USE OF ANTI-CD26 ANTIBODY LEVELS AS AUTOIMMUNE AND/OR INFLAMMATORY DISEASE BIOMARKERS
20200393461 · 2020-12-17
Inventors
- José María PEGO REIGOSA (Santiago de Compostela- A Coruna, ES)
- Óscar CORDERO SANTAMARÍA (Santiago de Compostela, ES)
- Rubén VARELA CALVIÑO (Santiago de Compostela, ES)
Cpc classification
G01N33/564
PHYSICS
A61K45/06
HUMAN NECESSITIES
G01N2800/102
PHYSICS
A61K31/00
HUMAN NECESSITIES
G01N2800/101
PHYSICS
International classification
G01N33/564
PHYSICS
Abstract
The present invention relates to the use of anti-CD26 antibodies as markers for the screening, diagnosis or monitoring of human subjects having, or suspected to have an autoimmune and/or inflammatory disease, such as rheumatoid arthritis, in particular those in an early stage of the disease. More specifically, it refers to an invitromethod for the screening of a subject having, or suspected of having an autoimmune and/or inflammatory disease, such as rheumatoid arthritis, comprising the following steps: a) determining the levels of anti-CD26 IgG antibodies in an antibody-containing sample isolated from said subject; b) comparing the levels in said antibody-containing sample with a reference value; wherein an increase of the anti-CD26 IgG antibody levels in the subject sample with regard to said reference value is indicative of disease; and wherein said reference value corresponds to the anti-CD26 IgG antibody mean levels in healthy subjects.
Claims
1. A method for treating an inflammatory rheumatic disease in a subject in need thereof, the method comprising administering a drug selected from the group consisting of: a. DMARDS; b. Anti-TNF alpha agents; c. Anti-CD20 agents; and d. Anti-IL6R agents and/or CTLA4-Fc fusion proteins; to a subject having been diagnosed as having an inflammatory rheumatic disease by a diagnostic method comprising the following steps: a) determining the levels of anti-CD26 IgG antibodies in an antibody-containing sample isolated from said subject; b) comparing the levels in said antibody-containing sample with a reference value; wherein an increase of the anti-CD26 IgG antibody levels in the subject sample with regard to said reference value is indicative of disease; and wherein said reference value corresponds to the anti-CD26 IgG antibody mean levels in healthy subjects.
2-6. (canceled)
7. The method according to claim 1, wherein said inflammatory rheumatic disease is selected from the group consisting of rheumatoid arthritis, lupus erythematosus, Sjgren syndrome, juvenile rheumatoid arthritis, psoriatic arthritis and spondyloarthropathy.
8. The method according to claim 1, wherein said inflammatory rheumatic disease is rheumatoid arthritis.
9. The method according to claim 1, wherein the diagnostic method further comprises: a) determining the anti-CD26 antibody levels of the IgM and/or IgA isotype in said antibody-containing sample; b) comparing the anti-CD26 IgM and/or IgA antibody levels in said antibody-containing sample with a reference value; wherein an increase of the anti-CD26 IgG antibody levels value and of the anti-CD26 IgM and/or IgA antibody levels in the subject sample with regard to the corresponding reference value is indicative of disease; wherein the respective reference value corresponds to the mean levels in healthy subjects.
10. The method according to claim 1, wherein the determined anti-CD26 antibody levels are selected from the group consisting of: i. the anti-CD26 IgG antibody levels and the anti-CD26 IgM antibody levels; ii. the anti-CD26 IgG antibody levels and the anti-CD26 IgA antibody levels; and iii. the anti-CD26 IgG antibody levels, the anti-CD26 IgM antibody levels, and anti-CD26 IgA antibody levels.
11. The method according to claim 1, wherein the increase of said anti-CD26 antibody levels with respect to said reference value is of at least 1.3.
12. The method according to claim 1, wherein said subject is a human subject.
13. The method according to claim 1, wherein said antibody-containing sample is whole blood, serum or plasma.
14. The method according to claim 1, wherein the antibody levels are determined using an ELISA assay, a cell-ELISA assay or any multiplex version thereof.
15. The method according to claim 1, wherein said anti-CD26 antibodies are antibodies specific against recombinant soluble CD26.
16. The method according to claim 1, wherein said subject has not previously received or is not undergoing any biological treatment against said inflammatory rheumatic disease.
17. The method according to claim 1, wherein said subject has not previously received or is not undergoing any treatment against said inflammatory rheumatic disease.
18. The method according to claim 1, wherein said subject has previously received or is undergoing a treatment against said inflammatory rheumatic disease.
19. The method according to claim 1, wherein the diagnostic method further comprises determining other biomarkers associated with said inflammatory rheumatic disease.
20. The method according to claim 1, wherein the diagnostic method further comprises determining clinical parameters, wherein said clinical parameters are selected from the group consisting of morning stiffness, joint involvement, symmetric arthritis, rheumatoid nodules and radiographic changes.
21-31. (canceled)
32. The method of claim 11, wherein the increase of said anti-CD26 antibody levels with respect to said reference value is of at least 1.5.
33. The method of claim 13, wherein said antibody-containing sample is serum.
34. The method of claim 16, wherein said biological treatment is selected from the group consisting of: a. Anti-TNF alpha agents; b. Anti-CD20 agents; and c. Anti-IL6R agents and/or CTLA4-Fc fusion proteins.
35. The method of claim 18, wherein said treatment is selected from the group consisting of: a. DMARDS; b. Anti-TNF alpha agents; c. Anti-CD20 agents; and d. Anti-IL6R agents and/or CTLA4-Fc fusion proteins.
36. The method of claim 19, wherein said biomarkers are selected from the group consisting of anti-citrullinated protein antibodies (ACPA), rheumatoid factor antibodies, anti-mannose binding lectin (MBL) antibodies, erythrocyte sedimentation rate (ESR), C-reactive protein (CRP), platelet count, hemoglobin levels and hematocrit.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0067] The term screening is understood herein as the examination or testing of a group of asymptomatic individuals pertaining to the general population, or a group of individuals suspected of having a disease, or a group of individuals at risk of developing a disease, with the objective of discriminating healthy individuals from those who have or are suspected of having a disease.
[0068] The term subject having a disease as used herein refers to those subjects diagnosed for a given disease. The term diagnosis as used herein refers to determining the presence or absence of a disease in a subject suspected of having the disease. It may refer both to the process of attempting to determine and/or identify a possible disease in a subject, i.e. the diagnostic procedure, and to the opinion reached by this process, i.e. the diagnostic opinion. In particular, the diagnosis to determine autoimmune and/or inflammatory disease (e.g. rheumatoid arthritis) in a subject, relates to the capacity to identify and classify patients having said autoimmune and/or inflammatory disease. A diagnostic test could be used to suggest or rule out the disease.
[0069] The term subject suspected of having a disease as used herein refers to a subject that presents one or more signs or symptoms indicative of said disease. A subject suspected of having a disease may also have one or more risk factors (i.e., a subject suspected of developing or at risk of developing a disease). It further encompasses an individual who has received a preliminary diagnosis but for whom a confirmatory test has not been done. Furthermore, it includes those individuals in remission. In a preferred embodiment, a subject suspected of having a disease does not encompass a subject at risk of developing a disease or a subject in remission.
[0070] The term subject as used herein refers to a mammalian subject. Preferably, it is selected from a human, companion animal, non-domestic livestock or zoo animal. For example, the subject may be selected from a human, dog, cat, cow, pig, sheep, horse, bear, and so on. In a preferred embodiment, said mammalian subject is a human subject.
[0071] The term inflammatory rheumatic disease as used herein refers to a disease of the locomotive apparatus and/or of the connective tissues in which inflammatory mechanisms play a relevant role. A rheumatic disease may affect the joints, bones, cartilage, tendons, ligaments and muscles. This group of diseases include as illustrative non-limiting examples rheumatoid arthritis, juvenile rheumatoid arthritis, psoriatic arthritis, spondyloarthropathy (e.g. ankylosing spondylitis), lupus erythematosus, Sjgren syndrome, myositis, and scleroderma. A person skilled in the art will understand that this term will not include non-inflammatory rheumatic diseases such as degenerative diseases (e.g. arthrosis) or metabolic diseases (e.g. osteoporosis).
[0072] The term early stage of progression for an inflammatory rheumatic disease may refer to a stage of disease progression wherein there are no irreversible damages (e.g. no irreversible joint damages).
[0073] The term early rheumatoid arthritis, early RA or eRA as used herein may refer to a subject diagnosed with rheumatoid arthritis, typically with symptom duration of 6 months, who has not received any first line therapy for the treatment of RA (i.e., corticosteroid or DMARD therapy) and whose conventional radiographs of hands and feet showed no structural damage.
[0074] The term very early rheumatoid arthritis or veRA as used herein may refer to a subject diagnosed with early RA with symptom duration of 3 months. More details on the classification of RA patients are provided in the ACR/EULAR classification criteria (Ann Rheum Dis 2010; 69:1580-1588).
[0075] The term disease monitoring as used herein refers to determining the evolution of the disease, for example determining whether there is a remission of the disease, i.e., a reduction of clinical signs and/or symptoms characterizing the disease; or on the contrary whether there is disease progression or a relapse.
[0076] The term response to a treatment as used herein refers to the degree to which a treatment accomplishes the desired or projected outcomes, for instance the ability of a drug to achieve the desired prophylactic and/or therapeutic effect.
[0077] The term treatment encompasses both a prophylactic or therapeutic treatment. The term therapeutic treatment or therapy as used herein refers to bringing a body from a pathological state or disease back to its normal, healthy state. The term prophylactic treatment as used herein refers to preventing a pathological state.
[0078] The term antibody-containing sample or antibody-containing biological sample as used herein includes biological fluids, such as whole blood, serum, plasma, synovial fluid, cerebrospinal fluid, bronchial lavage, ascites fluid, bone marrow aspirate, pleural effusion, urine, as well as any tissue or any other bodily constituent that could contain antibodies or cells expressing thereof. Cells that express and secrete antibodies (B cells) are present in, and if appropriate may be isolated from, different tissues, organs and biological fluids from individuals. B cells may be found in the central or primary lymphoid organs that generate lymphocytes from immature progenitor cells, such as the thymus and the bone marrow. Alternatively, B cells may be found in secondary lymphoid tissue that provides the environment for the antigen to interact with the lymphocytes, such as the lymph nodes, the lymphoid follicles in tonsils, Peyer's patches, spleen, adenoids, skin, etc. that are associated with the mucosa-associated lymphoid tissue. It is noted that mononuclear cells in the spleen contain a higher percentage of IgG secreting cells. B cells may be found in from biological fluids such as blood, cerebrospinal, synovial or pleural fluids. Alternatively, lymphocytes may also be found in sites of chronic infection and/or inflammation.
[0079] The term reference value as used herein refers to a value determined in one or more samples, generally mean values of preferably a statistically significant number of samples, obtained from a reference or control population. Determination of the reference value is carried out under similar or identical conditions as the biological sample of the tested subject. Typically, said reference samples are from the same tissue or cell type and have undergone the same procedures for their obtaining and preservation. Alternatively; said reference values are pre-established values, generally mean values, in the control or reference population.
[0080] The term kit or testing kit denotes combinations of reagents and adjuvants required for an analysis. Although a test kit consists in most cases of several units, one-piece analysis elements are also available, which must likewise be regarded as testing kits.
[0081] The term partially identical as used herein refers to a sequence which is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to a reference sequence. In some embodiments, the partially identical sequence may be substantially identical to a reference sequence, that is at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to said reference sequence. In one embodiment, the partially identical sequence is 100% identical to a reference sequence.
[0082] The term identity as used herein refers to an exact nucleotide-to-nucleotide or amino acid to amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity. The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequence and multiplied by 100. Suitable programs for calculating the percent identity or similarity between sequences are well known in the art, such as the NCBI BLAST program, used for example with default parameters (http://www.ncbi.nlm.gov/cgi-bin/BLAST).
[0083] The term Receiver Operating Characteristic (ROC) curves as used herein refers to a graphical plot that illustrates the performance of a binary classifier system as its discrimination threshold is varied. The curve is created by plotting the true positive rate against the false positive rate at various threshold settings. The true positive rate is also known as sensitivity. The false positive rate is calculated as 1specificity. The ROC curve is thus a way of graphically displaying the true positive rate versus the false positive rate (sensitivity vs (1-specificity)) across a range of cut-offs and of selecting the optimal cut-off for clinical use. Accuracy expressed as the area under the ROC curve (AUC) provides a useful parameter for comparing test performance. An AUC approaching 1 indicates that the test is highly sensitive as well as highly specific whereas an AUC approaching 0.5 indicates that the test is neither sensitive nor specific. In general, a test is considered to be a suitable discriminator if the AUC is from 0.6 to 0.75, to have high discrimination capacity if the AUC is from 0.75 to 0.9 and to be an excellent discriminator if the AUC is from 0.9 to 1. For further details see for instance, Zweig M H and Campbell G, Clinical Chemistry 1993; 39:561-577 or Greiner et al. Preventive Veterinary Medicine 2000; 45:23-41.
DETAILED DESCRIPTION
[0084] An In Vitro Method for the Screening of an Autoimmune and/or Inflammatory Disease in a Subject and Methods Related Thereof
[0085] In a first aspect, the present invention relates to an in vitro method for the screening of a subject having, or suspected of having an autoimmune and/or inflammatory disease comprising the following steps: [0086] a) determining the levels of anti-CD26 IgG and/or anti-CD26 IgM antibodies in an antibody-containing sample isolated from said subject; [0087] b) comparing the levels in said antibody-containing sample with a reference value.
[0088] In a related aspect, the invention refers to an in vitro method for obtaining useful data for the diagnosis of an autoimmune and/or inflammatory disease in a subject, said method comprising the steps a) and b) of the first aspect.
[0089] In a further related aspect, the invention refers to an in vitro method for the diagnosis of an autoimmune and/or inflammatory disease in a subject, said method comprising the steps a) and b) of the first aspect.
[0090] In an additional related aspect, the invention refers to an in vitro method for classifying subjects as i) healthy subjects or as ii) subjects having, or suspected of having an autoimmune and/or inflammatory disease, said method comprising the steps a) and b) of the first aspect.
[0091] The first aspect and the above-described related aspects may herein be collectively referred as first aspect of the invention.
[0092] The term inflammatory disease is understood to be any disease where there is an excessive or altered inflammatory response that leads to inflammatory symptoms. Said inflammatory diseases include, without limitation, Addison's disease, acne vulgaris, alopecia areata, amyloidosis, ulcerations, aphthous stomatitis, arteriosclerosis, arthritis, osteoarthritis, rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, spondyloarthropathy (e.g. ankylosing spondylitis), bronchial asthma, Bechet's disease, Boeck's disease, intestinal inflammatory disease, Crohn's disease, choroiditis, ulcerative colitis, celiac's disease, cryoglobulinemia, macular degeneration, dermatitis, dermatitis herpetiformis, dermatomyositis, insulin dependent diabetes, juvenile diabetes, inflammatory demyelinating disease, Dupuytren contracture, encephalomyelitis, allergic encephalomyelitis, endophthalmia, allergic enteritis, autoimmune enteropathy syndrome, erythema nodosum leprosum, idiopathic facial paralysis, chronic fatigue syndrome, rheumatic fever, cystic fibrosis, gingivitis, glomerulonephritis, Goodpasture syndrome, Graves syndrome, Hashimoto's disease, chronic hepatitis, histiocytosis, regional ileitis, iritis, disseminated lupus erythematous, systemic lupus erythematous, cutaneous lupus erythematous, lymphogranuloma, infectious mononucleosis, miastenia gravis, transverse myelitis, primary idiopathic myxedema, nephrosis, obesity, sympathetic ophthalmia, granulomatous orchitis, pancreatitis, panniculitis, pemphigus vulgaris, periodontitis, polyarteritis nodosa, chronic polyarthritis, polymyositis, acute polyradiculitis, psoriasis, chronic obstructive pulmonary disease, purpura, gangrenous pioderma, Reiter's syndrome, diabetic retinopathy, rosacea, sarcoidosis, ataxic sclerosis, progressive systemic sclerosis, scleritis, sclerodermia, multiple sclerosis, disseminated sclerosis, acute anterior uveitis, vitiligo, Whipple's disease, diseases associated to AIDS, severe combined immunodeficiency and Epstein Barr's virus such as Sjogren's syndrome, osteoarticular tuberculosis and parasitic diseases such as leishmaniasis.
[0093] The term autoimmune disease as used herein refers to a non-malignant disease or disorder arising from and directed against an individual's own tissues. The autoimmune diseases herein specifically exclude malignant or cancerous diseases or conditions, especially excluding B cell lymphoma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), Hairy cell leukemia and chronic myeloblastic leukemia. Examples of autoimmune diseases or disorders include, but are not limited to, inflammatory responses such as inflammatory skin diseases including psoriasis and dermatitis (e.g. atopic dermatitis); systemic scleroderma and sclerosis; responses associated with inflammatory bowel disease (such as Crohn's disease and ulcerative colitis); respiratory distress syndrome (including adult respiratory distress syndrome; ARDS); dermatitis; meningitis; encephalitis; uveitis; colitis; glomerulonephritis; allergic conditions such as eczema and asthma and other conditions involving infiltration of T cells and chronic inflammatory responses; atherosclerosis; leukocyte adhesion deficiency; rheumatoid arthritis; systemic lupus erythematosus (SLE); diabetes mellitus (e.g. Type I diabetes mellitus or insulin dependent diabetes mellitis); multiple sclerosis; Reynaud's syndrome; autoimmune thyroiditis; allergic encephalomyelitis; Sjorgen's syndrome; juvenile onset diabetes; and immune responses associated with acute and delayed hypersensitivity mediated by cytokines and T-lymphocytes typically found in tuberculosis, sarcoidosis, polymyositis, granulomatosis and vasculitis; pernicious anemia (Addison's disease); diseases involving leukocyte diapedesis; central nervous system (CNS) inflammatory disorder; multiple organ injury syndrome; hemolytic anemia (including, but not limited to cryoglobinemia or Coombs positive anemia); myasthenia gravis; antigen-antibody complex mediated diseases; anti-glomerular basement membrane disease; antiphospholipid syndrome; allergic neuritis; Graves' disease; Lambert-Eaton myasthenic syndrome; pemphigoid bullous; pemphigus; autoimmune polyendocrinopathies; Reiter's disease; stiff-man syndrome; Behcet disease; giant cell arteritis; immune complex nephritis; IgA nephropathy; IgM polyneuropathies; immune thrombocytopenic purpura (ITP) or autoimmune thrombocytopenia etc.
[0094] In a particular embodiment, said autoimmune and/or inflammatory disease is an inflammatory rheumatic disease. Preferably, said inflammatory rheumatic disease is selected from the group consisting of rheumatoid arthritis, lupus erythematosus, Sjgren syndrome, juvenile rheumatoid arthritis, psoriatic arthritis and spondyloarthropathy (e.g. ankylosing spondylitis).
[0095] Elevated levels of TNF are found in the synovial fluid of patients with rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis and spondyloarthropathy (e.g. ankylosing spondylitis) and play an important role in both the pathologic inflammation and the joint destruction that are hallmarks of these diseases. Accordingly, in a preferred embodiment, said inflammatory rheumatic disease is selected from rheumatoid arthritis, juvenile rheumatoid arthritis, psoriatic arthritis and spondyloarthropathy (e.g. ankylosing spondylitis).
[0096] In another embodiment, said autoimmune and/or inflammatory disease is selected from the group consisting of rheumatoid arthritis, lupus erythematosus and Sjgren syndrome.
[0097] In a further preferred embodiment, said autoimmune and/or inflammatory disease is rheumatoid arthritis. In a particular embodiment, the method of diagnosis of the invention is a method for the differential diagnosis between rheumatoid arthritis and other diseases which present joint inflammation. For instance, it may be used for the differential between rheumatoid arthritis and one or more diseases selected from the group consisting of rheumatoid arthritis, lupus erythematosus, Sjgren syndrome, juvenile rheumatoid arthritis, psoriatic arthritis and spondyloarthropathy (e.g. ankylosing spondylitis).
[0098] Correlations of anti-CD26 levels with disease activity parameters, notably with tenderness of the joints, have been observed by the inventors (Example 6). Notably, according to Example 6.1 anti-CD26 levels of the three isotypes appear to correlate negatively with tender joints count (TJC) when considering the whole cohort. Also, the CD26 antigen used in the performed ELISA tests is not citrullinated suggesting that the detected auto-antibodies would recognize a non-citrullinated sCD26 form. Taken together this data may suggest that anti-CD26 antibodies appear in an early stage of the RA pathogenesis. Accordingly, in a preferred embodiment, said autoimmune and/or inflammatory disease is in an early, preferably in a very early, stage of progression.
[0099] Step (a) of the method under the first aspect of the invention requires the determination of anti-CD26 antibody levels in an antibody-containing sample isolated from a subject.
[0100] The term CD26 as used herein refers to human CD26 (UniProtKBP27487), also known as dipeptidyl peptidase IV (DPP-IV). Its enzymatic activity is characterized by the release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, from a polypeptide, preferentially when Yaa is Pro, provided Zaa is neither Pro nor hydroxyproline.
[0101] The term CD26 encompasses, the 240 kDa homodimeric type II membrane glycoprotein composed of two 120 kDa subunits. (Mentlein, R., International Review of Cytology, 235: 165-213, 2004). Each of the homodimers of the membrane-bound form are characterized by a sequence consisting of positions 1 to 766 of SEQ ID NO:1 and the soluble form or sCD26 is characterized by a sequence consisting of positions 39 to 766 of SEQ ID NO:1, as shown below in Table 1 below.
TABLE-US-00001 Positions of SEQ UNIPROT SEQ ID ID NO: 1 Length Description identifier NO 1-766 766 Dipeptidyl PRO_0000027213 SEQ ID peptidase 4 NO: 1 membrane form 39-766 728 Dipeptidyl PRO_0000027214 SEQ ID peptidase 4 NO: 2 soluble form
[0102] SEQ ID NO: 1 (PRO_0000027213) has the following sequence:
TABLE-US-00002 MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL60 RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY120 VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL180 PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF240 YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL300 CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS360 EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN420 EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY480 TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY540 PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT600 FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE660 YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS720 KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP766
[0103] The term CD26 may also encompass sequences partially identical, preferably substantially identical to SEQ ID NO:1 or SEQ ID NO:2. These are collectively referred as CD26 variants and may be obtained by modifying SEQ ID NO:1 or SEQ ID NO:2 by substitution, deletion and/or addition.
[0104] Deletion variants of CD26 and antigenic fragments of CD26 are characterized by containing at least one antigenic region or epitope. Illustrative non-limiting examples of CD26 epitopes are those defined by the binding of known anti-CD26 mAb which have been previously described, such as 4G8, 11H9, 1F7, 10F8A, 12E3B, 14D10, Tal, 5F8, 2F9, TA5.9, 18H3A, 16D4B, 9C11 (see anti-CD26 mAbs and their respective binding to CD26 deletion mutants in
[0105] In one embodiment, a CD26 variant may have one or more additional amino acid residues.
[0106] Said additional amino acid residue(s) may be any amino acid, which may be either an L- and/or a D-amino acid, naturally occurring and otherwise. Preferably the amino acid is any naturally occurring amino acid such as alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, methionine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan or tyrosine.
[0107] However, the amino acid residue(s) may also be (a) modified or unusual amino acid(s). Examples of those are 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine, 2-aminobutyric acid, 4-aminobutyric acid, 6-aminocaproic acid, 2-aminoheptanoic acid, 2-aminoisobutyric acid, 3-aminoisobutyric acid, 2-aminopimelic acid, 2,4-diaminobutyric acid, desmosine, 2,2-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N-ethylasparagine, hydroxylysine, allo-hydroxylysine, 3-hydroxyproloine, 4-hydroxyproloine, isodesmosine, allo-isoleucine, N-methylglycine, N-methylisoleucine, 6-N-Methyllysine, N-methylvaline, norvaline, norleucine or ornithine.
[0108] Additionally, the amino acid(s) may be subject to modifications such as posttranslational modifications. Examples of modifications include acetylation, amidation, blocking, formylation, -carboxyglutamic acid hydroxylation, glycosilation, methylation, phosphorylation, sulfatation and citrullination. Preferably, CD26 is not citrullinated.
[0109] If more than one additional amino acid residue is present in the polypeptide, the amino acid residues may be the same or different from one another. The CD26 polypeptide may be flanked by the amino acid residue(s) C-terminally, N-terminally, or C- and N-terminally.
[0110] In a particular embodiment of the invention said variant of CD26 is a variant having at least 70%, at least 80%, at least 90%, at least 95%, at least 99% identity to SEQ ID NO: 1 or SEQ ID NO: 2 which is derived by conservative substitutions. Conservative substitutions are those that take place within a family of amino acids that are related in their side chains and chemical properties and are well known to a person skilled in the art. Examples of such families are amino acids with basic side chains, with acidic side chains, with non-polar aliphatic side chains, with non-polar aromatic side chains, with uncharged polar side chains, with small side chains, with large side chains etc. In one embodiment, one conservative substitution is included in the polypeptide. In another embodiment, two conservative substitutions or less are included in the polypeptide. In a further embodiment, three conservative substitutions or less are included in the polypeptide.
[0111] CD26 may be obtained by recombinant protein techniques or by purification from human serum. Standard recombinant techniques in prokaryotic or eukaryotic host cells can be used to produce CD26. Suitable host cells include bacteria (e.g. E. coli), yeast, insect, or mammalian cells. A number of eukaryotic expression systems are available for expression of secreted proteins and membrane-bound proteins including those that contain unique post-translational modifications. The most common eukaryotic expression platforms currently include yeast (e.g., Pichia pastoris and Saccharomyces cerevisiae), insect cells (Spodoptera frugiperda or Trichoplusia ni), and mammalian cell systems (including a variety of transformed and/or genetically modified cell lines). Mammalian cell systems include but are not limited to simian, human, dog and rodent cells. Examples of human cells are PER.C6 cells (WO01/38362), MRC-5 (ATCC CCL-171), WI-38 (ATCC CCL-75), HEK-293 cells (ATCC CRL-1573), HeLa cells (ATCC CCL2), and fetal rhesus lung cells (ATCC CL-160). Examples of non-human primate cells are Vero cells (ATCC CCL81), COS-1 cells (ATCC CRL-1650) or COS-7 cells (ATCC CRL-1651). Examples of dog cells are MDCK cells (ATCC CCL-34). Examples of rodent cells are hamster cells, such as BHK21-F, HKCC cells, or CHO cells. Any protein compatible expression system may be used to produce CD26. Suitable expression systems include transgenic animals described in Gene Expression Systems, Academic Press, eds. Fernandez et al., 1999. Moreover, any expression vectors known in the art can be used. Enzymes can be used to generate less than full-length proteins by enzymatic proteolysis of full-length or partial proteins.
[0112] Synthetic chemistry methods, such as solid-phase peptide synthesis, can also be used to synthesize CD26. In another particular embodiment, CD26 has been synthesized by means of any technique known in the art of peptide synthesis.
[0113] CD26 may be purified by means of any technique known in the art of protein purification. Exemplary techniques include ion-exchange chromatography, hydrophobic interaction chromatography, and immunoaffinity methods.
[0114] In a particular embodiment, CD26 is the soluble form of CD26 (sCD26), including variants thereof. In a preferred embodiment, sCD26 has been obtained by recombinant means and purified from a suitable host cell as described above. In a more preferred embodiment, said recombinant sCD26 has been purified from mouse myeloma cell line NS0, such as the commercially available sCD26 from RnD Systems, USA (1180-SE-010). In another more preferred embodiment, said recombinant sCD26 has been purified from baculovirus infected Sf9 cells, such as the commercially available sCD26 from Sigma-Aldrich, USA (D4943).
[0115] The methods of the present invention may be applied to samples from individuals of either sex, i.e. men or women, and at any age.
[0116] In some embodiments, said subject has not previously received or is not undergoing any biological treatment against said autoimmune and/or inflammatory disease, preferably has not previously received or is not undergoing any treatment against said autoimmune and/or inflammatory disease.
[0117] In other embodiments, said subject has previously received or is undergoing a treatment against said autoimmune and/or inflammatory disease, preferably, wherein said treatment is selected from the group consisting of
[0118] i. DMARDS;
[0119] ii. Anti-TNF alpha agents;
[0120] iii. Anti-CD20 agents; and
[0121] iv. Anti-IL6R agents and/or CTLA4-Fc fusion proteins.
[0122] The term antibody-containing sample has been defined above. These types of samples are routinely used in the clinical practice and a person skilled in the art will know how to identify the most appropriate means for their obtaining and preservation. Once a sample has been obtained, it may be used fresh, it may be frozen or preserved using appropriate means (e.g., as a formalin-fixed, paraffin-embedded tissue sample). When quantification is carried out by immunohistochemistry (IHC) analysis, typically thin sections of the biological sample immobilised on coated slides are used. These sections, when derived from a paraffin-embedded tissue samples, are deparaffinised and preferably treated so as to retrieve the protein to be detected. The detection can be carried out in individual samples or in tissue microarrays.
[0123] Preferably, this antibody-containing sample is whole blood, serum or plasma, more preferably is serum.
[0124] The quantification of antibody levels under step a) of the first aspect of the invention may be expressed in terms of antibody concentration and/or antibody titer. The term antibody titer and antibody concentration may be used herein interchangeably.
[0125] The term antibody concentration as used herein refers to the total amount of antibody (protein) in solution without regard to function. Antibody concentration can be estimated using either a general protein assay or an immunoglobulin-specific method.
[0126] The term antibody titer as used herein refers to the functional dilution (or working concentration) of an antibody sample that is necessary to achieve a minimum level of specific detection in a given assay method. The exact minimum acceptable value is established by the researcher, but it is usually defined by reference to a statistically significant signal-to-noise ratio. Antibody titer is generally considered an assay-specific measurement.
[0127] Preferably, the determination of antibody levels under step a) of the first aspect of the invention is performed by an immunoglobulin-specific method. Various types of immunoassays are known to one skilled in the art for the quantitation of proteins of interest. These methods are based on the use of affinity reagents, which may be any antibody or ligand specifically binding to the target protein, which is preferably labeled. For example, western blotting or immunoblotting techniques allow comparison of relative abundance of proteins separated by an electrophoretic gel (e.g., native proteins by 3-D structure or denatured proteins by the length of the polypeptide). Immunoblotting techniques use antibodies (or other specific ligands in related techniques) to identify target proteins among a number of unrelated protein species. They involve identification of protein target via antigen-antibody (or protein-ligand) specific reactions. Proteins are typically separated by electrophoresis and transferred onto a sheet of polymeric material (generally nitrocellulose, nylon, or polyvinylidene difluoride). Dot and slot blots are simplified procedures in which protein samples are not separated by electrophoresis but immobilized directly onto a membrane.
[0128] In some embodiments of the invention, immunoglobulin quantification may be performed by quantifying the corresponding immunoglobulin expressing cells (e.g. B cells producing anti-CD26 antibodies of a given isotype). This may be possible for instance by immunohistochemistry assays, where proteins are detected directly in cells of a tissue. The role of B cells and autoantibodies in tissue destructive events of autoimmune diseases is emerging, and thereby increasing interest in identifying the presence and location of autoreactive B cells and autoantibody secreting plasma cells. For visualization and analysis of the autoreactive B cells, the antigen of interest is selected and produced and purified from native or recombinant sources. Appropriate labelling (e.g. biotinylation) of the purified antigen and subsequent use in immunohistochemistry with sections from tissue under analysis permits detection of the autoreactive B cells and plasma cells. Double staining with cell-specific markers or for the presence of intracellular Ig allows characterization of the cell or determination of Ig isotype of the autoantibody produced by the individual autoreactive B-cell. With this technique, identification as well as quantification of autoreactive cells within tissues may be performed; it is also possible to analyze the spatial relation to residual cells or other infiltrating cells of the target organ. For illustrative purposes, a non-limiting example on how this may be carried out is described in Wharen-Herlenius and Salomonsson (Methods Mol Med. 200, 136:19-24).
[0129] Quantification of immunoglobulin expressing cells may also be possible in any kind of antibody-containing biological fluids using techniques well known in the art such as flow cytometry and fluorescence-activated cell sorting (FACS). A specific selection and quantification of antibody-secreting cells can be performed, using one of the many methods described in the literature, usually on the basis of the expression of specific antibody isotypes and/or cell surface markers on their surface. In particular, various technologies for the purification of antibody-secreting cells from human samples make use of different means and conditions for positive or negative selection. These cells are more easily and efficiently selected by physically separating those expressing cell surface markers specific for cells that express and secrete antibodies (e.g. B cells). Specific protocols can be found in the literature (see Callard R and Kotowicz K Human B-cell responses to cytokines in Cytokine Cell Biology: A practical Approach. Balkwill F. (ed.) Oxford University Press, 2000, pg. 17-31).
[0130] Traditionally, quantification of proteins in solution has been carried out by immunoassays on a solid support. Said immunoassay may be for example an enzyme-linked immunosorbent assay (ELISA), a fluorescent immunosorbent assay (FIA), a chemiluminescence immunoassay (CIA), or a radioimmunoassay (RIA), an enzyme multiplied immunoassay, a solid phase radioimmunoassay (SPROA), a fluorescence polarization (FP) assay, a fluorescence resonance energy transfer (FRET) assay, a time-resolved fluorescence resonance energy transfer (TR-FRET) assay, a surface plasmon resonance (SPR) assay. Multiplex and any next generation versions of any of the above, such as bead-based flow-cytometry immunoassays (e.g., based on the Luminex xMAP technology) are specifically encompassed. In a particular embodiment, said immunoassay is an ELISA assay, a cell-ELISA or any multiplex version thereof.
[0131] Other methods that can be used for quantification of proteins are techniques based on mass spectrometry (MS) such as liquid chromatography coupled to mass spectrometry (LC/MS), described for example in US2010/0173786, or tandem LC-MS/MS (WO2012/155019, US2011/0039287, M. Rauh, J Chromatogr B Analyt Technol Biomed Life Sci 2012 Feb. 1, 883-884. 59-67) and the use of arrays of peptides, proteins or antibodies and multiplex versions of the above techniques, as well as the next generation of such techniques and combinations thereof.
[0132] In a particular embodiment, anti-sCD26 antibody levels present in an antibody-containing suspension sample are determined by an immunoassay wherein sCD26 has been coated on a solid phase support. In another embodiment, anti-CD26 antibody levels present in an antibody-containing suspension sample are determined by an immunoassay wherein a cell expressing CD26 is found on a solid phase support (e.g. cell-ELISA). Below it is generally described a method for the determination of anti-sCD26 antibodies of a selected isotype.
[0133] sCD26, or any antigenic fragments thereof, is bound to the solid support. It can be adsorbed or chemically coupled to a solid phase support. Any means known in the art for immobilizing a protein or peptide to a solid support can be used. sCD26 can be either covalently or non-covalently bound to the solid phase support by techniques such as covalent bonding via an amide or ester linkage or adsorption. It can also be bound using binding pairs such as biotin and avidin or antibody and antigen. After sCD26 is affixed to the solid phase, the solid phase support can be incubated with a blocking solution (containing a blocking protein such as bovine serum albumin) to reduce non-specific adsorption of antibodies in a test sample to the support surface.
[0134] Various solid phase supports can be used, including but not limited to glass, polystyrene, polypropylene, nitrocellulose, dextran or other materials. Suitable forms of the solid phase supports include beads, microparticles, tubes, fabrics or plates formed from or coated with these materials. In a preferred embodiment the solid support comprises microtiter wells, such as a 96-well microtiter plate.
[0135] A detection antibody is used to assess the anti-sCD26 antibody bound to the solid phase support. The detection antibody used for this purpose can be isotype-specific, e.g. IgA, IgD, IgE, IgG, or IgM. The isotype-specific detection antibody can be labeled and detected. Antibody sub-isotypes may also be determined.
[0136] The detection antibody may be labeled. A label can be any composition which is detectable. Any analytical means known in the art can be used for determining or detecting the detection antibody. These means include the use of spectroscopy, chemistry, photochemistry, biochemistry, immunochemistry, or optics. The label can be, for example, an enzyme (e.g., horseradish peroxidase (HRP), alkaline phosphatase, beta-galactosidase, and others commonly used in an ELISA), a radiolabel (e.g., .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), a chemiluminescent compound (e.g. luciferin, and 2,3-dihydrophthalazinediones, luminol, etc.), a fluorescent dye (e.g., fluorescein isothiocyanate, Texas red, rhodamine, etc.), or any other dye known in the art.
[0137] The label may be coupled directly or indirectly (e.g., via binding pairs such as biotin and avidin) to the detection antibody according to methods well known in the art. As indicated above, a wide variety of labels may be used. The choice of label may depend on sensitivity required, ease of conjugation with the compound, stability requirements, available instrumentation, or disposal provisions.
[0138] Detection antibodies can be detected or quantified by any suitable method known in the art. A label on an antibody can be detected by a gamma counter if the label is a radioactive gamma emitter, or by a fluorimeter, if the label is a fluorescent material. In a preferred embodiment, the detection antibody is detected using a HRP-conjugated species-specific immunoglobulin. Any known substrate of HRP can be used. Non-limiting examples are ABTS (2,2-Azinobis [3-ethylbenzothiazoline-6-sulfonic acid]-diammonium salt), OPD (o-phenylenediamine dihydrochloride) and TMB (3,3,5,5-tetramethylbenzidine). Each of these substrates yields a reaction product that can be detected optically with a maximum absorbance at 410 nm and 650 nm, at 492 nm and at 450 nm, respectively.
[0139] Results of the assay may be qualitative or quantitative. The amount of label associated with the support can be compared with positive and negative controls in order to determine the presence of anti-sCD26 antibodies. The controls are typically run concomitantly with the sample to be tested. A positive control can be a serum containing antibodies that are immunoreactive with sCD26. A negative control can be a serum that does not contain antibodies that are immunoreactive with the sCD26. For quantitation, a standard curve using known quantities of anti-sCD26 antibody can be generated and/or used.
[0140] Antibodies for use as positive controls may be produced using all, or fragments of, the amino acid sequence of sCD26. Antibody as used herein includes intact immunoglobulin molecules, as well as fragments thereof, such as Fab, F(ab).sub.2, and Fv, which are capable of binding an epitope of the target protein (e.g. sCD26). Any type of antibody known in the art can be generated to bind specifically to an epitope of sCD26. Monoclonal or polyclonal antibodies can be made as is well known in the art.
[0141] Any technique for purifying antibodies available in the art can be used. For example, antibodies can be purified by known methods such as affinity separation using protein A, high pressure liquid chromatography on reverse phase alkylated silica gel, or gel filtration. Antibodies can also be passed over a solid phase to which sCD26 is bound. The anti-sCD26 antibodies will bind to the sCD26 bound to the solid support and the contaminants can be washed away. The bound antibodies can be eluted, for example, with a buffer having a high salt concentration.
[0142] The particular parameters employed in the assay for anti-CD26 antibody levels determination can vary widely depending on various factors such as the concentration of antibody in the sample, the nature of the sample, the type of immunoassay employed and the like. Optimal conditions can be readily established by those of ordinary skill in the art. Typical assay conditions include a temperature range of about 4 C. to about 45 C. and a pH value range of about 5 to 9. Incubation times can also vary widely depending upon the nature of the assay, and generally range from about 0.1 minute to about 24 hours. A broad variety of buffers, for example TRIS-buffered saline, may be employed, and other reagents such as salt to enhance ionic strength, proteins such as serum albumin, stabilizers, and non-ionic detergents may also be included. Exemplary conditions for total immunoglobulins and anti-CD26 autoantibodies of the IgG, IgM and IgA isotypes are given in Example 1.
[0143] The Ratio Between Anti-CD26 IgG Antibody Levels and Total IgG Antibody Levels
[0144] As an alternative or in addition to determining the levels of anti-CD26 IgG antibodies, the methods of the invention may include the determination of the ratio between anti-CD26 IgG antibody levels and total IgG antibody levels (herein after referred as anti-CD26 IgG ratio).
[0145] Total antibody levels of a particular isotype may be determined by an immunoassay in a solid support wherein, instead of sCD26 as described above, an anti-human antibody of the relevant isotype (e.g., IgM, IgG or IgA) generally of another animal species is bound to the solid support, e.g., a polyclonal rabbit anti-human IgM, anti-IgG or anti-IgA.
[0146] Accordingly, the ratio between anti-CD26 IgG antibody levels and total IgG antibody levels (i.e., the anti-CD26 IgG ratio) is obtained herein by dividing the anti-CD26 IgG antibody levels by the total IgG antibody levels.
[0147] Accordingly, in another particular embodiment, the methods of the invention comprise the following steps: [0148] a) determining the levels of anti-CD26 IgG antibodies and/or the anti-CD26 IgG ratio in an antibody-containing sample isolated from said subject; [0149] b) comparing the levels and/or ratio in said antibody-containing sample with a reference value.
[0150] In a further particular embodiment, the methods of the invention comprise the following steps: [0151] a) determining the levels of anti-CD26 IgM antibodies and/or the anti-CD26 IgG ratio in an antibody-containing sample isolated from said subject; [0152] b) comparing the levels and/or ratio in said antibody-containing sample with a reference value.
[0153] In a preferred embodiment, the method under the first aspect of the invention and any related aspect as described above, comprises the following steps: [0154] a) determining the levels of anti-CD26 IgG antibodies in an antibody-containing sample isolated from said subject; [0155] b) comparing the levels in said antibody-containing sample with a reference value.
[0156] In step b), the levels and/or ratio determined in said biological sample are compared with reference values.
[0157] A reference value represents a threshold value of the relevant biomarker (e.g. anti-CD26 IgG antibody levels) to which a subject's measured levels may be compared. The reference level can be selected based on the intended purpose of the test or assay being performed on the subject. For example, a reference level may be determined for purposes of identifying subjects affected by an autoimmune and/or inflammatory disease while the same or different reference level may be used for monitoring the progression or severity of disease in a subject or the responsiveness to a treatment.
[0158] The selection of an appropriate reference level for a given test or assay is within the level of skill in the art. The choice of the reference value is not absolute. For example, a relatively low value may advantageously be used to reduce the incidence of false negatives, but may also increase the likelihood of false positives. Accordingly, as for other screening, diagnosis or monitoring techniques, the reference value may be based on a number of factors, including but not limited to cost, the benefit of early diagnosis and treatment, the invasiveness of follow-up diagnostic methods for individuals that have false positive results, the intended purpose of the test or assay, the limits of accurate detection in the particular sample type, the prevalence and average or of the given biomarker on the relevant population, the desired level of statistical significance of the results, the level of quantification desired in terms of disease risk, presence, progression, or severity, and other factors that are routinely considered in designing screening assays.
[0159] A threshold value or cut-off level may be determined for use in the methods of the invention. The term reference value as used herein also encompasses a threshold or cut-off level. A variety of statistical and mathematical methods for establishing the threshold or cutoff level for a particular biomarker are known in the prior art and may be selected, for example, based on data from Receiver Operating Characteristic (ROC) plots.
[0160] One of skill in the art will appreciate that these threshold or cutoff expression levels can be varied, for example, by moving along the ROC plot for a particular biomarker or combinations thereof, to obtain different values for sensitivity or specificity thereby affecting the overall assay performance. The best cut-off refers to the value obtained from the ROC plot for a particular biomarker that produces the best sensitivity and specificity. Sensitivity and specificity values are calculated over the range of thresholds (cut-offs). Thus, the threshold or cut-off values can be selected such that the sensitivity and/or specificity are at least about 70%, and can be, for example, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% in at least 60% of the patient population assayed, or in at least 65%, 70%, 75%, 80%, 85%, 90%, 95% or preferably 100% of the population assayed.
[0161] In some embodiments of the methods under the first and related aspects of the invention, said reference value corresponds to the respective anti-CD26 antibody levels or ratio reference value in healthy subjects. The term healthy subjects as used herein refers to an appropriate unaffected population.
[0162] In other embodiments of the methods under the first and related aspects of the invention, said disease is an inflammatory rheumatic disease and said reference value corresponds to the respective anti-CD26 antibody levels or ratio reference value of a rheumatic disease which is not an inflammatory rheumatic disease, such as osteoarthritis.
[0163] When comparing the subject's levels with said reference or control value (e.g., the mean or median levels or a cut-off value), the degree of variation of the levels in the tested sample with respect to a reference value may be for instance by at least 5%, by at least 10%, by at least 15%, by at least 20%, by at least 25%, by at least 30%, by at least 35%, by at least 40%, by at least 45%, by at least 50%, by at least 55%, by at least 60%, by at least 65%, by at least 70%, by at least 75%, by at least 80%, by at least 85%, by at least 90%, by at least 95%, by at least 100%, by at least 110%, by at least 120%, by at least 130%, by at least 140%, by at least 150%, or more.
[0164] Alternatively or in addition, subjects having more than about 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 8, 10 or 20 fold higher biomarker concentration than the reference value (e.g., the mean or median levels or a cut-off value) for an appropriate unaffected population as measured under similar or identical conditions may be identified as having, or suspected of having an autoimmune and/or inflammatory disease.
[0165] Preferably, this variation is statistically significant. The term significant or statistically significant when referring to differences between the test sample values and the control or reference value, relates to the condition when using the appropriate statistical analysis the probability of the groups being the same is less than 5%, e.g. p<0.05. In other words, the probability of obtaining the same results on a completely random basis is less than 5 out of 100 attempts. A person skilled in the art will know how to choose the appropriate statistical analysis. Typically, the appropriate statistical analysis is determined based on whether the variable under study has a normal distribution, for instance by using the test of Kolmogorov-Smirnov and on whether there is homoscedasticity, which is determined for instance with the Levene test. Preferably, in those cases where there is a normal distribution and homoscedasticity, a parametric model such as t-test or ANOVA test is used; and where at least one of these two requirements is not accomplished then a non-parametric model such as Mann-Whitney U test or Kruskal-Wallis test is generally used to compare continuous variables (not categorized). For categorized variables Chi-square test or Fisher exact test are typically performed. For multiple comparisons to a single cohort Dunnett's t-test is typically used.
[0166] In preferred embodiments of the methods of the invention, an increase of the relevant anti-CD26 antibody levels as defined above (e.g., anti-CD26 IgG antibody levels and/or the anti-CD26 IgG ratio and/or anti-CD26 IgM antibody levels) in the subject sample with regard to the respective reference value is indicative of disease. Preferably, wherein said reference value corresponds to the respective reference value in healthy subjects.
[0167] The methods under the first aspect and related aspects as defined above may further comprise determining the anti-CD26 antibody levels of the IgA isotype in said antibody-containing sample.
[0168] Accordingly, in some embodiments of the invention, the determined anti-CD26 antibody levels are selected from the group consisting of: [0169] i. the anti-CD26 IgG antibody levels and/or the anti-CD26 IgG ratio; [0170] ii. the anti-CD26 IgM antibody levels; [0171] iii. the IgG levels and/or ratio recited in i) and the anti-CD26 IgM antibody levels; [0172] iv. the IgG levels and/or ratio recited in i) and the anti-CD26 IgA antibody levels; and [0173] v. the IgG levels and/or ratio recited in i) and the anti-CD26 IgM, and anti-CD26 IgA antibody levels.
wherein for each of the defined groups an increase of any and preferably all of the antibody levels or ratio in the subject sample with regard to said reference value is indicative of disease and wherein said reference value corresponds to the respective reference value in healthy subjects.
[0174] In a preferred embodiment, said method comprises: [0175] a) determining the levels of anti-CD26 IgG antibodies in an antibody-containing sample isolated from said subject; [0176] b) comparing the anti-CD26 IgG antibody levels in said antibody-containing sample with a reference value; and
further comprises: [0177] c) determining the anti-CD26 antibody levels of the IgM and/or IgA isotype in said antibody-containing sample; [0178] d) comparing the anti-CD26 IgM and/or IgA antibody levels in said antibody-containing sample with a reference value;
wherein an increase of the anti-CD26 IgG antibody levels value and of the anti-CD26 IgM and/or anti-CD26 IgA antibody levels in the subject sample with regard to the respective reference value is indicative of disease and wherein said reference value corresponds to the respective reference value (e.g. the mean levels) in healthy subjects.
[0179] In a preferred embodiment of any of the above, the increase of said anti-CD26 antibody levels with respect to said reference value is of at least 1.2, preferably of at least 1.3, more preferably of at least 1.4, even more preferably of at least 1.5, and most preferably of at least 2. In a more preferred embodiment, the increase for IgG is of at least 1.3, the increase for IgM is of at least 1.4, and the increase of IgA is of at least 1.3.
[0180] The method according to the first and related aspects may further comprise the determination of IgA total antibodies levels, which have shown a high discrimination value between healthy donors and the whole cohort (see
[0181] The method according to the first and related aspects may further comprise the determination of other biomarkers associated to said autoimmune and/or inflammatory disease, preferably, said biomarkers are selected from the group consisting of anti-citrullinated protein antibodies (ACPA), rheumatoid factor (RF) antibodies, anti-mannose binding lectin (MBL) antibodies, erythrocyte sedimentation rate (ESR), C-reactive protein (CRP), platelet count, hemoglobin levels and hematocrit.
[0182] In a particular embodiment, these are selected from the list consisting of ESR, CRP concentration levels, anti-citrullinated protein antibodies (ACPA), rheumatoid factor auto-antibodies and anti-mannose binding lectin (MBL) auto-antibodies which have been previously been used as diagnostic markers. Further details are provided in Gupta B et al. J Autoimmun. 2006. 27: 125-133, Afzal Net al. Clin Lab. 2011. 57: 895-899, Takizawa Y et al. Ann Rheum Dis. 2006. 65: 1013-1020, Vossenaar E R et al. Arthritis Res Ther. 2004. 6: R142-R150 and EP0175270 which are incorporated herein by reference.
[0183] In a particular embodiment, the method of the invention further comprises determining anti-citrullinated protein antibodies (ACPA) levels in said subject. The results in Example 10 suggest that anti-CD26 antibodies participate in RA pathogenesis in an independent way than ACPA, and may serve for earlier diagnosis, in particular in those subjects which are ACPA negative.
[0184] In another particular embodiment, optionally in combination with any of the above, the methods of the invention as described herein may further comprise the determination of clinical parameters. Signs and/or symptoms which presence/absence may be determined are: morning stiffness, joint involvement (i.e. any swollen or tender joint on examination) including number (e.g. arthritis of three or more joint areas) and type of joints (e.g. large joints, small joints, or hand joint involvement), symmetric arthritis, rheumatoid nodules, and radiographic changes (see Table 1 of Rindfleisch and Muller (American Family Physician 2005, 72(6), 1037-1047), and ACR/EULAR classification criteria (Ann Rheum Dis 2010; 69:1580-1588).
[0185] In a particular embodiment, optionally in combination with any of the above, the methods of the invention as described herein further comprise the determination of biomarkers and clinical parameters as described herein. Preferably, these include one or more, preferably all, of the following i) determination of joint involvement, ii) determination of anti-citrullinated protein antibodies (ACPA) and/or rheumatoid factor (RF) antibodies levels, and iii) erythrocyte sedimentation rate (ESR) and/or C-reactive protein (CRP) determination. Preferably, the method of the invention is combined with the current 2010 ACR/EULAR classification criteria, provided in Table 3 of Ann Rheum Dis 2010; 69:1580-1588 and reproduced below:
TABLE-US-00003 TABLE 3 The 2010 American College of Rheumatology/European League Against Rheumatism classification criteria for rheumatoid arthritis Score Target population (Who should be tested?): Patients who 1) have at least 1 joint with definite clinical synovitis (swelling)* 2) with the synovitis not better explained by another disease Classification criteria for RA (score-based algorithm: add score of categories A-D; a score of 6/10 is needed for classification of a patient as having definite RA) A. Joint involvement 1 large joint 0 2-10 large joints 1 1-3 small joints (with or without involvement of large joints)# 2 4-10 small joints (with or without involvement of large joints) 3 >10 joints (at least 1 small joint) 5 B. Serology (at least 1 test result is needed for classification) Negative RF and negative ACPA 0 Low-positive RF or low-positive ACPA 2 High-positive RF or high-positive ACPA 3 C. Acute-phase reactants (at least 1 test result is needed for classification) Normal CRP and normal ESR 0 0 Abnormal CRP or abnormal ESR 1 1 D. Duration of symptoms <6 weeks 0 6 weeks 1 *The criteria are aimed at classification of newly presenting patients. In addition, patients with erosive disease typical of rheumatoid arthritis (RA) with a history compatible with prior fulfillment of the 2010 criteria should be classified as having RA. Patients with long-standing disease, including those whose disease is inactive (with or without treatment) who, based on retrospectively available data, have previously fulfilled the 2010 criteria should be classified as having RA. Differential diagnoses differ in patients with different presentations, but may include conditions such as systemic lupus erythematosus, psoriatic arthritis, and gout. If it is unclear about the relevant differential diagnoses to consider, an expert rheumatologist should be consulted. Although patients with a score of lss than 6/10 are not classifiable as having RA, their status can be reassessed and the criteria might be fulfilled cumulatively over time. Joint involvement refers to any swollen or tender joint on examination, which may be confirmed by imaging evidence of synovitis. Distal interphalangeal joints, first carpometacarpal joints, and first metatarsophalangeal joints are excluded from assessment. Categories of joint distribution are classified according to the location and number of involved joints, with placement into the highest category possible based on the pattern of joint involvement. Large joints refers to shoulders, elbows, hips, knees, and ankles. **Small joints refers to the metacarpophalangeal joints, proximal interphalangeal joints, second through fifth metatarsophalangeal joints, thumb interphalangeal joints, and wrists. In this category, at least 1 of the involved joints must be a small joint; the other joints can include any combination of large and additional small joints, as well as other joints not specifically listed elsewhere (e.g., temporomandibular, acromioclavicular, sternoclavicular, etc.). Negative refers to international unit (IU) values that are less than or equal to the upper limit of normal (ULN) for the laboratory and assay; low-positive refers to IU values that are higher than the ULN but three of less times the ULN for the laboratory and assay; high-positive refers to IU values that are more than three times the ULN for the laboratory and assay. Where rheumatoid factor (RF) information is only available as positive or negative, a positive result should be scored as low-positive for RF. Normal/abnormal is determined by local laboratory standards. Duration of symptoms refers to patient self-report of the duration of signs or symptoms of synovitis (eg, pain, swelling, tenderness) of joints that are clinically involved at the time of assessment, regardless of treatment status. ACPA = anti-citrullinated protein antibody; CRP = C-reactive protein; ESR = erythrocyte sedimentation rate.
[0186] A confirmed diagnosis of rheumatoid arthritis or definite rheumatoid arthritis may be based on the confirmed presence of synovitis in at least one joint, absence of an alternative diagnosis better explaining the synovitis, and achievement of a total score of 6 or greater (of a possible 10) from the individual scores in four domains: number and site of involved joints (range 0-5), serological abnormality (range 0-3), elevated acute-phase response (range 0-1) and symptom duration (two levels; range 0-1). The meaning of these parameters is as defined in ACR/EULAR classification criteria (Ann Rheum Dis 2010; 69:1580-1588).
[0187] The term joint involvement as used herein refers to any swollen or tender joint on examination, which may be confirmed by imaging evidence of synovitis. Distal interphalangeal joints, first carpometacarpal joints and first metatarsophalangeal joints are typically excluded from assessment. Categories of joint distribution are generally classified according to the location and number of involved joints, with placement into the highest category possible based on the pattern of joint involvement. The term large joints as used herein, refers to shoulders, elbows, hips, knees and ankles. The term small joints as used herein, refers to the metacarpophalangeal joints, proximal interphalangeal joints, second to fifth metatarsophalangeal joints, thumb interphalangeal joints and wrists.
[0188] Preferably, the method of the invention further comprises storing the results of the method in a data carrier. The results of the method of the invention include the determined UNR gene product expression values, the determination of the subject as having good or poor prognosis, the determination of the subject as having short-term or long-term outcome after surgery, and any other determinations according to any of the methods of the invention, as well as any mathematical or statistical treatment thereof. Said data carrier may be a paper sheet or preferably a computer readable medium. As used herein, a computer readable medium can be any apparatus that may include, store, communicate, propagate, or transport the results of the determination of the method of the invention. The medium can be an electronic, magnetic, optical, electromagnetic, infrared, or semiconductor system (or apparatus or device) or a propagation medium.
[0189] The methods of the present invention might be implemented by a computer. Therefore, a further aspect of the invention refers to a computer implemented method, wherein the method is any of the methods disclosed herein or any combination thereof. It is noted that any computer program capable of implementing any of the methods of the present invention or used to implement any of these methods or any combination thereof, also forms part of the present invention.
[0190] It is also noted that any device or apparatus comprising or carrying a computer program capable of or, for implementing any of the methods of the present invention or any combination therefore, is included as forming part of the present specification.
[0191] An In Vitro Method of Disease Monitoring and/or Monitoring Responsiveness to a Treatment in a Subject Having or Suspected to have an Autoimmune and/or Inflammatory Disease and Methods Related Thereof
[0192] In another aspect, the invention relates to an in vitro method of disease monitoring and/or monitoring responsiveness to a treatment in a subject having or suspected to have an autoimmune and/or inflammatory disease, said method comprising the steps a) and b) of the first aspect of the invention. In a particular embodiment, an increase of the anti-CD26 IgG and/or anti-CD26 IgM antibody levels and/or the anti-CD26 IgG antibody levels/total IgG antibody levels ratio in the subject sample with regard to the reference value is indicative of disease.
[0193] In a related aspect, the invention refers to an in vitro method for the classification of a subject as responder to a treatment to an autoimmune and/or inflammatory disease, said method comprising the steps a) and b) of the first aspect of the invention. In a particular embodiment, an increase of the anti-CD26 IgG and/or anti-CD26 IgM antibody levels and/or the anti-CD26 IgG antibody levels/total IgG antibody levels ratio in the subject sample with regard to said reference value is indicative of lack of response.
[0194] For any of the above aspects, said reference value may correspond to a reference value (e.g., the relevant anti-CD26 antibody mean levels or ratio) in healthy subjects. It may also correspond to said anti-CD26 antibody levels determined in an appropriate sample isolated from said patient in an earlier moment in time, such as around diagnosis and/or before treatment.
[0195] Preferred features and embodiments are as defined above for other aspects of the invention.
[0196] A Method of Treating a Subject Identified with a Method Comprising Steps a) and b) of the First Aspect and Related Second Medical Uses
[0197] In a further aspect, the present invention relates to a method of treating a subject having an autoimmune and/or inflammatory disease, said method comprising identifying the subject to be treated by a method comprising the steps a) and b) of the first aspect of the invention and [0198] c) treating said subject suffering or suspected to suffer from an autoimmune and/or inflammatory disease.
[0199] In a particular embodiment, an increase of any of the anti-CD26 IgG and/or anti-CD26 IgM antibody levels and/or the anti-CD26 IgG antibody levels/total IgG antibody levels ratio in the subject sample with regard to said reference value is indicative of disease.
[0200] Said reference value may correspond to a reference value (e.g., the relevant anti-CD26 antibody mean levels or ratio) in healthy subjects.
[0201] Said therapies may include one or more of disease-modifying anti-rheumatic drugs (DMARDs); nonsteroidal anti-inflammatories (NSAIDs); biological therapies; corticosteroids; and JAK kinase inhibitors (such as tofacitinib).
[0202] The term biological therapies or biologics as used herein refers to biologic response modifiers (BRM) which are drugs which stimulate or suppress the immune system. Biological therapies have successfully been used in the treatment of immune-mediated conditions such as RA and may be broadly divided as i) anti-TN F alpha biologics (also referred as TNFi biologics, e.g., adalimumab, cetolizumab pegol, etanercept, golimumab or infliximab) and ii) non-TNF alpha biologics, including anti-CD20 agents (e.g. rituximab), anti-IL6R agents (e.g. tocilizumab) or CTLA4-Fc fusion proteins (e.g. abatacept).
[0203] NSAIDs including but are not limited to Cox-2 inhibitors, diclofenac, ibuprofen, naproxen, celecoxib, mefenamic acid, etoricoxib, indometacin and aspirin. Corticosteroids include but are not limited to triamcinolone, cortisone, prednisone, and methylprednisolone. Disease-modifying antirheumatic drugs (DMARDs), include but are not limited to auranofin, choroquine, cyclosporine, cyclophosphamide, gold preparations, hydroxychloroquine sulphate, leflunomide, methotrexate, penicillamine, sodium aurothiomalate and sulfasalazine. Illustrative non-limiting examples of therapeutic antibodies used for autoimmune and/or inflammatory diseases are provided in Table 1 of Chan and Carter, Nature Reviews on Immunology, 2010, 10, 301-315.
[0204] Singh et al., (Arthritis & Rheumathology, 2016, 68(1), 1-16) provides a guideline for the treatment of RA from the American College of Rheumatology. Table 1 (partially reproduced below) provides a summary of current RA therapeutic treatments. In particular treatment recommendations for patients with symptomatic early RA are provided in the table of
TABLE-US-00004 Drug category Descriptions Methotrexate Used either oral or subcutaneous (a DMARD). DMARDs Traditional/conventional DMARDs including HCQ, LEF, MTX, or SSZ (excludes azathioprine, cyclosporine, minocycline, and gold), it does not include tofacitinib, which is considered separately. DMARD monotherapy Most often defined as the use of MTX monotherapy, but may also be SSZ, HCQ, or LEF. Double DMARD therapy MTX + SSZ, MTX + HCQ, SSZ + HCQ, or combinations with LEF. Triple DMARD therapy MTX + SSZ + HCQ. DMARD combination therapy Double or triple traditional/conventional DMARD therapy. Tofacitinib Oral synthetic small molecule. Biologics TNFi biologic or non-TNF biologic (excludes anakinra). TNFi biologics Adalimumab, certolizumab pegol, etanercept, golimumab, or infliximab. Non-TNF biologics Abatacept, rituximab, or tocilizumab (excludes anakinra). Low-dose glucocorticoid 10 mg/day of prednisone (or equivalent). High-dose glucocorticoid >10 mg/day of prednisone (or equivalent) and up to 60 mg/day with a rapid taper.# Short-term glucocorticoid <3 month treatment. *ACR = American College of Rheumatology; RA = rheumatoid arthritis; PROMIS = Patient-Reported Outcomes Measurement Information System; EULAR = European League Against Rheumatism; DAS = Disease Activity Score; DMARD = disease-modifying antirheumatic drug; AST = aspartate aminotransferase; ALT = alanine aminotransferase; HBV = hepatitis B virus; HCV = hepatitis C virus; NYHA = New York Heart Association; HCQ = hydroxychloroquine; LEF = leflunomide; MTX = methotrexate; SSZ = sulfasalazine; TNFi = tumor necrosis factor inhibitor; COBRA = Combinatietherapie Bij Reumatoide Artritis. Any of the ACR recommended disease activity measures may be chosen, as described in ref. 16. New classification criteria for RA (ACR/EULAR collaborative initiative) were published in 2010 (82), the definition of established RA is based on the 1987 ACR RA classification criteria, since the 2010 ACR RA classification allows a much earlier diagnosis. Anakinra was considered but not included in these guidelines due to its infrequent use in RA and lack of new data since 2012. Azathioprine, cyclosporine, minocycline, and gold were considered but not included in these guidelines due to their infrequent use in RA and/or lack of new data since 2012. #Regimen based on that described in the COBRA study (153).
[0205] In a particular embodiment, said method of treating comprises the use of one or more agents selected from the group consisting of: [0206] i. DMARDs, preferably methotrexate, and/or leflunomide; [0207] ii. anti-TNF alpha agents; [0208] iii. anti-CD20 agents; [0209] iv. anti-IL6R agents; and [0210] v. CTLA4-Fc fusion proteins, such as abatacept.
[0211] In a related aspect, the invention refers to a drug selected from the list consisting of: [0212] i. DMARDS, preferably methotrexate, and/or leflunomide; [0213] ii. Anti-TNF alpha agents; [0214] iii. Anti-CD20 agents; and [0215] iv. Anti-IL6R agents and/or CTLA4-Fc fusion proteins, such as abatacept; [0216] for use in a method of treating a subject suffering or suspected of suffering from an autoimmune and/or inflammatory disease, wherein said subject has been selected by using a method according to any of the methods described herein. [0217] In another related aspect, it concerns the use of a drug selected from the list consisting of: [0218] i. DMARDS, preferably methotrexate, and/or leflunomide; [0219] ii. Anti-TNF alpha agents; [0220] iii. Anti-CD20 agents; and [0221] iv. Anti-IL6R agents and/or CTLA4-Fc fusion proteins, such as abatacept; [0222] in the manufacturing of a medicament for the treatment of a subject suffering or suspected of suffering from an autoimmune and/or inflammatory disease, wherein said subject has been selected by using a method according to any of the methods described herein.
[0223] Preferred features and embodiments are as defined above for other aspects of the invention.
[0224] An In Vitro Method for Determining the Stage of Progression of an Autoimmune and/or Inflammatory Disease in a Subject and Methods Related Thereof
[0225] In further aspect, the invention relates to an in vitro method for determining the stage of progression of an autoimmune and/or inflammatory disease in a subject, said method comprising the steps a) and b) of the first aspect of the invention.
[0226] In a related aspect, the invention refers to an in vitro method of determining a treatment for a subject suffering from an autoimmune and/or inflammatory disease according to its stage of progression comprising the steps a) and b) of the first aspect of the invention.
[0227] In a particular embodiment of any of the above aspects, an increase of any of the anti-CD26 IgG and/or anti-CD26 IgM antibody levels and/or the anti-CD26 IgG antibody levels/total IgG antibody levels ratio in the subject sample with regard to said reference value is associated with early stage of progression.
[0228] Also, for any of the above aspects, said reference value may correspond to a reference value (e.g., the relevant anti-CD26 antibody mean levels or ratio) in healthy subjects. It may also correspond to a reference value (e.g., the relevant anti-CD26 antibody mean levels or ratio) in patients having or suspected to have an anti-inflammatory and/or autoimmune disease, preferably an inflammatory rheumatic disease, more preferably the same anti-inflammatory and/or autoimmune disease.
[0229] Preferred features and embodiments are as defined above for other aspects of the invention.
[0230] In a preferred embodiment, optionally in combination with any of the embodiments described herein, it relates to an in vitro method for determining the stage of progression of an autoimmune and/or inflammatory disease in a subject, said method comprising the steps a) and b) of the first aspect, wherein an increase of the anti-CD26 IgG antibody levels in the subject sample with regard to said reference value is associated with early stage of progression;
wherein said reference value corresponds to the mean anti-CD26 IgG antibody levels in healthy subjects.
[0231] In another preferred embodiment, optionally in combination with any of the embodiments described herein, it relates to an in vitro method of determining a treatment for a subject suffering from an autoimmune and/or inflammatory disease according to its stage of progression comprising the steps a) and b) of the first aspect, wherein an increase of the anti-CD26 IgG antibody levels in the subject sample with regard to said reference value is indicative of early stage of progression; wherein said reference value corresponds to the mean anti-CD26 IgG antibody levels in healthy subjects.
[0232] Use of In Vitro Determined Anti-CD26 Antibody Levels as Biomarkers of an Autoimmune and/or Inflammatory Disease
[0233] Use of in vitro determined anti-CD26 IgG and/or anti-CD26 IgM and/or the anti-CD26 IgG antibody levels/total IgG antibody levels ratio, optionally in combination with in vitro determined anti-CD26 IgA antibody levels, in an antibody-containing sample isolated from a subject for the screening, diagnosis, and/or monitoring of an autoimmune and/or inflammatory disease; and/or for monitoring the effectiveness of a treatment in an autoimmune and/or inflammatory disease.
[0234] Preferred features and embodiments are as defined above for other aspects of the invention.
[0235] Kit and Uses Thereof
[0236] In an additional aspect, the invention relates to a kit comprising reagents for determining anti-CD26 antibody levels according to step a) of the first aspect of the invention. These reagents may be as described under the first aspect of the invention for various types of immunoassays.
[0237] In some embodiments, the kit includes a purified or synthesized sCD26 polypeptide or an antigenic fragment thereof (which may be labelled or not) and one or more ancillary reagents. In other embodiments, the kit includes a suitable host cell (e.g. a mammalian cell) expressing CD26 and one or more ancillary reagents. CD26, including sCD26 and fragments thereof have been described under the first aspect of the invention. In these embodiments, when anti-CD26 antibodies are quantified sCD26 or a cell expressing CD26 is typically used for capturing purposes and a secondary or detection antibody for detection purposes. In still further embodiments, when anti-CD26 immunoglobulin expressing cells are quantified, e.g. by IHC or cytometry, the kit typically includes labelled sCD26 for detection purposes and one or more ancillary reagents.
[0238] Kit Anti-CD26 IgG Isotype
[0239] In a particular embodiment, said kit comprises reagents for determining anti-CD26 antibody levels of the IgG isotype in an antibody-containing sample isolated from a subject, wherein said kit comprises: [0240] a) a reagent for determining the levels of anti-CD26 antibodies of the IgG isotype; [0241] b) optionally, instructions for the use of said reagent in determining the anti-CD26 antibody levels of the IgG isotype in an antibody-containing sample isolated from said subject.
[0242] Preferably, a) corresponds to: [0243] i. CD26, an antigenic fragment thereof or a cell expressing any thereof; [0244] ii. a reagent for determining the levels of CD26-captured antibodies of the IgG isotype, such as a labelled anti-IgG affinity reagent (e.g., a labelled anti-IgG antibody).
[0245] In a preferred embodiment, said kit further comprises: [0246] c) a reagent for determining the levels of anti-CD26 antibodies of the IgA and/or IgM isotype; [0247] d) optionally, instructions for the use of said reagent in determining the anti-CD26 antibody levels of the IgA and/or IgM isotype in said antibody-containing sample.
[0248] Preferably, c) corresponds to: [0249] iii. a reagent for determining the levels of CD26-captured antibodies of the IgA and/or IgM isotype, such as a labelled anti-IgM affinity reagent and/or a labelled anti-IgA affinity reagent (e.g., a labelled anti-IgA antibody and/or a labelled anti-IgM antibody).
[0250] Kit Anti-CD26 IgM Isotype
[0251] In another particular embodiment, said kit comprises reagents for determining anti-CD26 antibody levels of the IgM isotype in an antibody-containing sample isolated from a subject, wherein said kit comprises: [0252] a) a reagent for determining the levels of anti-CD26 antibodies of the IgM isotype; [0253] b) optionally, instructions for the use of said reagent in determining the anti-CD26 antibody levels of the IgM isotype in an antibody-containing sample isolated from said subject.
[0254] Preferably, a) corresponds to: [0255] i. CD26, an antigenic fragment thereof or a cell expressing any thereof; [0256] ii. a reagent for determining the levels of CD26-captured antibody of the IgM isotype, such as a labelled anti-IgM affinity reagent (e.g., a labelled anti-IgM antibody).
[0257] In a preferred embodiment, said kit further comprises: [0258] c) a reagent for determining the levels of anti-CD26 antibodies of the IgA and/or IgG isotype; [0259] d) optionally, instructions for the use of said reagent in determining the anti-CD26 antibody levels of the IgA and/or IgG isotype in said antibody-containing sample.
[0260] Preferably, c) corresponds to: [0261] iii. a reagent for determining the levels of CD26-captured antibodies of the IgA and/or IgG isotype, such as a labelled anti-IgA affinity reagent and/or a labelled anti-IgG affinity reagent (e.g., a labelled anti-IgA antibody and/or a labelled anti-IgG antibody).
[0262] Preferably, said kit comprises a solid support or surface which is coated with i). The solid support can include any support known in the art on which a protein of this disclosure can be immobilized. In some embodiments, said solid supports are microtiter well plates, slides (e.g., glass slides), chips (e.g., protein chips, biosensor chips, such as Biacore chips), microfluidic cartridges, cuvettes, beads (e.g., magnetic beads, xMAP beads) or resins.
[0263] Said reagent for determining the levels of antibody of the IgM, IgG and/or IgA isotype may be a secondary or detection antibody. Preferably, the antibody of the IgM, IgG and/or IgA isotype is a human antibody and the secondary or detection antibody is an anti-human antibody. Secondary or detection antibodies in the present invention can include, e.g., an anti-human IgA antibody, an anti-human IgG antibody, or an anti-human IgM antibody. These antibodies can be monoclonal or polyclonal antibodies. Also, these can be derived from any mammalian organism, including mice, rats, hamsters, goats, camels, chicken, rabbit, and others. Secondary or detection antibodies can be conjugated to any suitable detection means such as enzymes (e.g., horseradish peroxidase (HRP), alkaline phosphatase (AP), luciferase, and the like) or dyes (e.g., colorimetric dyes, fluorescent dyes, fluorescence resonance energy transfer (FRET)-dyes, time-resolved (TR)-FRET dyes, and the like). Other suitable labels have been described herein above. In some embodiments, the secondary or detection antibody is a polyclonal goat-anti-human IgG (anti-human IgM or anti-human IgA antibody, respectively depending on the isotype to be determined), which is HRP-conjugated.
[0264] Any of the above embodiments on the kit, may further comprise: [0265] e) a reagent for determining the levels of total antibodies of the IgM, IgG and/or IgA; [0266] f) optionally, instructions for the use of said reagent in determining the levels of total antibodies of the IgM, IgG and/or IgA isotype in said antibody-containing sample.
[0267] Preferably, e) corresponds to: [0268] iv. a reagent for capturing antibodies of the IgM, IgG and/or IgA isotype, such as an anti-IgM, IgG and/or IgA affinity reagent (e.g., an anti-IgM, anti-IgG and/or anti-IgA antibody) [0269] v. a reagent for determining the levels of captured antibodies of the IgM, IgG and/or IgA isotype, such as a labelled anti-IgM, IgG and/or IgA affinity reagent (e.g., a labelled anti-IgM, anti-IgG and/or anti-IgA antibody);
[0270] Typically, the reagent in iv) and v) are polyclonal antibodies against the relevant isotype originating from different animal species. Preferably, these are anti-human antibodies. (e.g. a polyclonal rabbit anti-human IgG and a polyclonal goat anti-human IgG, respectively). These may also be monoclonal antibodies, with the proviso that, these bind to different epitopes and there is no steric interference.
[0271] Any of the above embodiments on the kit may further comprise: [0272] a reagent for determining the levels of anti-citrullinated protein antibodies (ACPA); and [0273] optionally, instructions for the use of said reagent in determining the levels of ACPA in said antibody-containing sample.
[0274] This reagent may comprise one or more antigens in citrullinated proteins, such as those typically included in anti-cyclic citrullinated peptide (anti-CCP) antibody assays (Johansson et al. Arthritis Res Ther. 2016; 18: 127; Nijenhuis S, et al., Clin Chim Acta 2004, 350:17-34; van Venrooij W. J. and Zendman A. J. W. Clin Rev Allergy Immunol. 2008, 34(1): 36-39). These citrullinated antigens are not particularly limited and may be endogenous (e.g. histone-4-derived citrullinated peptides (HCP1 and HCP2) or exogenous (e.g. viral citrullinated peptides (VCP) derived from Epstein-Barr-virus nuclear antigen (EBNA)1 and EBNA2 (VCP1 and VCP2). The sequences of the specifically mentioned VCPs and HCPs have been described in Johansson et al. Arthritis Res Ther. 2016; 18: 127.
[0275] Preferably, said kit comprises a solid surface or support, which is coated with iv). This solid surface or support may be as described herein above. This surface may or not be the same, which is coated with i). Preferably, the surface coated with i) and the surface coated with iv) are separate surfaces.
[0276] Ancillary reagents typically used in an immunoassay, such as a solid support immunoassay, can include, e.g., an immobilization buffer, an immobilization reagent, a dilution buffer, a secondary or detection antibody, a detection reagent, a blocking buffer, a washing buffer, a detection buffer, a stop solution, a system rinse buffer, and a system cleaning solution which are well known by a person skilled in the art.
[0277] Preferred features and embodiments are as defined above for other aspects of the invention. In particular, an example of immunoassay to determine anti-CD26 antibody levels is provided under the first aspect of the invention.
[0278] In still an additional aspect, the invention relates to the use of a kit of the preceding aspect for the screening, diagnosis, and/or monitoring of an autoimmune and/or inflammatory disease; and/or for monitoring the effectiveness of a treatment in an antibody-containing sample isolated from a subject.
[0279] Preferred features and embodiments are as defined above for other aspects of the invention.
[0280] Total IgA Levels as Biomarker for Screening, Diagnosis, Monitoring of an Inflammatory and/or Autoimmune Disease and Related Aspects.
[0281] As provided in Example 5, IgA total antibodies levels, have shown a high discrimination value between healthy donors and the whole cohort of patients treated with different therapies (see
[0282] Accordingly, in a further aspect, the invention relates to an in vitro method for the screening, for obtaining useful data for the diagnosis, for the diagnosis or for the monitoring of a subject having, or suspected of having an autoimmune and/or inflammatory disease comprising the following steps: [0283] a) determining the levels of total antibodies of the IgA isotype (total IgA antibody levels) in an antibody-containing sample isolated from said subject; [0284] b) comparing the levels in said antibody-containing sample with a reference value.
[0285] In a particular embodiment, an increase of the total IgA antibody levels in the subject sample with regard to said reference value is indicative of disease.
[0286] Said reference value may correspond to a reference value for total IgA antibody levels (e.g., the mean or median levels or a calculated cut-off value) in healthy subjects. It may also correspond to said total IgA antibody levels determined in an appropriate sample isolated from said patient in an earlier moment in time, such as around diagnosis and/or before treatment.
[0287] Total IgA antibody levels (e.g. total human IgA antibody levels) may be determined by any method well-known in the art. These are typically quantified by using an immunoassay, including in particular an immunoassay in a solid support as described in detail under the first aspect of the invention wherein the solid support is coated with an anti-IgA antibody (e.g. an anti-human IgA antibody).
[0288] In a further aspect, the present invention relates to a method of treating a subject having an autoimmune and/or inflammatory disease, said method comprising identifying the subject to be treated by a method comprising the steps of: [0289] a) determining the levels of total antibodies of the IgA isotype (total IgA antibody levels) in an antibody-containing sample isolated from said subject; [0290] b) comparing the levels in said antibody-containing sample with a reference value; and [0291] c) treating said subject suffering or suspected to suffer from an autoimmune and/or inflammatory disease.
[0292] In a particular embodiment, an increase of the total IgA antibody levels in the subject sample with regard to said reference value is indicative of disease.
[0293] Said reference value may correspond to the total IgA antibody levels reference value (e.g., the mean or median levels or a cut-off value) in healthy subjects.
[0294] In an additional aspect, the invention relates to a kit comprising reagents for determining total antibody levels of the IgA isotype in an antibody-containing sample isolated from a subject, wherein said kit comprises: [0295] a) a reagent for determining the levels of total antibody levels of the IgA isotype; [0296] b) optionally, instructions for the use of said reagent in determining the total IgA antibody levels in an antibody-containing sample isolated from said subject.
[0297] In a particular embodiment, said kit further comprises: [0298] c) a reagent for determining the levels of an anti-CD26 antibody of the IgG isotype; [0299] d) optionally, instructions for the use of said reagent in determining the anti-CD26 antibody levels of the IgG isotype in an antibody-containing sample isolated from said subject.
[0300] In another particular embodiment, optionally in combination with the embodiment above, said kit further comprises: [0301] e) a reagent for determining the levels of anti-CD26 antibody of the IgA and/or IgM isotype; [0302] f) optionally, instructions for the use of said reagent in determining the anti-CD26 antibody levels of the IgA and/or IgM isotype in said antibody-containing sample.
[0303] In still an additional aspect, the invention relates to the use of a kit for the screening, diagnosis, and/or monitoring of an autoimmune and/or inflammatory disease; and/or for monitoring the effectiveness of a treatment in an antibody-containing sample isolated from a subject, wherein said kit is as described in the preceding aspect.
[0304] Preferred embodiments and features of any of these aspects are as described above for the other aspects of the invention.
[0305] It is contemplated that any embodiment discussed in this specification with respect to one aspect of the invention applies to other aspects of the invention as well and viceversa, more specifically it can be implemented with respect to any method, kit, and use of the invention described herein. It will be understood that particular embodiments described herein are shown by way of illustration and not as limitations of the invention. The principal features of this invention can be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of this invention and are covered by the claims.
[0306] All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
[0307] The use of the word a or an may mean one, but it is also consistent with the meaning of one or more, at least one, and one or more than one. The use of the term another may also refer to one or more. The use of the term or in the claims is used to mean and/or unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive.
[0308] As used in this specification and claim(s), the words comprising (and any form of comprising, such as comprise and comprises), having (and any form of having, such as have and has), including (and any form of including, such as includes and include) or containing (and any form of containing, such as contains and contain) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. The term comprises also encompasses and expressly discloses the terms consists of and consists essentially of. As used herein, the phrase consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention. As used herein, the phrase consisting of excludes any element, step, or ingredient not specified in the claim except for, e.g., impurities ordinarily associated with the element or limitation.
[0309] The term or combinations thereof as used herein refers to all permutations and combinations of the listed items preceding the term. For example, A, B, C, or combinations thereof is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB. Continuing with this example, expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, AB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth. The skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.
[0310] A person skilled in the art will generally understand that a value includes the standard deviation of error for the device or method being employed to determine the value. This may be emphasized herein by the use of words of approximation such as, without limitation, about, around, approximately refers to a condition that when so modified is understood to not necessarily be absolute or perfect but would be considered close enough to those of ordinary skill in the art to warrant designating the condition as being present. The extent to which the description may vary will depend on how great a change can be instituted and still have one of ordinary skilled in the art recognize the modified feature as still having the required characteristics and capabilities of the unmodified feature. In general, but subject to the preceding discussion, a numerical value herein that is modified by a word of approximation such as about may vary from the stated value by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15%. Preferably the term about means exactly the indicated value (0%).
[0311] The following examples serve to illustrate the present invention and should not be construed as limiting the scope thereof.
EXAMPLES
Example 1.Material and Methods
[0312] Study Design
[0313] 110 patients from the Rheumatology Service (Hospital Meixoeiro-CHUVI) were recruited in a cross-sectional case-control study. Patients fulfilled the American College of Rheumatology (ACR)/EULAR criteria of 2010 (Aletaha D et al. Arthritis Rheum. 2010. 62: 2569-2581 and were on different therapies, including biological therapies (BT). The only exclusion criterion was the patient's decision not to be included in the study. A group of 25 healthy donors was also recruited. All the procedures described were performed according to clinical ethical practices of the Spanish and European Administrations and approved by the local ethics committee. Written informed consent was obtained from all participants.
[0314] Disease activity was previously assessed in this group of patients by the DAS-28 index, which takes into account the number of tender joints (TJC), swollen joints (SJC), erythrocyte sedimentation rate (ESR) and Patient Global Assessment (PGA) of disease activity, scored by a numeric rating scale (NRS 0-100). Erythrocyte sedimentation rate (ESR), C-reactive protein (CRP), haemoglobin and platelet concentration levels were also recorded as RA activity markers. The DAS-28 index and how to determine it is well known to a person skilled in the art, see for instance J. S. Smolen, et al. Arthritis Rheum 1995, 38: 38-43, the content of which is included herein by reference. All patients also completed the HAQ (Stanford Health Assessment Questionnaire: Fries J, Spitz P W, Young D Y. The dimensions of health outcomes: the health assessment questionnaire, disability and pain scales. J Rheumatol 1982, 9: 789-93), which is a self-report functional status (disability) measure. The results on the assessed disease activity parameters have been published before by the inventors (Cordero O J et al. PLoS One. 2015. 10(7):e0131992) and the content of this document is included herein by reference.
[0315] Different Group of Patient's Defined According to the Undergoing Therapies
[0316] The patients under study were classified in different groups according to the therapies they were receiving, which may have different effect on the antibody values. The cohort was divided into four groups according to the mechanism of action of the different therapies:
a) Disease-Modifying Anti-Rheumatic Drugs (DMARDs; methotrexate and/or leflunomide);
b) anti-TNF-alpha agents (adalimumab, etanercept, infliximab, golimumab, certolizumab),
c) anti-CD20 mAb (rituximab), and
d) anti-IL6R mAb (tocilizumab) or Ig-CTLA4 (abatacept). In this latter subgroup both therapies showed a similar immunological response, so patients' results were grouped together.
[0317] Smoking History
[0318] Patients' smoking history was evaluated at inclusion. Current smokers were those reporting active smoking. Past smokers were all patients who had stopped smoking before the first examination at inclusion. Non-smokers reported no history of smoking at any time.
[0319] Biological Samples
[0320] For serum collection, peripheral venous blood extracted with BD SST II Advance tubes was allowed to clot at room temperature and centrifuged at 2,000g for 15 min. Serum was stored at 80 C. until use. Blood cells were collected using TransFix Vacuum Blood Collection Tubes (Cytomark, Buckingham, UK) and stored at 4 C. until use.
[0321] Measurement of DPP-IV Enzyme Activity and Soluble CD26 Protein
[0322] Both techniques have been described previously [Cordero O J et al. PLoS One. 2015. 10(7):e0131992, Cuchacovich M et al. Clin Exp Rheumatol. 2001. 19: 673-80, Ellingsen T et al. Scand J Immunol. 2007. 66: 451-7]. Since previous studies [Cordero O J et al. Immunobiology. 1997. 197:522-33, De Chiara L et al. Dis Markers. 2009. 27:311-6. doi: 10.3233/DMA-2009-0679, Lambeir A M et al. Crit Rev Clin Lab Sci. 2003. 40: 209-94] have shown slight but not statistically significant differences in both levels of sCD26 and DPP-IV activity according to gender or age, values from controls and RA patients were not matched for these two parameters.
[0323] Enzyme-Linked Immunosorbent Assays for Total Immunoglobulins and Anti-CD26 Autoantibodies.
[0324] Concentration of both total and anti-CD26/DPP-IV IgA, IgG and IgM titers in sera of patients was determined by ELISA using 96-well cultured plates coated with rDPP-IV (0.5 g/mL) (Sigma-Aldrich Spain or RnD Systems, USA) or with polyclonal rabbit anti-human IgA, anti-IgG and anti-IgM (2 g/mL) (DakoCytomation, Denmark) prepared in PBS pH 7.4 and blocked overnight with PBS 0.5% BSA. Plates were incubated with different dilutions of serum for 1 h at 37 C. and then washed four times with PBS 0.05% Tween20. Goat anti-human IgM (-chain), anti IgG (Fab-specific) and IgA (-specific)-peroxidase conjugates (all from Sigma-Aldrich) were used to detect captured antibodies together with standard OPD substrate (Sigma-Aldrich) following manufacturer's instructions. Absorbance at 450 nm was registered using a BioRad Plate reader (BioRad, Madrid, Spain). Concentrations were calculated from calibration curves constructed with affinity-purified human IgA, IgG or IgM.
[0325] ACPA Test
[0326] Elia CCP Test (Thermo Scientific/Phadia, Sweden) was used to analyse whether anti-CD26 autoantibodies in RA were antibodies against a citrullinated CD26. Briefly, the test was used to bind the anti-CCP antibodies from patients' sera to the plate containing CPP antigens, according to the manufacturers' instructions. The remaining serum was recovered as negative-ACPA fraction. After washing the Elia-CCP plate to avoid unspecific binding, ACPA were eluted from the plate with Elution buffer (0.1 M Gly-HCl pH 2.7) and this buffer neutralized with 1 M Tris-HCl pH 9 to obtain the positive-ACPA fraction. Both fractions were then checked using the in-house anti-CD26 ELISA described above. In the same way, this latter ELISA was used to obtain a negative anti-CD26 Ab fraction (recovery of patients' serum after antibody (Ab) binding to the plate-bound CD26 Ag) and a positive-antiCD26 Ab fraction (obtained after washing and elution of the bound Ab) and both fractions analyzed using the Elia CCP test.
[0327] Sera from three RA patients showing high levels of anti-CD26 IgG isotype and three healthy donors were chosen. In all the ELISAs, only reagents to detect the IgG isotype (described above) were used.
[0328] Statistical Analysis
[0329] All analyses were parametric. The ANOVA test was carried out to compare variables among the four groups of patients with or without biological therapies. The post-hoc Scheff test was used for variables with homogeneous variances and the post-hoc Dunnett's C test was used for variables without homogeneous variances. Dunnett's t test was performed to compare each group with a control group, either the group without biological therapy or the healthy donor group. Student's t test was also used to compare variables between two groups. Statistical analyses were carried out using the SPSS version 20 software (SPSS, Chicago Ill., USA).
Example 2.Anti-CD26/DPP-IV Autoantibody Levels and their Correlations with Serum DPP-IV Activity and sCD26 Concentrations in the Healthy Donor Cohort
[0330] Autoantibodies against CD26 have been described in healthy donors and proposed to participate in antigen clearance via bile secretion (Cuchacovich M et al. Clin Exp Rheumatol. 2001. 19: 673-80). With our in-house ELISA, mean serum titers (n=25) of total immunoglobulin concentrations for the three isotypes under study are found coherent with the expected values, 2.371.24 mg/mL for IgM, 2.280.27 mg/mL for IgA and 12.282.79 mg/mL for IgG (Gonzalez-Quintela A et al. Clinical and Experimental Immunology. 2007. 151: 42-50). Mean anti-CD26 serum autoantibody titers are also quite similar to those previously published (Snir O et al. Arthritis Rheum. 2010. 62: 44-52. 10.1002/art.25036 [doi]), 13.515.62 g/mL for IgM, 1.280.27 g/mL for IgA and 2.140.64 g/mL for IgG, being the present values slightly lower for the IgM and IgA isotypes when compared to previous results published by Cuchacovich et al. (Cuchacovich M et al. Clin Exp Rheumatol. 2001. 19: 673-80) probably due to the fact that we used recombinant human antigen instead purified CD26 from human serum. However, comparing Cuchacovich et al. published ratios of anti-CD26 autoantibody/total Ig isotype with our data (7.12 for IgM, 0.57 for IgA and 0.19 for IgG), our results are more coherent with the expected values of total Igs titers. Importantly, none of the presented serum titer values, including the reduced anti-CD26 IgA isotype levels, nor their ratios, correlate with either serum DPP-IV activity or sCD26 concentrations in this cohort of healthy donors suggesting that if their function is related to antigen clearance, their effect on sCD26 levels is undetectable.
Example 3. Anti-CD26/DPP-IV and Total Antibody Levels in RA Patients Undergoing Different Therapies
[0331] 3.1 Anti-CD26/DPP-IV and Total Antibody Levels in the Whole Cohort
[0332] Analyzing our whole cohort of RA patients (n=106) we found higher levels of both total and anti-CD26 Ig titers. Total immunoglobulin concentrations for the three isotypes are 4.333.79 mg/mL for IgM, 5.611.77 mg/mL for IgA and 21.8115.35 mg/mL for IgG (Lambeir A M et al. Crit Rev Clin Lab Sci. 2003. 40: 209-94). Anti-CD26 autoantibody concentrations are 27.9719.09 g/mL for IgM, 2.011.34 g/mL for IgA and 5.873.13 g/mL for IgG, and auto-antibody/total isotype ratios are 17.10 for IgM, 0.43 for IgA and 0.75 for IgG. Thus, although all values of total Igs increase two-fold overall, it is interesting to note that ratios for IgA isotypes are lower compared to healthy donors whereas this was not the case for the IgM and particularly for IgG isotype ratio, being higher (next to 4-fold) and significantly different compared to healthy donors (p<0.001; ANOVA test), in addition to all mean values for total or auto-antiCD26 isotype titers (p<0.001 for most of them with the Student's T-test). These results point to the usefulness of anti-CD26 antibody titers as biomarker of RA.
[0333] 3.2 Anti-CD26/DPP-IV and Total Antibody Levels According to Therapy
[0334] The anti-CD20 therapy group may serve as control. Therapeutic mAbs that target the CD20 antigen on B cells are successfully used in the clinic for the depletion of B cells to treat various forms of cancer and autoimmune diseases, and thus by its mechanism of action reduce the levels of immunoglobulins in general. Anti-CD20 therapy was shown to reduce the levels of total IgG and particularly IgM, as expected, but had no effect on total IgA (Table 2) compared to the group without biological therapy. The observed decrease does not reach the antibody levels seen in healthy donors, however. On the contrary, the other biological therapies were shown to raise the levels of total IgG and IgM with the anti-IL6R/Ig-CTLA4 group being the only showing a slightly lower level of IgA (Table 2).
[0335] However, the effect of different therapies on anti-CD26 auto-Ab levels was different. The IgG isotype was not affected by any therapy; anti-CD20 strongly reduces only the IgM isotype and finally the IgA isotype is affected by both the anti-TNF and anti-IL6R/Ig-CTLA4 therapies but in contrary directions (Table 2). As a consequence, ratios for each of the three isotypes, are quite different compared to healthy subjects, particularly IgM for anti-TNF and anti-IL6R/Ig-CTLA4 BT, IgA for anti-CD20 and IL6R/Ig-CTLA4 BT, and IgG for NoBT and IL6R/Ig-CTLA4 BT, underlying the specificity of our results. Most of these differences were statistically significant (see Table 2). The same can be concluded when checking the isotype ratios (A/M, G/A, G/M) for total or for auto-Ab titers: statistically significant differences between patients and donors in some ratios (Table 3) and important differences among the therapies (
TABLE-US-00005 TABLE 2 Levels of total and anti-CD26 Ig isotypes in RA patients under different therapies HC (n = 25) No BT (n = 22) Anti-TNF BT (n = 58) Mean SD CI (95%) Mean SD CI (95%) Mean SD CI (95%) Anti-CD26 13.51 5.62* 7.11-24.53 30.30 20.49* 21.21-39.38 27.92 18.08 23.16-32.67 IgM (g/mL) Anti-CD26 1.28 0.27* 0.85-1.87 1.76 0.92* 1.35-2.17 2.32 + 1.51* 1.92-2.72 IgA (g/mL) Anti-CD26 2.14 0.64 0.98-3.58 5.60 3.13 4.21-6.98 6.08 3.15 5.25-6.91 IgG (g/mL) Total IgM 2.37 1.24* 0.73-3.72 3.26 3.28* 1.80-4.71 5.22 + 3.95* 4.18-6.26 (mg/mL) Total IgA 2.28 0.27 1.91-2.60 5.56 2.04 4.65-6.46 5.88 1.82* 5.38-6.34 (mg/mL) Total IgG 12.28 2.79 8.27-16.60 17.73 12.68 12.11-23.35 24.23 17.1* 19.74-28.73 (mg/mL) Ratio IgM 7.12 5.19 20.75 25.75 10.42 13.12* (g/mg) Ratio IgA 0.57 0.15 0.49 0.67 0.47 0.63* (g/mg) Ratio IgG 0.19 0.07 0.50 0.78 0.96 1.82* (g/mg) Anti-CD20 BT (n = 11) Anti-IL6R/Ig-CTLA4 BT (n = 15) Mean SD CI (95%) Mean SD CI (95%) Anti-CD26 16.85 15.15* 6.67-27.03 32.94 21.82 20.85-45.02 IgM (g/mL) Anti-CD26 1.81 1.44* 0.85-2.78 1.34 0.71* 0.95-1.73 IgA (g/mL) Anti-CD26 5.69 3.68 3.21-8.16 5.62 2.83 4.05-7.19 IgG (g/mL) Total IgM 2.23 2.26* 0.71-3.74 4.02 3.92 1.85-6.19 (mg/mL) Total IgA 5.46 1.11 4.71-6.21 4.81 1.38* 4.05-5.58 (mg/mL) Total IgG 15.73 11.35* 8.10-23.35 22.85 12.76 15.78-29.91 (mg/mL) Ratio IgM 20.36 33.05* 30.79 51.75* (g/mg) Ratio IgA 0.32 0.24* 0.29 0.16* (g/mg) Ratio IgG 0.79 1.05 0.29 0.17* (g/mg) n = number of samples; BT = biological therapy; CI = confidence interval; SD = standard deviation. *Values significantly different among groups (not specified) at p < 0.05 with Student's t test + Values significantly different to those of no biological therapy (No BT) group at p < 0.05 with Dunnett's t test.
TABLE-US-00006 TABLE 3 Ratios of total and anti-CD26 Ig isotypes in control and RA patients Controls RA patients (n = 25) (n = 106) Mean SD Mean SD Total Ig ratio A/M 1.3 1.0 3.7 6.7** Total Ig ratio G/A 5.4 1.3 4.8 7.3 Total Ig ratio G/M 6.7 5.2 11.3 18.6* Auto (anti-CD26) Ig ratio A/M 0.11 0.04 0.13 0.21 Auto (anti-CD26) Ig ratio G/A 1.7 0.6 7.5 27.1 Auto (anti-CD26) Ig ratio G/M 0.17 0.06 0.32 0.35** n = number of samples; SD = standard deviation. *Values significantly different among groups (not specified) at p < 0.05 with Student's t test. **Values significantly different among groups (not specified) at p < 0.001 with Student's t test
Example 4.Diagnostic Value of Anti-CD26/DPP-IV Antibody Levels
[0336] As our cohort of RA patients showed elevated titers of anti-CD26 autoantibodies, pointing to their utility to follow patients' responsiveness to therapy at individual level, we tested whether any of the isotype titers could have diagnostic value.
[0337] 4.1 Anti-CD26/DPP-IV Ig Levels in the Whole Cohort
[0338] The patients of the cohort under study have already been diagnosed and are undergoing therapy. Thus, this group of subjects is not ideal for the assessment of the diagnostic value of anti-CD26 antibody titers. However, the IgG isotype titers have shown to remain unchanged with the undergoing therapies and may thus be a good indicator.
[0339] In addition, to assay the performance of the biomarkers in a screening/diagnostic test, ROC curves have been prepared representing the obtained sensitivity vs 1-specificity values for the anti-CD26 of the IgG, IgM and IgA isotypes, finding the following AUCs and Specificity (E) and Sensibility (S) values for the calculated optimal cut-off: [0340] anti-CD26 IgM (
[0344] These cut-offs are, respectively, 1.41, 1.33, 1.17 and 1.26-fold than the reference values (mean of healthy donors' biomarker concentrations).
[0345] 4.2 Anti-CD26/DPP-IV Antibody Levels in Patients Undergoing DMARDs but No Biological Therapy
[0346] We then tested the group undergoing DMARDs but no biological therapy (noBT), which would better resemble undiagnosed patients and/or patients closer to pre-RA in the sense that these therapies do not change CD26 expression at least in the leukocyte populations (Ellingsen T et al. Scand J Immunol. 2007. 66: 451-7). A sensitivity of 77% (17/22) is found for the anti-CD26 IgG isotype (with a cut-off 2.85 microg/mL). A similar result, 73% (16/22) sensitivity is found for the anti-CD26 IgM (with a cut-off 20 microg/mL) and IgA 64% (with a cut-off 1.7 microg/mL) titers (
[0347] In addition, to assay the performance of the biomarkers in a screening/diagnostic test, ROC curves have been prepared representing the obtained sensitivity vs 1-specificity values for the anti-CD26 of the IgG, IgM and IgA isotypes, finding the following AUCs and Specificity (E) and Sensibility (S) values for the calculated optimal cut-off: [0348] anti-CD26 IgM (
[0352] These cut-offs are, respectively, 1.48, 1.33, 1.33 and 1.26-fold than the reference values (mean of healthy donors' biomarker concentrations).
[0353] It is noted that an important difference between the inventors' results and those previously published by Cuchacovich et al. (Cuchacovich M et al. Clin Exp Rheumatol. 2001. 19: 673-80 is that in the previous study higher anti-CD26 antibody titers were found in RA and other autoimmune diseases, in particular of the IgA isotype. However, the inventors have found elevated levels of the three classes tested but particularly for the IgM and IgG isotypes, which in fact showed better diagnostic values compared to the IgA isotype. It should be pointed that Cuchacovich et al. only discloses ratios of auto-Abs/total Ig for each isotype whereas under Example 3 above are presented the results for each of these individual determinations and for the ratio, and indeed show that anti-CD26 Ig levels of each isotype were independent to changes in the total levels of each isotype. The differences for the anti-CD26 antibody titers between both studies may also be related in part to the fact that we have used as an antigen for the ELISA a recombinant sCD26 protein instead of sCD26 antigen isolated from patient sera, which has been reported to be a more complex molecule (Cuchacovich M et al. Clin Exp Rheumatol. 2001. 19: 673-80, Lambeir A M et al. Crit Rev Clin Lab Sci. 2003. 40: 209-94, Cordero O J et al. Cancer Immunol Immunother. 2009. 58(11):1723-47).
Example 5.Diagnostic Value of Total IgA Antibody Levels
[0354] Interestingly, when performing ROC curves for anti-CD26 antibodies, total antibodies and the ratios thereof for the IgA, IgM and IgG isotypes, the inventors have observed that total IgA antibodies have shown to be a very good discriminator between healthy donors (HD) and the RA patient population both for the whole cohort (see
Example 6.Correlations of Anti-CD26/DPP-IV Antibody Levels with Disease Activity Parameters of RA Patients
[0355] The inventors have previously shown correlations between the DAS28 score, the DAS28 components (clinical: TJC, SJC, PGA, and laboratory variables: ESR and CRP, or other RA activity markers (HAQ, haemoglobin, platelet and haematocrit) with T cell subsets defined by the CD26 surface expression (Cordero O J et al. PLoS One. 2015. 10(7):e0131992).
[0356] 6.1 Anti-CD26/DPP-IV Antibody Levels in the Whole Cohort
[0357] Here, disease activity correlations were analysed first with total levels of each isotype, which include rheumatoid factor (RF) and ACPA, in the whole cohort. Total titers of the three Ig classes do not correlate with the DAS28, however some statistically significant correlations are still found between total titers for the three isotypes and ESR (r=0.272, p=0.005 for IgM; r=0.213, p=0.028 for IgG; r=0.280, p=0.004 for IgA). Moreover, IgG negatively correlate with TJC and total IgM with HAQ.
[0358] Anti-CD26 levels do neither correlate with the DAS28 score in the whole cohort. However, the three anti-CD26 auto-Ab Ig titers correlate negatively with TJC (r=0.272, p=0.036 for IgM; r=0.210, p=0.032 for IgG; r=0.273, p=0.005 for IgA); in addition, the anti-CD26 IgG levels negatively correlate with the haematocrit and anti-CD26 IgA titers with ESR (r=0.360, p<0.001 for the latter). Finally, the ratios of IgG and IgA isotypes correlated with the CRP.
[0359] 6.2 Anti-CD26/DPP-IV Antibody Levels According to Therapy
[0360] To check the effect that any of the different therapies may have on the correlations between the antibody levels and clinical scores, the same analysis (plus internal controls) was performed for each group of patients undergoing different therapies. In the no BT group, whereas strong correlations between all total Ig isotype titers are seen (and they show correlations with the platelet count) only anti-CD26 IgA and IgM isotype titers do show a correlation between them and only the IgA isotype ratio show a very strong correlation with TJC (r=0.704, p<0.001).
[0361] In the anti-TNF group, total IgA titers do not correlate with titers of the other two isotypes, showing only a positive correlation with the ESR, positively (data not shown). Total IgM titers also correlate positively with Hb and haematocrit and negatively with the CRP whereas IgG titers correlate negatively with the ESR and the platelet count (data not shown). Very interestingly, anti-CD26 IgA titers strongly correlate with TJC and DAS28 (
[0362] However, in the anti-CD20 group, these anti-CD26 IgG titers correlate very strongly with TJC, SJC, DAS28 and PGA (
[0363] Finally, in the anti-IL6R/Ig-CTLA4 group, whereas total IgA levels do not correlate with the other isotype titers (as in the anti-TNF group) and anti-CD26 IgA and IgM titers do not correlate between them (on the contrary to the noBT group), auto-Abs titers in the other combinations (IgA with IgG and IgM with IgG) do it. In this group, only the IgG isotype ratio correlates with TJC and total IgG with the hematocrit.
[0364] Altogether, the present data suggest: a) a specific relation between anti-CD26 auto-antibodies with the joints and disease activity, b) these antibody levels are differently affected by each therapy, and c) they provide a different information compared to the most frequently disease activity parameters used at present (ESR, CRP, platelet count, Hb levels or haematocrit).
Example 7.Higher Anti-CD26 Antibody Titers are Detected in Smokers
[0365] Tobacco is an environmental factor triggering autoimmunity in ACPA-positive RA (Reynisdottir G et al. Arthritis Rheum. 2014. 66(1):31-9. doi: 10.1002/art.38201, Catrina A I et al. Nat Rev Rheumatol. 2014. 10(11):645-53. doi: 10.1038/nrrheum.2014.115, Vossenaar E R et al. Arthritis Res Ther. 2004. 6: 107-111). We decided to compare mean titers for the three anti-CD26 isotypes dividing the whole RA patient cohort in three groups according to their smoking status, current (n=18), past (n=28) or non-smokers (n=59). Whereas IgA titers were similar among the three groups, both IgM and IgG showed higher levels in past smokers in particular (26.0 g/mL in non-smokers compared to 31.8 g/mL in past smokers for IgM, and 5.5 g/mL to 6.7 g/mL for IgG), although these differences did not achieve statistical significance.
[0366] We then analysed the RA cohort taking into account therapy (Table 4). Interestingly, in the no-BT group, anti-CD26 IgM titers are significantly higher in past smoker patients compared to non-smokers. Although there are few current smoker patients in this group, they also showed higher auto-antibody titers. The anti-CD26 IgG isotype also showed a trend to higher titers in past smokers compared to the other groups, although this trend did not achieve statistical significance. To note, whereas anti-CD26 IgG or IgA levels do not change among the different therapies, the anti-CD26 IgM levels were attenuated in past smokers in the anti-TNF group and in all patients in the anti-CD20 treatment group; however, in the anti-IL6R/Ig-CTLA4 treatment group non-smokers showed increased levels for the CD26 IgM isotype (Table 4).
TABLE-US-00007 TABLE 4 Titers of anti-CD26 Ig isotypes in RA patients under different therapies according to their smoking status No BT Anti-TNF BT Anti-CD20 BT Anti-IL6R/Ig-CTLA4 BT (n = 22) (n = 58) (n = 11) (n = 15) Mean SD (n) Mean SD (n) Mean SD (n) Mean SD (n) Anti-CD26 Non smokers 22.4 18.0 (12) 25.4 19.0 (33) 13.5 7.7 (3) 37.1 25.5 (10) IgM (g/mL) Smokers 28.6 3.8 (2) 33.0 16.5 (13) 9.7 9.1 (4) Past smokers 42.6 21.7* (8) 29.6 18.0 (11) 25.6 22.0 (4) 24.6 8.3 (5) Anti-CD26 Non smokers 4.6 3.2 5.9 3.4 4.8 4.0 5.7 3.1 IgG (g/mL) Smokers 8.1 1.6 6.0 2.9 4.0 2.0 Past smokers 6.4 2.9 6.9 2.7 7.9 4.0 5.6 2.7 Anti-CD26 Non smokers 1.6 0.8 2.4 1.6 1.4 2.1 1.3 0.8 IgA (g/mL) Smokers 1.7 1.4 2.1 1.3 2.1 0.8 Past smokers 2.0 1.0 2.4 1.6 2.1 1.2 1.5 0.7 n = number of samples; BT = biological therapy; SD = standard deviation; *Value significantly different at p < 0.05 with Student's t test between groups classified according to their smoking status (past smokers vs non smokers). Groups were compared only inside each type of therapy.
Example 8.ACPA Test
[0367] The obtained results, combining the well-established second-generation Elia CCP tool in the clinical practice together with our in-house ELISA for anti-CD26 auto-Abs (only the IgG isotype was tested), enable to conclude that auto anti-CD26 Abs are not ACPA. When supernatants of serum from both healthy donors and RA patients were recovered from the ACPA test and tested for the presence of anti-CD26 autoantibodies, an absorbance similar to that obtained with the same serum sample tested only using our anti-CD26 ELISA test (not shown) could be detected (
[0368] To verify these results, we also performed the inverse analysis, where supernatants recovered from the anti-CD26 ELISA were used later in the ACPA test. Although absorbances were similar to those obtained after the direct incubation of the same serum in the ACPA test, there were minor differences in four of the samples and more significant in two of them, one healthy control and one RA patient (
Example 9.Serum Anti-CD26 Auto-Antibodies and their Correlations with DPP-IV Activity and sCD26 Concentrations in the Cohort of RA Patients Under Different Therapies
[0369] 9.1 Serum Anti-CD26 Auto-Antibodies and their Correlations with DPP-IV Activity and sCD26 Concentrations in the Whole Cohort
[0370] As determined for the healthy control group (see Example 2 above), we analysed the correlations of the Ig isotypes and their ratios with the serum DPP-IV activity and sCD26 concentrations in the whole cohort of patients. Near statistically significant positive correlations were found between total IgG and anti-CD26 IgG with the sCD26 concentration but not enzymatic activity for the whole cohort.
9.2 Serum Anti-CD26 Auto-Antibodies and their Correlations with DPP-IV Activity and sCD26 Concentrations According to Therapy
[0371] When the same analysis was performed for each of the patients groups according to therapy many interesting correlations were found. In the group without BT (noBT), total levels of IgA and IgM positively correlate with the DPP-IV activity but not with the sCD26 concentration (
[0372] These results point to the idea that: a) auto-Ab levels do not relate to the reduction of their Ag (sCD26) concentrations in RA patients, since the only correlation seen was for the anti-TNF group, but a positive correlation instead; b) DPP-IV activity and sCD26 concentration, reduced in RA patients and affected by therapies (Cordero O J et al. PLoS One. 2015. 10(7):e0131992), are related to the same pathway that enhances anti-CD26 autoAb titers; c) together with the fact that different levels of correlation between DPP-IV activity and sCD26 concentration are found in each group of patients (they do not correlate in the no-BT and in the anti-IL6R/Ig-CTLA4 group and correlate strongest in the anti-CD20 group, data not shown), we also conclude that DPP-IV activity and sCD26 concentration are implicated in RA pathogenesis in different ways; and d) finally, different therapies have a profound impact in these pathways even in opposite ways.
[0373] Interestingly Cuchacovich et al showed a negative correlation between the (circulating levels of DPP-IV and titers of anti-CD26 IgA autoantibodies in RA (Cuchacovich M et al. Clin Exp Rheumatol. 2001. 19: 673-80, Cuchacovich M et al. Clin Diagn Lab Immunol. 2002. 9:1253-9), a correlation which was not found in the present study. On the contrary, when correlations were found these were positive and mostly for the anti-CD26 IgG and IgM isotypes. We did found a negative correlation in the anti-CD20 group of patients but in this group therapy was found to decrease the autoantibody levels in general. It can be concluded, therefore, that impairment of DPP-IV activity and sCD26 concentration in RA patients is related to the same pathway that enhances anti-CD26 auto-Ab titers, which thus do not appear to be involved in the clearance of sCD26 from serum as the more prominent role.
Example 10.Serum Anti-CD26 Auto-Antibodies and their Relationship with ACPA Analysis
[0374] Early diagnosis and treatment of RA has been associated with positive treatment outcome and RA remission. However, the sensitivity of anti-citrullinated peptides antibodies (ACPA), the most specific biomarker for RA up to date, is about 75% in established RA compared with 55% in early RA and 40% in very early RA (Nicaise R P, et al., Arthritis Res Ther 2008; 10:R142; Ohmura K, et al. Rheumatology 2010; 49:2298-304).
[0375] The serum anti-CD26 levels in a cohort of RA patients under different biological and non-biological therapies were measured as disclosed in Example 2 (see Table 3). With the cut-off points obtained for serum IgA, IgM and IgG anti-CD26 titers using also a healthy donor group (n=25), we had obtained high sensitivity and specificity data (see Example 4). Here, we compared the positivity for both anti-CD26 and ACPA auto-antibodies.
[0376] ACPA levels in the patients' serum were measured using a standard EliA CCPFully Automated Anti-CCP second generation detection test (Phadia, Thermo Fisher Scientific). In this automated enzyme-linked immunosorbent assay (ELISA), anti-CCP antibodies of the isotype IgG were detected in the samples and the result calibrated against a standardized curve. Samples with a value of 10 EliA U/mL were considered ACPA positive, in accordance with the manufacturer's instructions. Positivity with respect to anti-CD26 antibodies was assigned to values above the cut-off levels defined in Example 4.
[0377] Testing anti-CCP showed that 22 diagnosed RA patients were ACPA-negative. In this group of patients sensitivity of 77% (17/22 positives) was found for the anti-CD26 IgG isotype, which is the same we found with the same cut-off in the group of patients under DMARDs (which may be closer to undiagnosed people). A similar result, 14/22 instead of 16/22 positives, was found for the anti-CD26 IgA. However, the results were worse for the IgM (10/22 instead of 16/22 positives). Interestingly, 100% of ACPA-negative patients were total IgA positives. The obtained results suggest that auto-antibodies against CD26/DPP-IV participate in RA pathogenesis in an independent way than ACPA, and may serve for earlier diagnosis.
TABLE-US-00008 TABLE 5 Frequencies of positivity for anti-CD26 Ig isotypes in RA patients classified according to their ACPA status ACPA ACPA+ Total (n = 22) (n = 53) (n = 106) (%) (%) (%) Anti-CD26 IgM 45 66 62 Anti-CD26 IgA 64 60 60 Anti-CD26 IgG 77 87 82