 l of .sup.51Cr-labeled targets cells were pipetted into 96-well plates, and 50 l of antibody were added, diluted in RPMI1640/10% FSC (3-fold dilutions at final concentrations range 0.01-10 g/mL). Cells were incubated (room temperature (RT), 15 min), and 50 l effector cells were added, resulting in an effector to target ratio of 100:1 (for determination of maximal lysis, 100 l 5% Triton-X100 was added instead of effector cells; for determination of spontaneous lysis, 50 L target cells and 100 L RPMI1640/10% FSC were used). Cells were incubated overnight at 37 C. and 5% CO.sub.2. After spinning down cells (1200 rpm, 10 min), 70 L of supernatant was harvested into micronic tubes, and counted in a gamma counter. The percentage specific lysis was calculated as follows:
% specific lysis=(cpm samplecpm target cells only)/(cpm maximal lysiscpm target cells only),
wherein cpm is counts per minute.
[0692] IgG1-AXL-183-N520, and IgG1-AXL-733 induced 15 to 21% ADCC in A431 cells at a concentration of 10 g/mL (
Example 5Binding Characteristics of AXL Antibody-Drug Conjugates (AXL-ADCs)
[0693] HEK293T cells were transiently transfected with expression constructs for full-length human AXL (see Example 1). Binding of anti-AXL antibodies and AXL-ADCs to these cells was evaluated by flow cytometry. Transiently transfected HEK293 cells were incubated with serial dilutions of anti-AXL antibodies or AXL-ADCs (4-fold dilutions; final concentration range 0.003-10 g/mL) for 30 minutes at 4 C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated in 100 l with secondary antibody at 4 C. for 30 min in the dark. As a secondary antibody, R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, Pa.; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide, was used. Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 L PBS/0.1% BSA/0.02% azide and analyzed on a FACS CantoII (BD Biosciences).
[0694] Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, Calif., USA).
[0695]
Example 6In Vitro Cytotoxicity Induced by AXL-Specific Antibody Drug Conjugates
[0696] LCLC-103H cells (human large cell lung cancer) cells were cultured in RPMI 1640 with L-Glutamine (Cambrex; cat. no. BE12-115F) supplemented with 10% (vol/vol) heat inactivated Cosmic Calf Serum (Perbio; cat. no. SH30087.03), 2 mM L-glutamine (Cambrex; cat. no. US17-905C), 50 IU/mL penicillin, and 50 g/mL streptomycin (Cambrex; cat. no. DE17-603E). MDA-MB-231 cells (human breast cancer) were cultured in DMEM (Cambrex; cat. no. BE12-709F) supplemented with 10% (vol/vol) heat inactivated Cosmic Calf Serum (Perbio; cat. no. SH30087.03), 1 mM Sodium Pyruvate (Cambrex; cat. no. BE13-115E), 2 mM L-glutamine (Cambrex; cat. no. US17-905C), 100 M MEM NEAA (Invitrogen; cat. no. 11140), 50 IU/mL penicillin, and 50 g/mL streptomycin (Cambrex; cat. no. DE17-603E). The cell lines were maintained at 37 C. in a 5% (vol/vol) CO2 humidified incubator. LCLC-103H and MDA-MB-231 cells were cultured to near confluency, after which cells were trypsinized, resuspended in culture medium and passed through a cell strainer (BD Falcon, cat. no. 352340) to obtain a single cell suspension. 110.sup.3 cells were seeded in each well of a 96-well culture plate, and cells were incubated for 30 min at room temperature and subsequently for 5 hrs at 37 C., 5% CO2 to allow adherence to the plate.
[0697] Serial dilutions (4-fold; final concentrations ranging from 0.00015 to 10 g/mL) of AXL antibody drug conjugates (AXL-ADCs; see Example 1) were prepared in culture medium and added to the plates. Incubation of cells with 1 M staurosporin (#S6942-200, Sigma) was used as reference for 100% tumor cell kill. Untreated cells were used as reference for 0% tumor cell kill. Plates were incubated for 5 days at 37 C., 5% CO2. Next, CellTiter-Glo Reagent (Promega; cat. no. G7571) was added to the wells (20 L per well) and plates were incubated for 1.5 hours at 37 C., 5% CO2. Subsequently, 180 L per well was transferred to white 96-well Optiplate plates (PerkinElmer, Waltham, Mass.; cat. no. 6005299), which were incubated for 30 min at room temperature. Finally, luminescence was measured on an EnVision multiplate reader (Envision, Perkin Elmer).
[0698] AXL-ADCs IgG1-AXL-148-vcDuo3, IgG1-AXL-183-vcDuo3, and IgG1-AXL-726-vcDuo3 induced cytotoxicity in LCLC-103H cells, with IC50 values between 0.01 and 0.06 g/mL, as shown in
Example 7Antibody VH and VL Variants that Allow Binding to AXL
[0699] Protein sequences of the VH and VL regions of the anti-AXL antibody panel (described in Example 1) were aligned and compared for AXL binding to identify critical or permissive changes of amino acid residues in the VH or VL regions. Therefore, antibodies with identical VH or VL regions were grouped and compared for binding to human AXL and differences in VL or VH sequences, respectively. Binding to human AXL transiently expressed by HEK-293F cells was assessed in the homogeneous antigen specific screening assay as described in Example 1. Numbering of amino acid positions for the alignments done in the present example was done based on the sequences put forth in
[0700] First, antibodies with identical VL sequences were grouped.
[0701] IgG1-AXL-148 and IgG1-AXL-140 were found to have an identical VL sequence, and showed 1 amino acid difference in the HC CDR3 region (F for I at amino acid position 109;
[0702] IgG1-AXL-726 and IgG1-AXL-187 were found to have an identical VL sequence and both antibodies bound to human AXL (Table 10). Two amino acid residue changes in the HC CDR3 region (R for S at position 97 and A for T at position 105;
[0703] IgG1-AXL-171, IgG1-AXL-172 and IgG1-AXL-181 were found to have an identical VL sequence and all antibodies bound to human AXL (Table 10). The CDR3 regions of these three antibodies were identical, but an amino acid residue change in the HC CDR1 (S for N at position 31) or the framework region (H for Q at position 82) was allowed without losing binding (
[0704] IgG1-AXL-613, IgG1-AXL-608-01, IgG1-AXL-610-01 and IgG1-AXL-620-06 were found to have an identical VL sequence, and showed one amino acid difference in the HC CDR3 region (N for D at amino acid position 101;
[0705] Next, antibodies with identical VH sequences were grouped.
[0706] IgG1-AXL-613 and IgG1-AXL-613-08 were found to have an identical VH sequence, and showed five amino acid differences in the CDR3 region of the LC (RSNWL for YGSSY at positions 92 to 96;
TABLE-US-00012 TABLE 10 Antibody EC50 (g/mL) Maximal binding (Arbitrary units) IgG1-AXL-140 0.0026 2889 IgG1-AXL-148 0.0036 3499 IgG1-AXL-171 0.003 2575 IgG1-AXL-172 0.0055 5378 IgG1-AXL-181 0.008 3598 IgG1-AXL-187 0.0065 2563 IgG1-AXL-608-01 0.0035 3318 IgG1-AXL-610-01 0.0023 2947 IgG1-AXL-613 0.0072 5211 IgG1-AXL-613-08 0.0242 2209 IgG1-AXL-620-06 0.0034 4352 IgG1-AXL-726 0.0471 3154
Example 8In Vitro Cytotoxicity Induced by MMAE-Conjugated AXL Antibodies
Conjugation of MMAE to Anti-AXL Antibodies
[0707] Anti-AXL antibodies were purified by Protein A chromatography according to standard procedures and conjugated to vcMMAE. The drug-linker vcMMAE was alkylated to the cysteines of the reduced antibodies according to procedures described in the literature (see Sun et al., 2005; McDonagh et al., 2006; and Alley et al., 2008). The reaction was quenched by the addition of an excess of N-acetylcysteine. Any residual unconjugated drug was removed by purification and the final anti-AXL antibody drug conjugates were formulated in PBS. The anti-AXL antibody drug conjugates were subsequently analyzed for concentration (by absorbance at 280 nm), the drug to antibody ratio (DAR) by reverse phase chromatography (RP-HPLC) and hydrophobic interaction chromatography (HIC), the amount of unconjugated drug (by reverse phase chromatography), the percentage aggregation (by size-exclusion chromatography, SEC-HPLC) and the endotoxin levels (by LAL). The results are shown below in Table 11.
TABLE-US-00013 TABLE 11 Overview of different characteristics of the antibody-drug conjugates. ADC IgG1- IgG1- IgG1- IgG1- IgG1- AXL- IgG1- AXL- IgG1- IgG1- AXL- IgG1- AXL- AXL- 154- AXL- 183- AXL- AXL- 726- AXL- IgG1- Assay 107 148 M103L 171 N52Q 511 613 M101L 733 b12 Concentration 7.18 9.63 6.57 3.69 6.71 5.77 6.17 7.37 7.71 1.58 (mg/mL) DAR by HIC 3.97 3.96 3.71 3.65 3.92 3.87 4.23 4.12 4.08 4.00 % 4.68 5.58 6.13 7.11 8.68 8.35 5.13 4.99 3.74 1.89 unconjugated antibody % aggregate 6.3 2.28 2.9 3.3 5.2 5.1 6.4 4.0 3.5 2.5 by SEC-HPLC Endotoxin 2.3 1.2 2.6 3.1 5.9 4.5 2.0 3.6 7.6 11.5 (EU/mq)
Cell Culture
[0708] LCLC-103H cells (human large cell lung cancer) and A431 cells (DMSZ, Braunschweig, Germany) were cultured in RPMI 1640 with L-Glutamine (Cambrex; cat. no. BE12-115F) supplemented with 10% (vol/vol) heat inactivated Cosmic Calf Serum (Perbio; cat. no. SH30087.03), 2 mM L-glutamine (Cambrex; cat. no. US17-905C), 50 IU/mL penicillin, and 50 g/mL streptomycin (Cambrex; cat. no. DE17-603E). MDA-MB231 cells were cultured in DMEM with high glucose and HEPES (Lonza #BE12-709F), Donor Bovine Serum with Iron (Life Technologies #10371-029), 2 mM L-glutamine (Lonza # BE17-605E), 1 mM Sodium Pyruvate (Lonza #BE13-115E), and MEM Non-Essential Amino Acids Solution (Life Technologies #11140). The cell lines were maintained at 37 C. in a 5% (vol/vol) CO.sub.2 humidified incubator. LCLC-103H, A431 and MDA-MB231 cells were cultured to near confluency, after which cells were trypsinized, resuspended in culture medium and passed through a cell strainer (BD Falcon, cat. no. 352340) to obtain a single cell suspension. 110.sup.3 cells were seeded in each well of a 96-well culture plate, and cells were incubated for 30 min at room temperature and subsequently for 5 hrs at 37 C., 5% CO.sub.2 to allow adherence to the plate.
Cytotoxicity Assay
[0709] Serial dilutions (final concentrations ranging from 0.00015 to 10 g/mL) of MMAE-conjugated AXL-antibodies were prepared in culture medium and added to the plates. Incubation of cells with 1 M staurosporin (#S6942-200, Sigma) was used as reference for 100% tumor cell kill. Untreated cells were used as reference for 100% cell growth. Plates were incubated for 5 days at 37 C., 5% CO.sub.2. Next, CellTiter-Glo Reagent (Promega; cat. no. G7571) was added to the wells (20 L per well) and plates were incubated for 1.5 hours at 37.sup.2C, 5% CO.sub.2. Subsequently, 180 L per well was transferred to white 96-well Optiplate plates (PerkinElmer, Waltham, Mass.; cat. no. 6005299), which were incubated for 30 min at room temperature. Finally, luminescence was measured on an EnVision multiplate reader (Envision, Perkin Elmer).
[0710] MMAE-conjugated AXL-antibodies induced 50% cell kill in LCLC-103H cells at concentrations between 0.004 and 0.219 g/mL as shown in Table 12 and
[0711] Similarly, AXL-ADCs efficiently induced cytotoxicity in A431 cells (Table 13) and
TABLE-US-00014 TABLE 12 Cytotoxicity of MMAE-conjugated-AXL-antibodies in LCLC-103H cells (EC50 values) ADC EC50 (g/mL) IgG1-AXL- 613-vcMMAE 0.004 IgG1-AXL- 148-vcMMAE 0.012 IgG1-AXL- 171-vcMMAE 0.018 IgG1-AXL- 726-M101L-vcMMAE 0.018 IgG1-AXL- 107-vcMMAE 0.022 IgG1-AXL- 511-vcMMAE 0.032 IgG1-AXL- 154-M103L-vcMMAE 0.044 IgG1-AXL- 183-N52Q-vcMMAE 0.113 IgG1-AXL- 733-vcMMAE 0.219
TABLE-US-00015 TABLE 13 Cytotoxicity of MMAE-conjugated AXL antibodies in A431 and MDA-MB-231 cells (EC50 values). EC50 (g/mL) A431 (n = 3) MDA-MB231 (n = 2) ADC Mean s.d. Mean s.d. IgG1-AXL-107-vcMMAE 0.154 0.066 0.037 0.005 IgG1-AXL-148-vcMMAE 0.070 0.013 0.012 0.004 IgG1-AXL-154-M103L- 0.719 0.091 0.396 0.195 vcMMAE IgG1-AXL-171-vcMMAE 0.206 0.074 0.035 0.006 IgG1-AXL-183-N52Q- 1.157 0.160 0.139 0.028 vcMMAE IgG1-AXL-511-vcMMAE 0.093 0.020 0.052 0.003 IgG1-AXL-613-vcMMAE 0.109 0.078 0.005 0.001 IgG1-AXL-726-M101L- 0.270 0.157 0.022 0.002 vcMMAE IgG1-AXL-733-vcMMAE 1.253 0.228 0.881 0.182
Example 9Therapeutic Treatment of LCLC-103H Tumor Xenografts in SCID Mice with MMAE-Conjugated Anti-AXL Antibodies
[0712] The in vivo efficacy of MMAE-conjugated anti-AXL antibodies was determined in established subcutaneous (SC) LCLC-103H xenograft tumors in SCID mice. 510.sup.6 LCLC-103H (large cell lung carcinoma) tumor cells (obtained from Leibniz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH (DSMZ)) in 200 L PBS were injected subcutaneously in the right flank of female SCID mice. Starting 14-21 days after tumor cell inoculation, when the average tumor size was >100-200 mm.sup.3 and distinct tumor growth was observed, a single injection with 1 mg/kg (20 g/mouse) IgG1-AXL-vcMMAE antibodies (as described in Supplementary Example 1) or control (unconjugated IgG1-b12) was given intraperitoneally (100 L/mouse). Tumor volume was determined at least two times per week. Tumor volumes (mm.sup.3) were calculated from caliper (PLEXX) measurements as: 0.52(length)(width).sup.2.
[0713] The panel of anti-AXL-vcMMAE antibodies showed a broad range of anti-tumor activity in established SC LCLC-103H tumors (
[0714] Statistical analysis on the last day that all groups were intact (day 30) using One Way ANOVA (Dunnett's multiple comparisons test versus control IgG1-b12) indicated a highly significant difference (p<0.0001) in tumor volume between IgG1-b12 versus IgG1-AXL-733-vcMMAE, IgG1-AXL-107-vcMMAE and IgG1-AXL-148-vcMMAE. Treatment with these clones led in some mice within these groups to complete tumor reduction. Treatment with clones IgG1-AXL-171-vcMMAE, IgG1-AXL-511-vcMMAE and IgG1-AXL-613-vcMMAE also showed significant tumor growth inhibition compared to IgG1-b12, but the differences were less pronounced (p<0.05 to p<0.001). The tumor growth of mice treated with clones IgG1-AXL-154-M103L-vcMMAE, IgG1-AXL-183-N520-vcMMAE, and IgG1-AXL-726-M101L-vcMMAE was not significant affected compared to the IgG1-b12 control.
[0715] Anti-tumor activity of anti-AXL-vcMMAE antibodies was observed in various other in vivo tumor models. In two cell line-derived xenograft models (A431; epidermoid adenocarcinoma, and MDA-MB-231; breast cancer) anti-AXL-vcMMAE antibodies induced tumor growth inhibition, and tumor regression was induced by anti-AXL-vcMMAE antibodies in two patient-derived xenograft models from patients with pancreas cancer and cervical cancer.
Example 10Anti-Tumor Efficacy of AXL-ADCs in a Pancreas Cancer Patient-Derived Xenograft (PDX) Model with Heterogeneous Target Expression
[0716] The anti-tumor activity of IgG1-AXL-107-vcMMAE, IgG1-AXL-148-vcMMAE, and IgG1-AXL-733-vcMMAE was determined in the PAXF1657 pancreas cancer PDX model (experiments performed by Oncotest, Freiburg, Germany). Human pancreas tumor tissue was subcutaneously implanted in the left flank of 5-7 weeks old female NMRI nu/nu mice. Randomization of animals was performed as follows: animals bearing a tumor with a volume between 50-250 mm.sup.3, preferably 80-200 mm.sup.3, were distributed in 7 experimental groups (8 animals per group), considering a comparable median and mean of group tumor volume. At day of randomization (day 0), the 3 ADCs were dosed intravenously (i.v.) at either 4 mg/kg or 2 mg/kg, and the control group received a single dose of IgG1-b12 (4 mg/kg). Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.52(length)(width).sup.2.
[0717] Staining of PAXF1657 tumors was performed with standard immunohistochemistry techniques. Briefly, frozen tissues were fixated with acetone for 10 minutes and endogenous peroxidase was exhausted using hydrogen peroxidase. Subsequently, tissue sections were blocked with normal mouse serum and staining was performed by incubation with 5 g/mL of a pool of 5 IgG1-AXL antibodies (IgG1-AXL-061, IgG1-AXL-137, IgG1-AXL-148, IgG1-AXL-183, IgG1-AXL-726). After incubation with the secondary, horseradish peroxidase (HRP) conjugated antibody, HRP was visualized with amino-ethyl carbazole (AEC; resulting in a red color). Each slide was counterstained with hematoxylin (blue) to identify nuclei and coverslipped in glycergel. Immunostained tissue slices were digitized on manual Zeiss microscope (AxioSkop) at 10 and 40 magnifications.
[0718]
[0719]
[0720] Treatment of mice with unconjugated IgG1-AXL-148 did not result in anti-tumor activity in the PAXF1657 model (
[0721] Moreover, treatment of mice with the untargeted ADC IgG1-b12-vcMMAE did not show anti-tumor activity in the PAXF1657 model (
Example 11AXL Antibodies Binding to the Ig1 Domain
[0722] The AXL domain specificity of AXL antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, and IgG1-AXL-613 was determined using a panel of human-mouse chimeric AXL mutants. The human-mouse cross-reactive monoclonal AXL antibody YW327.6S2 was included to confirm expression of hsAXL-mmECD. IgG1-b12 was included as isotype control antibody. Five different chimeric AXL molecules were generated and expressed in HEK293F as described in Example 3. In brief, the human Ig-like domain I (Ig1), the Ig-like domain II (Ig2), the human FNIII-like domain I (FN1) or the human FNIII-like domain II domain (FN2) were replaced with their murine homologs. Binding of 1 g/mL anti-AXL antibody to the human-mouse AXL chimeras was determined by flow cytometry, as described in Example 2.
[0723] All anti-AXL antibodies showed binding to human AXL (
[0724] AXL antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, and IgG1-AXL-613 showed strongly reduced binding to hsAXL-mmIg1 (
Example 12AXL Antibodies IgG1-AXL-107 and IgG1-AXL-613 Bind to the Ig1 Domain but do not Compete with Gas6 Binding
[0725] It was tested whether the binding of the AXL antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, or IgG1-AXL-613 interfered with binding of AXL ligand Gas6 to AXL. Therefore, binding of Gas6 to A431 cells that had been pre-incubated with 10 g/mL AXL antibodies was tested as described in Example 2. Pre-incubation with AXL antibody YW327.6S2, that was described to compete with Gas6 for AXL binding, IgG1-b12 (isotype control) or medium (negative control) were included as controls.
[0726] Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, Calif., USA).
[0727]
[0728] In experiments in which A431 cells were pre-incubated with Gas6, the maximal binding values of IgG1-AXL-107 and IgG1-AXL-613 were comparable to antibody binding in absence of Gas6 (maximal binding after Gas6 pre-incubation was 91-108% of binding without Gas6 pre-incubation) (Table 14). The EC.sub.50 values for IgG1-AXL-107 and IgG1-AXL-613 binding with or without Gas6 pre-incubation were in the same range, or somewhat higher after Gas6 pre-incubation (Table 14), illustrating that IgG1-AXL-107 and IgG1-AXL-613 do not compete with Gas6 binding.
[0729] Similar to control antibody YW327.652, the binding of IgG1-AXL-061 and IgG1-AXL-137 to A431 cells was greatly reduced in the presence of Gas6 compared to binding without Gas6 (maximal binding after Gas6 pre-incubation was 40-43% of binding without Gas6 pre-incubation; Table 14). The EC.sub.50 values for IgG1-AXL-061 and IgG1-AXL-137 could not properly be determined after Gas6 pre-incubation (Table 14). This shows that IgG1-AXL-061 and IgG1-AXL-137 compete with Gas6 for binding to AXL.
[0730] These data demonstrate that antibodies binding to the AXL Ig1 domain have differential effect on Gas6 binding.
TABLE-US-00016 TABLE 14 Antibody binding to A431 cells Gas6 binding to A431 cells Maximal Maximal binding in binding in presence of presence of EC50 w/o EC50 in Gas6 (% of EC50 in AXL antibodies Gas6 presence of binding in presence of (% of binding EC50 Gas6 absence of AXL antibodies in presence of (g/mL) (g/mL) Gas6) (g/mL) control antibody) Antibody mean (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) IgG1-AXL-061 0.15 (n.a.) n.a. 43 (28) n.a. 22 (8) IgG1-AXL-107 0.16 (0.17) 0.94 (1.18) 91 (5) 0.78 (0.54) 96 (8) IgG1-AXL-137 0.11 (0.10) n.a. 40 (18) n.a 36 (4) IgG1-AXL-613 0.09 (0.09) 0.10 (0.10) 108 (22) 0.57 (0.36) 100 (11) YW327.6S2 0.09 (0.09) 1.90 (1.04)* 41 (24) 5.53 (7.09)* 17 (10) b12 n.a..sup.a n.a. n.a. 0.40 (0.11) 100 .sup.an.a., not applicable *EC50 values less accurate due to low binding.
Example 13In Vivo Anti-Tumor Efficacy of AXL-ADCs in Xenograft Models with and without Autocrine (Endogenous) Gas6 Production
Gas6 Production of A431 and LCLC-103H Tumor Cells
[0731] It was tested whether A431 cells and LCLC-103H cells produce Gas6. Therefore, cells were grown in complete culture medium for 3 days. Gas6 levels in supernatant were determined using the Quantikine Human Gas6 ELISA (R&D Systems, Minneapolis, Minn.) according to manufacturer's instructions. This assay uses the quantitative sandwich ELISA technique. A monoclonal Ab specific for human Gas6 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any human Gas6 present is bound by the immobilized Ab. After washing away any unbound substances, an enzyme-linked polyclonal Ab specific for human Gas6 is added to the wells. Following a wash to remove any unbound Ab-enzyme reagent, a substrate is added to the wells and color develops in proportion to the amount of human Gas6 bound in the initial step. The color development is stopped and the intensity of the color is measured.
[0732] Cell culture medium conditioned by A431 cells was found to contain 2576 ng/mL Gas6, while the concentration of Gas6 in medium conditioned by LCLC-103H cells was more than 20-fold less (Table 15).
TABLE-US-00017 TABLE 15 Gas6 production in tumor cell conditioned medium. Cell line Gas6 in supernatant (ng/mL) LCLC-103H 126 A431 2576
Anti-Tumor Activity of AXL-ADCs In Vivo
[0733] The in vivo anti-tumor activity of IgG1-AXL-061-vcMMAE (Ig1 binder), IgG1-AXL-107-vcMMAE (Ig1-binder), IgG1-AXL-137-vcMMAE (Ig1-binder), IgG1-AXL-148-vcMMAE (Ig2-binder), IgG1-AXL-183-vcMMAE (FN1-binder), and IgG1-AXL-726-vcMMAE (FN2-binder) was determined in the A431 (epidermoid carcinoma) tumor model, that produces high levels of Gas6, and the LCLC-103H (large cell lung carcinoma) tumor model, that produces low levels of Gas6.
[0734] Tumor induction was performed by subcutaneous injection of 510.sup.6 A431 or LCLC-103H tumor cells (both obtained from Leibniz-InstitutDeutsche Sammlung von Mikroorganismen and Zellkulturen GmbH (DSMZ)) in 200 L PBS in the right flank of female SCID mice. Treatment was started 14-21 days after tumor cell inoculation, when the average tumor size was >100-200 mm.sup.3 and distinct tumor growth was observed. Mice received a single injection or a total of 4 biweekly intraperitoneal injections with IgG1-AXL-vcMMAE ADCs or control antibody (unconjugated IgG1-b12), as indicated. Tumor volume was determined at least two times per week. Tumor volumes (mm.sup.3) were calculated from caliper (PLEXX) measurements as: 0.52(length)(width)2.
[0735]
[0736]
[0737]
[0738] In summary, all AXL-ADCs showed anti-tumor activity in the LCLC-103H xenograft model that produces low levels of Gas6. In the A431 xenograft model, that produces high levels of Gas6, anti-tumor activity was only observed for those AXL-ADCs that did not compete with the AXL ligand Gas6.
Example 14AXL Expression in Different Tumor Indications
[0739] Expression of AXL was evaluated in freshly cut paraffin embedded and formalin fixated (FFPE) tumor tissue micro arrays (TMA) comprising tissue cores from patients with thyroid, esophageal, ovarian, pancreatic, lung, breast, cervical or endometrial cancer, or malignant melanoma. TMAs were obtained from US BioMax.
[0740] FFPE tumor array slides were deparaffinized and subjected to antigen retrieval (pH 6) and endogenous peroxidase was exhausted by incubation with 0.1% H.sub.2O.sub.2 in citrate/phosphate buffer. To detect AXL expression, the TMAs were incubated with rabbit-anti-AXL (Santa Cruz, cat nr: sc-20741) at a concentration of 1 g/mL for 60 min (room temperature (RT)). To identify (tumor) cells of epithelial origin, TMAs were incubated with rabbit-anti-cytokeratin (Abcam, cat. Nr. ab9377) at a dilution of 1:50 for 60 min (RT). After a washing step, the TMAs were incubated with peroxidase conjugated, anti-rabbit IgG dextran polymer (ImmunoLogic, cat no: DPVR55HRP) to detect binding of rabbit Anti-AXL and rabbit anti-cytokeratin antibodies. Finally, binding of anti-rabbit IgG dextran polymer was visualized with di-amino-benzadine (DAB; brown color; DAKO, cat no: K346811). In the TMA with malignant melanoma tissue cores, binding of anti-rabbit IgG dextran polymer was visualized with amino-ethyl carbazole (AEC; red color; Vector, SK4200). Nuclei in TMAs were visualized with hematoxylin (blue color).
[0741] AXL and cytokeratin immunostained TMAs were digitized with an Aperio slide scanner at 20 magnification and immunostaining was quantified with tissue image analysis software (Definiens Tissue Studio software, version 3.6.1), using a cell-based algorithm. The algorithm was designed to identify and quantify the percentage of AXL- or cytokeratin-positive cells in the biopsies (range 0-100%) and to quantify AXL staining intensity in AXL-positive tumor cells (optical density (OD); range 0-3) in each tumor core. Tumor cells were scored AXL positive, when AXL OD was at least 0.1. The percentage of AXL positive tumor cells per tumor core (range 0-100%) was calculated by dividing the total number of AXL positive cells by the total number of cytokeratin-positive cells in sequential tumor cores. The average AXL staining intensity (OD) in each tumor core was calculated by dividing the sum of AXL OD of all AXL positive tumor cells by the number of AXL positive tumor cells.
[0742] Tumor array from patients with malignant melanoma were scored manually. AXL staining intensity was scored as either weak (1+), moderate (2+) or strong (3+) and the percentage AXL positive melanoma cells was scored in 10% intervals (range 0-100%).
[0743]
TABLE-US-00018 TABLE 16 % tumor cores (patients) with >10% AXL-positive Tumor indication Subtype tumor cells Esophageal cancer Adenocarcinoma 73 (n = 19) Squamous cell carcinoma 55 (n = 60) Ovarian cancer All subtypes 90 (n = 52) Pancreatic cancer All subtypes 60 (n = 58) Lung cancer Squamous cell carcinoma 63 (NSCLC) SSC (n = 52) Adenocarcinoma 67 (n = 48) Lung cancer SCLC (n = 5) 60 (SCLC) Thyroid cancer All subtypes 92 (n = 48) Uterine cancer All subtypes 88 (n = 60) Breast cancer TNBC (n = 54) 24 Cervical cancer All subtypes 93 (n = 54) Melanoma Malignant melanoma 6 (n = 67) Abbreviations used: NSCLC, non small cell lung cancer; SLCL, small cell lung cancer; TNBC, triple negative breast cancer
Example 15AXL Antibodies Specifically Bind AXL but not Other TAM Receptor Family Members
Expression of Human AXL, MER, and TYRO3 in HEK-293F Cells
[0744] The following codon-optimized constructs for expression of various full-length proteins were generated: human (Homo sapiens) AXL (Genbank accession no. NP_068713.2), human MER (Genbank accession no. EAW52096.1, and human TYRO3 (Genbank accession no. Q06418.1). The constructs contained suitable restriction sites for cloning and an optimal Kozak (GCCGCCACC) sequence (Kozak et al., 1999). The constructs were cloned in the mammalian expression vector pcDNA3.3 (Invitrogen)
[0745] Freestyle 293-F (a HEK-293 subclone adapted to suspension growth and chemically defined Freestyle medium, (HEK-293F)) cells were obtained from Invitrogen and transfected with the expression plasmids using 293fectin (Invitrogen), according to the manufacturer's instructions and grown for 24-48 hours.
Binding Study of AXL Antibodies to Human AXL, Human MER, or Human TYRO3
[0746] HEK-293F cells transiently transfected with expression constructs for full length human AXL, MER, or TYRO3 were evaluated for binding of HuMab-AXL antibodies by flow cytometry. Transfected HEK-293F cells were incubated with serial dilutions of AXL-antibodies (4-fold dilutions; final concentration range 0.002-10 g/mL) for 30 minutes at 4 C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, Pa.; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide (final volume 100 L). Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 L PBS/0.1% BSA/0.02% azide and analyzed on a FACS CantoII (BD Biosciences). Staining with mouse anti-human Mer (R&D Systems, cat. Mab8912) and mouse anti-human Tyro3 (Dtk) (R&D Systems, cat. MAB859) were included as controls for expression, IgG1-b12 was included as a non-binding isotype control antibody. Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, Calif., USA).
[0747]
Example 16Internalization of Cell Surface Bound AXL Antibodies
Internalization of Cell Surface Bound HuMab-AXL Evaluated by Flow Cytometry
[0748] Internalization of cell surface bound HuMab-AXL antibodies to MDA-MB-231 and Calu-1 cells (human lung carcinoma cell line; ATCC, catalognumber HTB-54) was evaluated by flow cytometry. 50,000 cells were seeded in 96-well tissue culture plates and allowed to attach for 6 hrs at 37 C. Plates were incubated at 4 C. for 30 minutes before incubation with serial dilutions of AXL-antibodies (final concentration range 0.0032-10 g/mL) at 4 C. for 1 hour. Subsequently, the medium was replaced by tissue culture medium without antibody and cells were incubated overnight (16-18 hours) at 37 C. or 4 C. Subsequently, the cells were detached with 40 L warm trypsin solution, washed with ice-cold PBS/0.1% BSA/0.02% azide, and incubated for 30 minutes at 4 C. with R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, Pa.; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide (final volume 100 L), to detect AXL-antibodies on the cell surface. Finally, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
[0749] Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, Calif., USA).
[0750]
Fab-TAMRA/QSY7 Internalization and Intracellular Degradation Assay
[0751] Internalization of AXL antibodies was assessed in the Fab-TAMRA/QSY7 internalization assay. This assay uses a fluorophore (TAMRA) and quencher (QSY7) pair. In close proximity, for example, upon conjugation to the same protein, TAMRA fluorescence is quenched by QSY7. In this example, goat-anti-human IgG Fab-fragments (Jackson Immunoresearch) were conjugated with TAMRA/QSY7 (Fab-TAMRA/QSY7) as described (Ogawa et al., Mol Pharm 2009; 6(2):386-395), and AXL HuMab (1.5 g/mL) were preincubated with Fab-TAMRA/QSY7 (12 g/mL; 30 min, 4 C.). The complex was subsequently added to LCLC-103H cells and incubated for 24 h incubation in the dark, under shaking conditions (200 rpm, 37 C.). Internalization of the HuMab-Fab-TAMRA/QSY7 complex and intracellular degradation in the endosomes and lysosomes causes dissociation of TAMRA/QSY7, resulting in dequenching of TAMRA. TAMRA fluorescence of LCLC-103H cells that had been incubated with AXL antibodies complexed with Fab-TAMRA/QSY7 was measured on a FACS Canto-II (BD Biosciences).
[0752] As shown in
Example 17Anti-Tumor Efficacy of AXL-ADCs in an Esophageal Cancer Patient-Derived Xenograft (PDX) Model
[0753] The anti-tumor activity of IgG1-AXL-107-vcMMAE (also referred to as HuMax-AXL-ADC herein) was evaluated in the subcutaneous esophageal PDX model ES0195 in BALB/c nude mice (experiments performed by Crown Bioscience. Taicang Jiangsu Province, China). Tumor fragments from donor mice bearing patient-derived esophageal xenografts (ES0195) were used for inoculation into BALB/c nude mice. Each mouse was inoculated subcutaneously at the right flank with one tumor fragment (2-3 mm in diameter) and tumors were allowed to grow until the tumor volume was about 150 mm.sup.3. Randomization of animals was performed as follows: animals bearing a tumor with a volume of about 150 mm.sup.3 were distributed in 5 experimental groups (8 animals per group), considering a comparable median and mean of group tumor volume. The treatment groups were: IgG1-b12, IgG1-b12-vcMMAE, IgG1-AXL-107, IgG1-AXL-107-vcMMAE, and paclitaxel. The antibodies and ADCs were dosed intravenously (i.v.) at 4 mg/kg at day of randomization (day 0) and day 7. Paclitaxel was dosed intra-peritoneally (i.p.) at 20 mg/kg at day 0, 7, and 14. Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.52(length)(width).sup.2.
[0754]
Example 18Anti-Tumor Efficacy of AXL-ADC in a Cervical Cancer Patient-Derived Xenograft (PDX) Model
[0755] The anti-tumor activity of IgG1-AXL-183-vcMMAE and IgG1-AXL-726-vcMMAE was evaluated in the patient derived cervix carcinoma xenograft CEXF 773 model in NMRI nu/nu mice (Harlan, Netherlands). Experiments were performed by Oncotest (Freiburg, Germany).
[0756] Tumor fragments were obtained from xenografts in serial passage in nude mice. After removal from donor mice, tumors were cut into fragments (4-5 mm diameter) and placed in PBS (with 10% penicillin/streptomycin) until subcutaneous implantation. Mice under isofluorane anesthesia received unilateral, subcutaneous tumor implants in the flank. Tumors were allowed to grow until the tumor volume was 50-250 mm.sup.3.
[0757] Randomization of animals was performed as follows: animals bearing a tumor with a volume of 50-250 mm.sup.3 were distributed in 4 experimental groups (8 animals per group), considering a comparable median and mean of group tumor volume. The treatment groups were: IgG1-b12, IgG1-b12-vcMMAE, IgG1-AXL-183-vcMMAE and IgG1-AXL-726-vcMMAE. The antibodies and ADCs were dosed intravenously (i.v.) at 4 mg/kg on the day of randomization (day 0) and on day 7. Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.52(length)(width).sup.2.
[0758]
Example 19Anti-Tumor Efficacy of AXL-ADCs in an Orthotopic Breast Cancer Xenograft Model
[0759] The anti-tumor activity of IgG1-AXL-183-vcMMAE and IgG1-AXL-726-vcMMAE was evaluated in in an orthotopic MDA-MB-231 D3H2LN xenograft model.
[0760] MDA-MB-231-luc D3H2LN Bioware cells (mammary gland adenocarcinoma; Perkin Elmer, Waltham, Mass.) were implanted in the mammary fat pad of 6-11 week old, female SCID (C.B-17/IcrPrkdc-scid/CRL) mice (Charles-River) under isofluorane anesthesia. Tumors were allowed to grow and mice were randomized when tumors reached a volume of .sup.325 mm.sup.3. Therefore, mice were distributed in 4 experimental groups (6-7 animals per group), considering a comparable median and mean of group tumor volume. The treatment groups were: IgG1-b12, IgG1-b12-vcMMAE, IgG1-AXL-183-vcMMAE and IgG1-AXL-726-vcMMAE. The animals received a total of 4 biweekly doses of 3 mg/kg antibody or ADC starting at the day of randomization. Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.52(length)(width).sup.2.
[0761]
Example 20In Vitro Cytotoxicity Induced by AXL-Specific Antibody Drug Conjugates is Dependent on Target Expression
[0762] The in vitro cytotoxicity of IgG1-AXL-107-vcMMAE was tested in human tumor cell lines with different levels of AXL expression.
Cell Culture
[0763] LS174T cells (human colorectal adenocarcinoma cell line; ATCC, cat no CL-188) were cultured in Minimum Essential Medium (MEM) with Glutamax, Hepes and Phenol Red (Life Technologies, cat no 42360-024). Components are 10% Donor Bovine Serium with Iron (DBSI) (Life Technologies, cat no 10371-029) and 1% Sodium Pyruvate (100 mM; Lonza, cat no BE13-115E) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E).
[0764] NCI-H226 cells (human lung squamous cell carcinoma; ATCC, cat no CRL-5826), NCI-H661 cells (human large cell lung cancer; ATCC, cat no HTB-183), and NCI-H1299 cells (human non-small cell lung cancer; ATCC, cat no CRL-5803) were cultured in RPMI 1640 Medium (ATCC Modification; Life Technologies, cat no A10491-01). Components are 10% Donor Bovine Serium with Iron (DBSI; Life Technologies, cat no 10371-029) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E).
[0765] SKOV-3 cells (human ovarian adenocarcinoma; ATCC, cat no HTB-77) were cultured in McCoy's 5A Medium with L-glutamine and HEPES (Lonza, cat no BE12-168F). Components are 10% Donor Bovine Serium with Iron (DBSI; Life Technologies, cat no 10371-029) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E).
[0766] Calu-1 cells (human lung epidermoid carcinoma; ATCC, cat no HTB-54) were cultured in McCoy's 5A Medium with Catopeptone, without HEPES (Life Technologies, cat no 26600-023). Components are 10% Donor Bovine Serium with Iron (DBSI; Life Technologies, cat no 10371-029) and 1% L-glutamine (200 nM) in 0.85% NaCl solution (Lonza, cat no BE17-605F) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E). Calu-1 cells are resistant to EGFR targeted therapy.
[0767] LCLC-103H cells (human large cell lung cancer), A431 cells (human epidermoid adenocarcinoma) and MDA-MB-231 cells (human breast cancer) were cultured as described in Example 8.
Quantification of AXL Expression on the Plasma Membrane of Human Tumor Cell Lines
[0768] AXL expression on the plasma membrane of human tumor cell lines was assessed by indirect immunofluorescence using QIFIKIT (DAKO, Cat nr K0078) with mouse monoclonal antibody Z49M (Santa Cruz biotechnology, Cat nr sc-73719). Adherent cells were trypsinized and passed through a cell strainer to obtain single cell suspensions. Cells were pelleted by centrifugation for 5 minutes at 1,200 rpm, washed with PBS and resuspended at a concentration of 110.sup.6 cells/mL. The next steps were performed on ice. 100 L of the single cell suspensions (100,000 cells per well) were seeded in polystyrene 96-well round-bottom plates (Greiner Bio-One, Cat nr 650101). Cells were pelleted by centrifugation for 3 minutes at 300g and resuspended in 50 L antibody sample or mouse IgG1 isotype control sample (BD/Pharmingen, Cat nr 555746) at a concentration of 10 g/mL. After an incubation of 30 minutes at 4 C., cells were pelleted and resuspended in 150 L FACS buffer. Set-up and calibration beads were added to the plate according to the manufacturer's instructions. Cells and beads in parallel were washed two more times with 150 L FACS buffer and resuspended in 50 L FITC-conjugated goat-anti-mouse IgG (1/50; DAKO, Cat nr K0078). Secondary antibody was incubated for 30 minutes at 4 C. in the dark. Cells and beads were washed twice with 150 L FACS buffer and resuspended in 1004 FACS buffer. Immunofluorescence was measured on a FACS Canto II (BD Biosciences) by recording 10,000 events within the gate of viable cells. The mean fluorescence intensity of the calibration beads was used to calculate the calibration curve using GraphPad Prism software (GraphPad Software, San Diego, Calif., USA). For each cell line, the antibody binding capacity (ABC), an estimate for the number of AXL molecules expressed on the plasma membrane, was calculated using the mean fluorescence intensity of the AXL antibody-stained cells, based on the equation of the calibration curve (interpolation of unknowns from the standard curve, using GraphPad Software).
Cytotoxicity Assay
[0769] For LCLC-103H, A431, MDA-MB-231, NCI-H226, NCI-H661, NCI-H1299, LS174T and SKOV-3 cells, the in vitro cytotoxicity assay was performed as described in Example 8. For Calu-1, the cytotoxicity assay was performed as described in Example 8, with the adaptation that the cell cultures were incubated for 11 instead of 5 days. Dose-response curves were generated using Graphpad Prism software, using non-linear regression analysis. The percentage of viable cells at an IgG1-AXL-107-vcMMAE concentration of 1 g/mL was interpolated from the dose-response curves.
[0770] As shown in
Example 21Improved Anti-Tumor Efficacy of IgG1-AXL-107-vcMMAE in Combination with Erlotinib in a NSCLC Patient-Derived Xenograft (PDX) Model
LU2511 PDX Model
[0771] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous erlotinib-resistant NSCLC PDX model LU2511 in BALB/c nude mice (experiments performed by Crown Bioscience, Changping District, Beijing, China). Tumor fragments from donor mice bearing patient-derived NSCLC xenografts (LU2511) were used for inoculation into BALB/c nude mice. Each mouse was inoculated subcutaneously at the right flank with one tumor fragment (2-3 mm in diameter) and tumors were allowed to grow until the tumor volume was about 200 mm.sup.3. Randomization of animals was performed as follows: animals bearing a tumor with a volume of about 200 mm.sup.3 were distributed in 5 experimental groups (8 animals per group), considering a comparable median and mean of group tumor volume. The treatment groups were: IgG1-b12, IgG1-b12-vcMMAE, IgG1-AXL-107-vcMMAE, erlotinib, and erlotinib plus IgG1-AXL-107-vcMMAE. The antibodies and ADCs were dosed intravenously (i.v.) at 4 mg/kg on the day of randomization (day 0) and on day 7. Erlotinib was dosed orally (per os) at 50 mg/kg daily for 2 weeks. Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.5(length)(width).sup.2.
[0772]
LU0858 PDX Model
[0773] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous erlotinib-resistant NSCLC PDX model LU0858 in BALB/c nude mice (experiments performed by CrownBioscience, Changping District, Beijing, China). Inoculation of tumor fragments into BALB/c nude mice and randomization was performed as described above.
[0774] Treatment with IgG1-AXL-107-vcMMAE (2 or 4 mg/kg) was performed at day 0 and 7 after randomization of the groups (
LU1868 PDX Model
[0775] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous erlotinib-resistant NSCLC PDX model LU1858 in BALB/c nude mice (experiments performed by CrownBioscience, Changping District, Beijing, China). Inoculation of tumor fragments into BALB/c nude mice and randomization was performed as described above.
[0776] Treatment with IgG1-AXL-107-vcMMAE (2 or 4 mg/kg) was performed at day 0 and 7 after randomization of the groups. IgG1-AXL-107-vcMMAE treatment in combination with EGFR inhibitor erlotinib was also tested. Erlotinib was given daily for 14 days at a dose of 50 mg/kg. Treatments with erlotinib alone, IgG1-b12-vcMMAE or IgG1-b12 were included as controls (
[0777] Analysis by Mann-Whitney test was done on day 21 to compare treatment effects versus IgG1-b12 or IgG1-b12-vcMMAE, on day 28 to compare the effects of IgG1-AXL-107-vcMMAE 2 mg/kg alone versus IgG1-AXL-107-vcMMAE 2 mg/kg in combination with erlotinib, and on day 31 to compare the effects of IgG1-AXL-107-vcMMAE 4 mg/kg alone versus IgG1-AXL-107-vcMMAE 4 mg/kg in combination with erlotinib. Erlotinib alone had no effect on tumor growth. At 2 mg/kg and 4 mg/kg, IgG1-AXL-107-vcMMAE alone induced tumor growth inhibition, while the combination of IgG1-AXL-107-vcMMAE with erlotinib did not improve the outcome versus IgG1-AXL-107-vcMMAE alone (
LXFA 526 PDX Model
[0778] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous erlotinib-resistant NSCLC PDX model LXFA 526 (experiments performed by Oncotest, Freiburg, Germany). Inoculation of tumor fragments into 4-6 weeks old male NMRI nu/nu mice and randomization was performed as described above.
[0779] Treatment with IgG1-AXL-107-vcMMAE (2 or 4 mg/kg) was performed at day 0 and 7 after randomization of the groups (
LXFA 677 and LXFA 677_3 PDX Models
[0780] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous NSCLC PDX model LXFA 677 and the LXFA 677_3 model, which is derived from the LXFA 677 model and has acquired resistance to erlotinib (experiments performed by Oncotest, Freiburg, Germany). Inoculation of tumor fragments into 4-6 weeks old male NMRI nu/nu mice and randomization was performed as described above.
[0781] Treatment with IgG1-AXL-107-vcMMAE (2 or 4 mg/kg) was performed at day 0 and 7 after randomization of the groups. IgG1-AXL-107-vcMMAE treatment in combination with the EGFR inhibitor erlotinib was also tested. Erlotinib was given daily for 14 days at a dose of 50 mg/kg. Erlotinib alone, IgG1-b12-vcMMAE and IgG1-b12 were used as controls. Erlotinib induced partial tumor regression in the LXFA 677 model but had no effect on tumor growth in the erlotinib-resistant LXFA 677_3 model, as expected (
TABLE-US-00019 TABLE 17 Overview of Lung PDX models, EGFR mutational status and response to erlotinib and AXL-ADC. Model EGFR status Erlotinib resistance LU2511 .sup.a WT R LU0858.sup.b L858R R LU1868.sup.b T790M/L858R R LXFA526 WT R LXFA677 .sup.c WT sensitive LXFA677_res3 .sup.c WT R .sup.a Yang et al. EORTC meeting 2013, Poster 493 (2013) .sup.bYang et al. Int. J. Cancer: 132, E74-E84 (2013) .sup.c Tschuch et al. AACR-EORTC meeting 2015, Poster A10 (2015)
Example 22NSCLC Cell Lines that are Resistant to the EGFR Inhibitors Erlotinib, Gefitinib, and Afatinib Show Enhanced Axl Protein Expression and Enhanced Sensitivity to IgG1-AXL-107-vcMMAE In Vitro
[0782] The influence of acquired resistance to erlotinib on Axl protein expression in a panel of NSCLC cell lines was evaluated by Western blot analysis. Furthermore, the NSCLC cell lines were evaluated for their sensitivity to IgG1-AXL-107-vcMMAE in vitro.
Cell Culture and Anticancer Agents
[0783] All tissue culture materials were obtained from Gibco Life Technologies (Carlsbad, Calif.). The erlotinib-sensitive NSCLC adenocarcinoma cell line HCC827 was purchased from the ATCC. HCC827 cells are KRAS wildtype and harbor the exon19del mutation in EGFR (deletion of E746-A750), which is associated with sensitivity to EGFR-TKIs. Cells were cultured in RPMI-1640 Glutamax medium supplemented with 10% fetal bovine serum (FBS) and 50 g/mL penicillin-streptomycin and maintained in a humidified atmosphere with 5% CO.sub.2 at 37 C. EGFR inhibitors (erlotinib, gefitinib, and afatinib) were purchased from Selleck Chemicals (Houston, Tex.). Erlotinib and gefitinib were dissolved in DMSO, aliquoted and stored at 20 C.
Short Tandem Repeat Analysis
[0784] To confirm cell line authenticity, short tandem repeat (STR) analysis was performed using the Cell ID System (cat. G9500, Promega, Madison, USA) as described by the manufacturer. In brief, ten specific loci of the human genome were PCR amplified and analyzed by capillary electrophoresis. We found that ER10, ER20 and ER30 had the same allelic sizes at all ten loci as the parental HCC827 clone. We also found the allelic loci sizes to be identical to those published by ATCC.
DNA Purification and EGFR/KRAS Mutation Testing
[0785] DNA was extracted from the cells using the QIAamp DNA Mini Kit (Qiagen, Hilden, Germany), and EGFR and KRAS mutation status examined using the TheraScreen EGFR RGQ PCR kit and the TheraScreen KRAS RGQ PCR kits (Qiagen, Hilden, Germany) as described by the manufacturer.
In Vitro Cytotoxicity Assay to Test Cell Line Sensitivity to Erlotinib or AXL-ADC
[0786] 2000 cells/well (5000 cells in the case of ER20) were seeded in 96 well plates and allowed to adhere for 6-8 h before adding erlotinib, gefitinib, afatinib, IgG1-AXL-107-vcMMAE or the isotype control ADC IgG1-b12-vcMMAE; then incubated at 37 C. and 5% CO.sub.2 for 5 days and quantified by Cell Titer Glo Assay (as described in Example 8). Untreated cells were used as reference for 100% cell growth. Plates were incubated for 4 or 5 days at 37 C., 5% CO.sub.2. Crystal violet assay was performed by adding staining solution for 5 min at RT, washing cells twice in H.sub.2O, redissolving in Na-citrate buffer (29.41 g Na-citrate in 50% EtOH) and measuring the absorbance at 570 nm.
Generation of Erlotinib- or Gefitinib-Resistant NSCLC Cell Lines
[0787] Three isogenic erlotinib-resistant cell lines were generated from the HCC827 cell line, by continuous exposure to erlotinib. Cells were initially exposed to 1 M erlotinib, and the erlotinib concentration was gradually increased to 20 M or 30 M, respectively, over a course of six months. Once cell lines had acquired resistance to erlotinib, they were cultured in culture medium as described above, supplemented with 20 M or 30 M erlotinib.
[0788] Similarly, one isogenic erlotinib-resistant cell line and 5 gefitinib-resistant cell lines were generated from the PC9 cell line, by continuous exposure to erlotinib or gefitinib. Cells were initially exposed to 1 M erlotinib or gefitinib, and the TKI concentration was gradually increased to up to 30 M over a course of six months.
Western Blotting
[0789] Expression of Axl was determined by Western blot analysis. Axl activation was determined by measuring the phosphorylation using phospho-specific antibodies. Cells were washed in ice cold TBS, spun down and lysed in RIPA buffer (10 mM Tris HCl pH 8, 5 mM Na2EDTA pH 8, 1% NP-40, 0,5% sodium dioxycholate, 0,1% SDS), containing both protease and phosphatase inhibitors (Complete Mini PhosphoSTOP, Roche, Basel, Switzerland). Protein concentrations were determined by Pierce BCA Protein Assay (Thermo Fisher Scientific, USA) according to the manufacturer's protocol. 5-40 g protein was resolved on 4-12% RunBlue SDS-PAGE gels (Expedeon, San Diego, Calif.), transferred onto PVDF membrane (GE Healthcare Life Sciences, Denmark), blocked and then incubated with primary antibodies O/N at 4 C. The anti-actin antibody was purchased from Abcam (cat. no. ab8226) and the antibody against total AXL was purchased from R&D Systems (cat. no. AF154). Next, the membranes were incubated with goat anti-rabbit, goat anti-mouse (Dako, Denmark) or donkey anti-goat (Santa Cruz) HRP-conjugated secondary antibodies in 1:5000 dilution for 1 h at room temperature. The immune reactive bands were visualized by Amersham ECL Prime Western Blotting Detecting Reagent (GE Healthcare Life Sciences, Buckinghamshire, UK) and exposed to CL-Xposure film (Thermo Fisher Scientific, USA).
Results
[0790] The HCC827 wildtype cell line was highly sensitive to erlotinib treatment, with an IC.sub.50 of approximately 0.005 M. The erlotinib-resistant cell lines ER10, ER20 and ER30, which were generated by exposure to increasing concentrations of erlotinib for six months, were not sensitive to erlotinib (IC.sub.50>50 M) (Table 18). The stability of the erlotinib-resistant phenotype was confirmed by culturing the ER10, ER20 and ER30 cell lines in absence of erlotinib for six weeks. After the six weeks, cell lines showed the same level of resistance to erlotinib. The mutational status of EGFR and KRAS of the erlotinib-resistant cell lines remained unchanged compared to the parental cell line (Table 18). The expression of Axl protein was upregulated in the HCC827-derived cell lines that had acquired resistance to erlotinib (
[0791] Similarly, expression of Axl protein was upregulated in the PC9-derived cell lines that had acquired resistance to erlotinib or gefitinib (
TABLE-US-00020 TABLE 18 Characteristics of the parental HCC827 cell line and the derived erlotinib-resistant cell lines. HCC827- HCC827- HCC827- HCC827- wt ER10 ER20 ER30 Erlotinib Sensitive Resistant Resistant Resistant sensitivity IC.sub.50 0.005 m >50 m >50 m >50 m Exposed to 0 m 10 m 20 m 30 m conc. of erlotinib EGFR status Exon19del Exon19del Exon19del Exon19del KRAS states wt Wt wt Wt
[0792] The sensitivity of the wild type and erlotinib/gefitinib resistant HCC827 and PC9 cells to IgG1-AXL-107-vcMMAE was evaluated. Therefore, cells were exposed to increasing concentrations of IgG1-AXL-107-vcMMAE (range 10 g/mL-3.810.sup.5 g/mL) for 5 days after which the cell viability was determined.
Example 23Resistance to the BRAF Inhibitor PLX4720 is Associated with Upregulated Axl Protein Expression and Enhanced Sensitivity to IgG1-AXL-107-vcMMAE
[0793] In a panel of established human melanoma cell lines (CDX) and patient derived low passage melanoma cell lines (PDX), Axl protein expression and sensitivity to IgG1-AXL-107-vcMMAE were evaluated in relation to their intrinsic or acquired resistance to growth inhibition by treatment with the BRAF inhibitor PLX4720, an analogue to the clinically approved BRAF inhibitor vemurafenib.
Cell Culture
[0794] SKMEL147 was obtained from the Laboratory of Reuven Agami at the Netherlands Cancer Institute. A875 was obtained from Thermo Fischer, COL0679 from Sigma, SKMEL28 and A375 cells from ATCC. Melanoma cell lines were cultured in DMEM supplemented with 10% fetal bovine serum (Sigma), 100 U/ml penicillin and 0.1 mg/ml streptomycin (all Gibco). The cell lines were maintained at 37 C. in a 5% (vol/vol) CO.sub.2 humidified incubator.
Generation of PLX4720 Resistant Cell Lines
[0795] BRAF inhibitor sensitive cell lines (SKMEL28, and A375) were cultured in the presence of increasing concentrations of the BRAF inhibitor PLX4720 (Selleck Chemicals, Houston, Tex., USA, Company: Selleck Chemicals, Houston, Tex., USA, Catalog number: S1152,) up to 3 M to establish the corresponding PLX4720 resistant SKMEL28R, and A375R. All drug-resistant cell lines were permanently cultured in the presence of 3 M of PLX4720.
Generation of Patient Derived Low Passage (PDX) Melanoma Cell Lines
[0796] The Medical Ethical Board of the Antoni van Leeuwenhoek hospital, Netherlands Cancer Institute has approved the collection and use of human tissue. Animal experiments were approved by the animal experimental committee of the institute and performed according to applicable rules and regulations. Human tumor material was obtained during surgery, or by taking tumor biopsies from malignant melanoma patients using a 14-gauge needle. Tumor fragments of .sup.5 mm.sup.3 were used for subcutaneous implantation in NOD.Cg-Prkdc.sup.scidIl2rg.sup.tm1Wji/SzJ mice, which was performed under anesthesia. Tumor outgrowth was measured twice per week with a caliper. Before reaching the a tumor size of 1000 mm.sup.3, mice were sacrificed, tumors were removed and tumor pieces were dissociated into single cells suspensions, plated on 10-cm dishes and grown as primary cell cultures in DMEM+10% FBS (Sigma)+100 U/ml penicillin and 0.1 mg/ml streptomycin (all Gibco).
Western Blot Analysis
[0797] Expression of Axl and MITF was determined using Western blot analysis. The proteins in the cell lysate were separated on a 4-12% SDS-PAGE gel and transferred to PVDF membrane that was subsequently stained with antibody specific for Axl (sc-1096 Santa Cruz) in 5% BSA in PBS-Tween, or to a nitrocellulose membrane stained with MITF (ab12039 Abcam) in 5% non-fat dry milk in PBS-Tween. To control for gel loading, antibodies against vinculin or beta-actin were used.
Quantification of AXL Expression on the Plasma Membrane of Melanoma Cell Lines
[0798] AXL expression on the plasma membrane of human tumor cell lines was quantified by indirect immunofluorescence using QIFIKIT analysis (DAKO, Cat nr K0078). Axl was detected using the mouse monoclonal antibody ab89224 (Abcam, Cambridge, UK). Adherent cells were trypsinized and passed through a cell strainer to obtain single cell suspensions. Cells were pelleted by centrifugation for 5 minutes at 1,200 rpm, washed with PBS and resuspended at a concentration of 110.sup.6 cells/mL. The next steps were performed on ice. 100 L of the single cell suspensions (100,000 cells per well) were seeded in polystyrene 96-well round-bottom plates (Greiner Bio-One, Cat nr 650101). Cells were pelleted by centrifugation for 3 minutes at 300g and resuspended in 50 antibody sample or mouse IgG1 isotype control sample (cat number QF2040741, lot number MA1-10406, Pierce) at a concentration of 10 g/mL. After an incubation of 30 minutes at 4 C., cells were pelleted and resuspended in 150 L FACS buffer (PBS containing 0.1% BSA). Set-up and calibration beads were added to the plate according to the manufacturer's instructions. Cells and beads in parallel were washed two more times with 150 L FACS buffer and resuspended in 50 l FITC-conjugated goat-anti-mouse IgG (1/50; DAKO, cat. no. K0078). Secondary antibody was incubated for 30 minutes at 4 C. in the dark. Cells and beads were washed twice with 150 L FACS buffer and resuspended in 100 L FACS buffer. Immunofluorescence was measured on a FACS Calibur (BD Biosciences) by recording 10,000 events within the gate of viable cells. The mean fluorescence intensity of the calibration beads was used to calculate the calibration curve using GraphPad Prism software (GraphPad Software, San Diego, Calif., USA). For each cell line, the antibody binding capacity (ABC), an estimate for the number of AXL molecules expressed on the plasma membrane, was calculated using the mean fluorescence intensity of the AXL antibody-stained cells, based on the equation of the calibration curve (interpolation of unknowns from the standard curve, using GraphPad Software).
In Vitro Cytotoxicity
[0799] Cells were cultured to near confluency, after which cells were trypsinized, resuspended in culture medium and passed through a cell strainer (BD Falcon, cat. no. 352340) to obtain single cell suspensions. Cells were plated in a 96-well format using the following seeding densities: 2000 cells/well for established cell lines, 4000 cells/well for PDX-derived cell lines. IgG1-AXL-107-vcMMAE was added 4 hours after seeding. Serial dilutions (10-fold; final concentrations ranging from 0.0001 to 10 g/mL) of IgG1-AXL-107-vcMMAE were prepared in culture medium and added to the plates. After 5 days (for CD samples) or 8 (PDX samples) days of incubation at 37 C., 5% CO.sub.2, CellTiter-Glo Reagent (Promega; cat. no. G7571) was added to the wells and the Luminescent Cell Viability Assay (Promega, Madison, Wis.) was performed according to the manufacturer's protocol. Luminescence was measured by the Infinite M200 microplate reader (Tecan) and viability was calculated as follows: % viability=(luminescence sample of interestluminescence PAO)/(average luminescence of control vehicle treatedluminescence PAO), with PAO representing 5 M phenyl arsine oxide for 100% cell killing.
SKMEL147 Melanoma Xenograft Model
[0800] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous melanoma model SKMEL147 in NMRI nude mice. Mice were subcutaneously injected in the left flank with 2.5105 SKMEL147 melanoma cells, which express high levels of Axl (see
[0801] On day 12 and day 19 after tumor cell injection (day 1 and day 8 of randomization) the test compounds were injected into the tail vein of the animals in a total volume of 100 L. Animals were sacrificed when the size of the tumor exceeded 1000 mm3.
Treatment of a Mixed Population of SKMEL28 Wild Type Cells and SKMEL28 Cells Resistant to PLX4720
[0802] SKMEL28 wild-type cells and SKMEL28 cells resistant to PLX4720 (SKMEL28-R) were transfected with expression vectors of the fluorophores mCherry (red) or GFP (green), respectively. Subsequently, cells were seeded in a 1:1 ratio, with 50.000 cells of each cell line in a 6-well plate (in total 100.000 cells/well). After 3 hours, the following compounds were added to the wells: IgG1-AXL-107-vcMMAE (1 g/mL), IgG1-b12-MMAE (1 g/mL; isotype control ADC), PLX4720 (10 M; BRAF inhibitor), dabrafenib (1 M; BRAF inhibitor), or trametinib (0.1. M; MEK inhibitor). After 4 days, cells were trypsinized, washed once in PBS+1% BSA and analyzed by flow cytometry.
Immunohistochemistry
[0803] Expression of AXL was evaluated in freshly cut paraffin embedded and formalin fixated (FFPE) whole tissues (WT) with malignant melanoma. Staining was performed manually in Sequenza Slide Racks (Ted Pella Inc., Redding, Calif., USA; cat. no. 36105).
[0804] Prior to staining, FFPE tissue slides were deparaffinized in 100% xylene (Sigma-Aldrich, cat. no. 16446; three times, 5 min.) and dehydrated in 96% ethanol (Sigma Aldrich, cat. no. 32294; two times, 5 min.) at RT. Thereafter, antigen retrieval was performed. IHC slides were incubated in citrate buffer (pH6; DAKO; cat. no. 52369) for 5 min. and blocked for endogenous peroxidase in citrate/phosphate buffer (0.43 M citric acid, 0.35 M Na.sub.2HPO.sub.4.2H.sub.2O; pH5.8) at RT for 15 min. Slides were incubated in 10% normal human serum (CLB/Sanquin, cat. no. K1146) in PBS, prior to incubation with primary antibodies. Axl expression was determined by incubation with 3 g/mL rabbit polyclonal anti-human Axl antibody H-124 in PBS supplemented with 2% normal human serum at RT for 60 min. Slides were washed in PBS supplemented with 0.1% Tween-20 (twice, 3 min.) and binding of rabbit antibodies specific for Axl were detected with undiluted Bright Vision poly-HRP-anti-rabbit IgG. HRP was visualized with 3-amino-9-ethylcarbazole (AEC) chromophore (red color; Sigma, cat. no. A6926-100TAB); nuclei were counterstained with hematoxylin (DAKO, cat. no. S3309). Slides were analyzed by a certified pathologist at the Netherlands Cancer Institute (NKI, Amsterdam, The Netherlands), who scored the intensity and localization of Axl staining in each sample. Examples are shown in
Results
[0805] AXL expression was evaluated in a panel of established melanoma cell lines (Table 19) and low passage primary melanoma lines (PDX, Table 20). AXL expression, as determined by western blot (
[0806] Next, sensitivity of the established melanoma cell lines and PDX panel to IgG1-AXL-107-vcMMAE was evaluated in viability assays. Cells were exposed to increasing concentrations of IgG1-AXL-107-vcMMAE (range 110.sup.4 to 10 g/mL) for 5 days after which the cell viability was determined. Results are summarized in Table 19 and 20, dose-response curves are shown in
TABLE-US-00021 TABLE 19 Characteristics of the melanoma cell line panel. AXL AXL expression expression (FACS) HuMax- (western Receptor PLX4720 AXL-ADC Cell line blot) number (ABC) BRAF NRAS sensitivity sensitivity SKMEL147 + 34981 wt Q61R resistant Sensitive A875 + 37079 V600E wildtype sensitive Sensitive COLO679 BLQ V600E Wt untested Resistant A375R + 14228 V600E Wt resistant Sensitive SKMEL28 BLQ V600E Wt sensitive Resistant SKMEL28R + 63809 V600E Wt resistant Sensitive * BLQ = Below Limit of Quantitation (<3300, lowest ABC value of calibration beads)
TABLE-US-00022 TABLE 20 Characteristics of the patient-derived melanoma cultures AXL expression AXL Receptor BRAF/ expression number HuMax- NRAS (western (ABC, PLX4720 AXL-ADC Name status Blot) FACS) sensitivity sensitivity M016 NRAS.sup.Q61R + 13688 resistant Sensitive M019R BRAF.sup.V600E + + 25988 resistant Sensitive M082 BRAF.sup.V600E (low) 3376 resistant Insensitive
[0807] In the SKMEL147 melanoma xenograft model, mice treated with IgG1-b12, IgG1-b12-vcMMAE, or IgG1-AXL-107 did not show tumor growth inhibition. IgG1-AXL-107-vcMMAE induced tumor growth inhibition at 2 mg/kg, and at a dose of 4 mg/kg IgG1-AXL-107-vcMMAE induced strong tumor regression, which lasted until around day 50 (
[0808] HuMax-AXL-ADC at a dose of 4 mg/kg thus showed a profound anti-tumor effect, but tumors started to grow out again after day 50. Four mice that showed tumor regrowth upon initial tumor regression with 4 mg/kg IgG1-AXL-107-vcMMAE were retreated with a single dose of 4 mg/kg IgG1-AXL-107-vcMMAE on days 55, while for comparison two other mice were observed.
[0809] Retreatment with 4 mg/kg IgG1-AXL-107-vcMMAE resulted in tumor regression in all four mice, whereas the 2 mice that were observed, showed tumor growth (
[0810] In the mixed population of SKMEL28 wt cells and SKMEL28 PLX4720-resistant cells, compared to the untreated control, total cell numbers were reduced with 74-62% when cell mixtures were treated with IgG1-AXL-107-vcMMAE, PLX4720, or dabrafenib (
[0811] To evaluate if specific cell populations were eradicated, the ratio of green (GFP-positive SKMEL28-R cells) and red (mCherry-positive SKMEL28 cells) was determined. As expected, untreated and IgG1-b12-vcMMAE treatment did not affect the GFP/mCherry ratio, as total cell numbers were also unaffected (
Results IHC
[0812] In total 45 samples were analyzed, of which 3 did not contain any tumor material and were thus excluded from analysis. In addition, 7 matched pre- and post vemurafenib samples from the same patients were included, and 1 matched pre- and post dabrafenib/trametinib sample.
[0813] In 41/42 samples Axl expression was detected in subsets of the melanoma region. Staining intensity differed per patient tumor (Table 21).
[0814] Furthermore, up regulation of Axl expression (as measured by increase of staining intensity by pathologist) was observed in 4/7 matched pre- and post vemurafenib samples (Table 21).
TABLE-US-00023 TABLE 21 Axl staining in tumor tissue from melanoma patients. Case Pre-/post- Matched Axl staining nr. Treatment treatment sample tumor cells.sup.a Comments 1 vemurafenib post NA Partially+ 2 vemurafenib post 17 Weakly + to + 3 dabr/tram post NA + + to + + + 4 vemurafenib post NA Focally+ 5 vemurafenib post NA Partially weakly+ 6 dabr/tram post 40 NA very necrotic 7 dabr/tram pre 16 Sporadic+ 8 vemurafenib post 38 Sporadic+ the weakly positive cells at the edge of the tumor could be the result of staining artefact 9 vemurafenib post NA 10 vemurafenib post NA Partially weakly+ 11 vemurafenib post NA Weakly+ many melanophages+ 12 vemurafenib post NA Locally weakly+ some melanophages+ 13 vemurafenib post NA + + to + + + 14 vemurafenib post 39 Weakly+ many melanophages+ 15 vemurafenib post 24 Weakly+ 16 dabr/tram post 7 Weakly+ 17 vemurafenib pre 2 Partially+ 18 vemurafenib 18 stable NA Weakly+ disease post 19 vemurafenib post NA Locally + to + + 20 vemurafenib 20 stable NA Weakly+ disease post 21 vemurafenib post NA Weakly+ 22 vemurafenib post NA Partially+ many melanophages+ 23 vemurafenib post NA + to + + 24 vemurafenib pre 15 Sporadic+ 25 vemurafenib post NA Sporadic+ 26 vemurafenib pre 44 Weakly+ many melanophages+ 27 vemurafenib post NA Partially and weakly+ 28 vemurafenib 28 stable NA Weakly+ limited amount of disease tumor cells are post present 29 vemurafenib post NA Partially and weakly+ 30 vemurafenib post NA Partially+ 31 vemurafenib post NA Partially+ 32 vemurafenib post NA + small amount of tumor cells/ melanophages with melanin 33 vemurafenib post NA Locally weakly+ 34 vemurafenib post NA Weakly + to + 35 vemurafenib post NA Weakly+ 36 vemurafenib post NA weakly+ many melanophages + 37 vemurafenib post NA Partially weakly+ 38 vemurafenib pre 8 Weakly + to + 39 vemurafenib pre 14 + the positive cells are present in the sinuses of the lymph nodes. It is not certain whether they are tumor cells or macrophage since these cells contain rather rich cytoplasm 40 dabr/tram pre 6 NA no neoplastic lesions are encountered 41 vemurafenib post NA NA no neoplastic lesions are encountered 42 vemurafenib post NA Partially+ partial negative areas could be due to staining artefact 43 vemurafenib post NA Weakly + to + 44 vemurafenib post 26 + to + + 45 vemurafenib post NA Partially weakly+ .sup.anegative; positive staining intensity: weakly + < + < + + < + + +; positive staining area: sporadic < focal < local < partial; NA: not available
Example 24CV1664 PDX Model
[0815] The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous cervical cancer PDX model CV1664 in BALB/c nude mice (experiments performed by CrownBioscience, Changping District, Beijing, China). Inoculation of tumor fragments into BALB/c nude mice and randomization was performed as described in Example 21.
[0816] Treatment with IgG1-AXL-107-vcMMAE (2 or 4 mg/kg) was performed at day 0 and 7 after randomization of the groups (
[0817] IgG1-AXL-107-vcMMAE induced strong tumor regression at both dose levels, which lasted at least until day 49 (
[0818] Two mice that showed tumor regrowth upon initial tumor regression with 4 mg/kg IgG1-AXL-107-vcMMAE were retreated with 2 doses of 4 mg/kg IgG1-AXL-107-vcMMAE on days 55 and 62. This resulted in partial tumor regression in both mice (
[0819] Three mice that showed tumor regrowth upon initial tumor regression with paclitaxel were retreated with 2 doses of 4 mg/kg IgG1-AXL-107-vcMMAE on days 55 and 62. Two of the three mice showed complete tumor regression upon retreatment with IgG1-AXL-107-vcMMAE (
LIST OF REFERENCES
[0820] Bahadoran et al., J Clin Oncol; 2013 Jul. 1; 31(19): e324-e326 [0821] Bansal et al., Oncotarget. 2015 Jun. 20; 6(17):15321-31 [0822] Blakely et al., Cancer Discov. 2012 October; 2(10):872-5 [0823] Bleeker et al., J Immunol. 2004 Oct. 1; 173(7):4699-707. [0824] Bollag et al., Nat Rev Drug Discov 2012 November; 11(11):873-86 [0825] Brand et al., Clin Cancer Res. 2015 Jun. 1; 21(11):2601-12 [0826] Dahlman et al., Cancer Discov. 2012 September; 2(9):791-7. Epub 2012 Jul. 13. [0827] Debruyne et al., Oncogene. 2015 Nov. 30. doi: 10.1038/onc.2015.434 [0828] Dufies et al., Oncotarget. 2011 November; 2(11):874-85 [0829] Elkabets et al., Cancer Cell. 2015 Apr. 13; 27(4):533-46 [0830] Greig et al., Drugs, 2016 February; 76(2):263-73. [0831] Herbst et al., Expert Opin Investig Drugs. 2007 February; 16(2):239-49 [0832] Hilger et al., Int J Clin Pharmacol Ther. 2002 December; 40(12):567-8. [0833] Hong et al., Cancer Lett. 2008 Sep. 18; 268(2):314-24. [0834] Hong et al., Cancer Res. 2013 Jan. 1; 73(1):331-40. [0835] Hong et al., Clin Cancer Res. 2012 Apr. 15; 18(8):2326-35. [0836] Huang et al., Cancer Res. 2010 Sep. 15; 70(18):7221-31. doi: 10.1158/0008-5472.CAN-10-0391 [0837] Kim et al., Curr Opin Mol Ther. 2004 February; 6(1):96-103. [0838] Kim et al., Mol Oncol. 2013 December; 7(6):1093-102. [0839] Konieczkowski et al., 2014, Cancer Discov 4: 816-827. [0840] Li et al., Oncogene. 2008 Aug. 7; 27(34):4702-11. [0841] Li et al., Cancer Lett. 2016 Jan. 28; 370(2):332-44. [0842] Liu et al., Cancer Res. 2009 Sep. 1; 69(17):6871-8 [0843] Mahadevan et al., Oncotarget. 2015 Feb. 10; 6(4):1954-66 [0844] Mordant et al., Mol Cancer Ther. 2010 February; 9(2):358-68 [0845] Mller et al., Nat Commun. 2014 Dec. 15; 5:5712 [0846] Park et al., Leukemia. 2015 December; 29(12):2382-9 [0847] Pettazzoni et al., Cancer Research 2015; 75: 1091-1101. [0848] Pollack et al., J Pharmacol Exp Ther. 1999 November; 291(2):739-48 [0849] Prewett et al., J Immunother Emphasis Tumor Immunol. 1996 November; 19(6):419-27. [0850] Sirotnak et al., Clin Cancer Res. 2000 December; 6(12):4885-92. [0851] Talavera et al., Cancer Res. 2009 Jul. 15; 69(14):5851-9 [0852] Tan et al., Lung Cancer. 2012 May; 76(2):177-82. [0853] Wilson et al., Cancer Res. 2014 Oct. 15; 74(20):5878-90 [0854] Wong et al., J Pharmacol Exp Ther. 2009 April; 329(1):360-7. [0855] Xia et al., Oncogene. 2002 Sep. 12; 21(41):6255-63. [0856] Yang et al., Crit Rev Oncol Hematol. 2001 April; 38(1):17-23. [0857] Zhang et al., Nat Genet. 2012 Jul. 1; 44(8):852-60 [0858] Zhou et al., Oncogene. 2016 May; 35(21):2687-97 [0859] WO 2014/174111; Pierre Fabr Medicament and Spirogen Sarl [0860] WO 09/062690; U3 Pharma [0861] WO 2010/130751; U3 Pharma [0862] WO 2014/093707; Stanford University [0863] EP 2 228 392 A1; Chugai [0864] Yang et al., EORTC meeting 2013, Poster 493 (2013a) [0865] Yang et al., Int. J. Cancer: 132, E74-E84 (2013b) [0866] Paccez et al., Int. J. Cancer: 134, 1024-1033 (2014) (Epub 2013 Jun. 4) [0867] Leconet et al., Oncogene, 1-10 (2013) [0868] Linger et al., Expert Opin. Ther. Targets, 14(10):1073-1090 (2010) [0869] Li et al., Oncogene, 28, 3442-3455 (2009) [0870] Ye et al., Oncogene, 1-11 (2010) [0871] Alley et al., Current Opinion in Chem. Bio., 4, 529-537 (2010) [0872] lida et al., Anticancer Research, 34:1821-1828 (2014) [0873] Tschuch et al., AACR-EORTC meeting 2015, Poster A10 (2015) [0874] King et al., Cancer Res. 2006 Dec. 1; 66(23):11100-5. [0875] Montagut et al., J. Cancer Res. 2008 Jun. 15; 68(12):4853-61. [0876] Sequist et al., N Engl J Med. 2015 Aug. 6; 373(6):578-9 [0877] Li et al., Structure. 2008 February; 16(2):216-27 [0878] Pedersen et al., Cancer Res. 2010 Jan. 15; 70(2):588-97. [0879] Mishima et al., Cancer Res. 2001 Jul. 15; 61(14):5349-54 [0880] WO 2012/175691; INSERM [0881] WO 2012/175692; INSERM [0882] WO 2013/064685; PF Medicament [0883] WO 2013/090776; INSERM [0884] WO 2009/063965; Chugai Pharmaceuticals [0885] WO 2010/131733 [0886] Hfizi et al. et al., 2006, FEBS Journal, 273; 5231-5244 [0887] WO 2007/059782; Genmab A/S [0888] Ward et al., Nature 341, 544-546 (1989) [0889] Holt et al.; Trends Biotechnol. 2003 November; 21(11):484-90 [0890] Revets et al.; Expert Opin Biol Ther. 2005 January; 5(1):111-24 [0891] Bird et al., Science 242, 423-426 (1988) [0892] Huston et al., PNAS USA 85 5879-5883 (1988) [0893] Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989) [0894] Lefranc M P. et al., Nucleic Acids Research, 27 et al., 209-212, 1999 [0895] Brochet X. Nucl. Acids Res. 36, W503-508 (2008) [0896] Korshunov et al, Clin Sci (Lond). 2012 April; 122(8):361-8. [0897] Sambrook et al, Molecular Cloning: A laboratory Manual, New York: Cold Spring Harbor Laboratory [0898] Press, 1989, Ch. 15 [0899] Kabat, E. A. et al., Sequences of proteins of immunological interest. 5th EditionUS Department of Health and Human Services, NIH publication No. 91-3242, pp 662,680,689 (1991) [0900] WO 2004/010957; Seattle Genetics, Inc. [0901] U.S. Pat. No. 7,659,241; Seattle Genetics, Inc. [0902] Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010) [0903] WO 2011/131746; Genmab A/S [0904] WO/2002/020039; Trion Pharma/Fresenius Biotech [0905] WO9850431; Genetech [0906] WO2011117329; Roche [0907] EP1870459; Amgen [0908] WO2009089004; Amgen [0909] US 2010/00155133; Chugai [0910] WO 2010/129304; Oncomed [0911] WO2007/110205; EMD Serono [0912] WO 2010/015792; Regeneron [0913] WO 11/143545; Pfizer/Rinat [0914] WO 2012/058768: Zymeworks/Merck [0915] WO 2011/028952; Xencor [0916] WO 2009/080254; Roche [0917] WO 2008/003116; F-Star [0918] U.S. Pat. No. 7,262,028; Crucell/Merus [0919] U.S. Pat. No. 7,612,181; Abbott [0920] WO 2010/0226923; Unilever, Sanofi Aventis [0921] U.S. Pat. No. 7,951,918; Biogen Idec [0922] CN 102250246; Changzhou Adam Biotech Inc [0923] WO 2012/025525; Roche [0924] WO 2012/025530; Roche [0925] WO 2008/157379; Macrogenics [0926] WO 2010/080538; Macrogenics [0927] Goodman et al., Goodman and Gilman's The Pharmacological Basis Of Therapeutics, 8th Ed., Macmillan Publishing Co., 1990 [0928] Vitetta, Immunol. Today 14, 252 (1993) [0929] U.S. Pat. No. 5,194,594 [0930] US 2005/0238649 [0931] WO 2013/173391; Concortis Biosystems, Corp. [0932] Junghans et al., in Cancer Chemotherapy and Biotherapy 655-686 (2d edition, Chafner and Longo, eds., Lippincott Raven (1996)) [0933] U.S. Pat. No. 4,681,581 [0934] U.S. Pat. No. 4,735,210 [0935] U.S. Pat. No. 5,101,827 [0936] U.S. Pat. No. 5,102,990 [0937] U.S. Pat. No. 5,648,471 [0938] U.S. Pat. No. 5,697,902 [0939] U.S. Pat. No. 4,766,106 [0940] U.S. Pat. No. 4,179,337 [0941] U.S. Pat. No. 4,495,285 [0942] U.S. Pat. No. 4,609,546 [0943] Hunter et al., Nature 144, 945 (1962), David et al., Biochemistry 13, 1014 (1974) [0944] Pain et al., J. Immunol. Meth. 40, 219 (1981) [0945] Nygren, J. Histochem. and Cytochem. 30, 407 (1982) [0946] Antibody Engineering Handbook, edited by Osamu Kanemitsu, published by Chijin Shokan (1994) [0947] WO 2002/083180; Syngenta BV [0948] WO 2004/043493; Syngenta BV [0949] WO 2007/018431; Syngenta BV [0950] WO 2007/089149; Syngenta BV [0951] WO 2009/017394; Syngenta BV [0952] WO 2010/62171; Syngenta BV [0953] U.S. Pat. No. 6,989,452; Medarex [0954] Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, Pa., 1995 [0955] Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978 [0956] Sykes and Johnston, Nat Biotech 17, 355-59 (1997) [0957] U.S. Pat. No. 6,077,835 [0958] WO 00/70087 [0959] Schakowski et al., Mol Ther 3, 793-800 (2001) [0960] WO 00/46147 [0961] Benvenisty and Reshef, PNAS USA 83, 9551-55 (1986) [0962] Wigler et al., Cell 14, 725 (1978) [0963] Coraro and Pearson, Somatic Cell Genetics 7, 603 (1981) [0964] U.S. Pat. No. 5,589,466 [0965] U.S. Pat. No. 5,973,972 [0966] Van Heeke & Schuster, J Biol Chem 264, 5503-5509 (1989) [0967] Ausubel et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley InterScience New York (1987) [0968] Grant et al., Methods in Enzymol 153, 516-544 (1987) [0969] Lon berg, N. et al., Nature 368, 856, 859 (1994a) [0970] Lonberg, N. Handbook of Experimental Pharmacology 113, 49 101 (1994b) [0971] Lonberg, N. and Huszar, D., Intern. Rev. Immunol. Vol. 13 65 93 (1995) [0972] Harding, F. and Lonberg, N. Ann. N.Y. Acad. Sci 764 536 546 (1995) [0973] Taylor, L. et al., Nucleic Acids Research 20, 6287 6295 (1992) [0974] Chen, J. et al., International Immunology 5, 647 656 (1993) [0975] Tuaillon et al., J. Immunol. 152, 2912 2920 (1994) [0976] Taylor, L. et al., International Immunology 6, 579 591 (1994) [0977] Fishwild, D. et al., Nature Biotechnology 14, 845 851 (1996) [0978] U.S. Pat. No. 5,545,806 [0979] U.S. Pat. No. 5,569,825 [0980] U.S. Pat. No. 5,625,126 [0981] U.S. Pat. No. 5,633,425 [0982] U.S. Pat. No. 5,789,650 [0983] U.S. Pat. No. 5,877,397 [0984] U.S. Pat. No. 5,661,016 [0985] U.S. Pat. No. 5,814,318 [0986] U.S. Pat. No. 5,874,299 [0987] U.S. Pat. No. 5,770,429 [0988] U.S. Pat. No. 5,545,807 [0989] WO 98/024884 [0990] WO 94/025585 [0991] WO 93/001227 [0992] WO 92/022645 [0993] WO 92/003918 [0994] WO 01/009187 [0995] Shieh, Neoplasia 2005 [0996] Koorstra, Cancer Biol Ther 2009 [0997] Hector, Cancer Biol Ther 2010 [0998] Sun, Ann Oncol 2003 [0999] Srivastava (ed.), Radiolabeled Monoclonal Antibodies For Imaging And Therapy (Plenum Press 1988), Chase [1000] Medical Applications of Radioisotopes, in Remington's Pharmaceutical Sciences, 18th Edition, Gennaro et al., (eds.), pp. 624-652 (Mack Publishing Co., 1990) [1001] Brown, Clinical Use of Monoclonal Antibodies, in Biotechnology And Pharmacy 227-49, Pezzuto et al., (eds.) (Chapman & Hall 1993) [1002] U.S. Pat. No. 5,057,313 [1003] U.S. Pat. No. 6,331,175 [1004] U.S. Pat. No. 5,635,483 [1005] U.S. Pat. No. 5,780,588 [1006] Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12): 3580-3584 [1007] U.S. Pat. No. 5,663,149 [1008] Pettit et al., (1998) Antimicrob. Agents and Chemother. 42:2961-2965 [1009] Senter et al., Proceedings of the American Association for Cancer Research. Volume 45, abstract number 623, presented Mar. 28, 2004 [1010] US 2005/0238649 [1011] U.S. Pat. No. 7,498,298; Seattle Genetics, Inc. [1012] U.S. Pat. No. 7,994,135; Seattle Genetics, Inc. [1013] WO 2005/081711; Seattle Genetics, Inc. [1014] Kozak et al. (1999) Gene 234: 187-208 [1015] EP 2 220 131; U3 Pharma [1016] WO 2011/159980; Genentech [1017] Barbas, CF. J Mol Biol. 1993 Apr. 5; 230(3):812-23 [1018] U.S. Pat. No. 7,829,531; Seattle Genetics, Inc. [1019] U.S. Pat. No. 7,851,437; Seattle Genetics, Inc. [1020] WO 2013/173392; Concortis Biosystems, Corp. [1021] WO 2013/173393; Concortis Biosystems, Corp. [1022] Sun et al. (2005) Bioconjugate Chem. 16: 1282-1290 [1023] McDonagh et al., (2006) Protein Eng. Design Sel. 19: 299-307 [1024] Alley et al., (2008) Bioconjugate Chem. 19: 759-765