TOBACCO PLANT AND METHOD FOR MANUFACTURING SAME
20200392523 ยท 2020-12-17
Assignee
Inventors
- Shoichi Suzuki (Tokyo, JP)
- Kaori Hamano (Tokyo, JP)
- Seiki Sato (Tokyo, JP)
- Masao Arai (Tokyo, JP)
- Yuta Negishi (Tokyo, JP)
- Ayako Nomura (Tokyo, JP)
- Mai Tsukahara (Tokyo, JP)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N15/8218
CHEMISTRY; METALLURGY
C12N2310/111
CHEMISTRY; METALLURGY
C12N15/8213
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
A01H1/00
HUMAN NECESSITIES
A01H5/00
HUMAN NECESSITIES
Abstract
The present invention provides a tobacco plant which is suitable for cultivation for harvesting leaf tobaccos. The present invention includes (i) a tobacco plant in which a mutation for suppressing the development of axillary buds is introduced and (ii) a method of producing the tobacco plant.
Claims
1. A tobacco plant in which a mutation is introduced into a genome, which mutation causes functional suppression of any of the following genes (1) through (3): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppressing development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, the functional suppression being a decrease in abundance of the polypeptide in comparison with a wild-type plant, the functional suppression being promotion of degradation of an mRNA transcribed from any of the above genes (1) through (3), the mutation being insertion, into an outside of a region in which any of the above genes (1) through (3) is present, of a polynucleotide expressing a factor which promotes the degradation of the mRNA, and the factor being an antisense RNA molecule or an RNAi molecule.
2. A tobacco plant in which a mutation is introduced into a genome, which mutation causes functional suppression of any of the following genes (1) through (4): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (4) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppressing development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, and the mutation being introduced into any of the above genes (1) through (4).
3. The tobacco plant as set forth in claim 1, wherein the functional suppression causes the number or weight of the secondary axillary buds to decrease to not more than of that of a wild-type plant.
4. The tobacco plant as set forth in claim 2, wherein the functional suppression causes the number or weight of the secondary axillary buds to decrease to not more than of that of a wild-type plant.
5. The tobacco plant as set forth in claim 2, wherein the functional suppression is a decrease in abundance of the polypeptide in comparison with a wild-type plant.
6. The tobacco plant as set forth in claim 4, wherein the functional suppression is a decrease in an amount of translation of the polypeptide in comparison with a wild-type plant.
7. The tobacco plant as set forth in claim 4, wherein the functional suppression is a decrease in an amount of transcription from any of the above genes (1) through (4) to an mRNA in comparison with a wild-type plant.
8. The tobacco plant as set forth in claim 4, wherein the functional suppression is promotion of degradation of an mRNA transcribed from any of the above genes (1) through (4).
9. The tobacco plant as set forth in claim 2, wherein the mutation is introduced by spontaneous mutation, mutagen treatment, genome editing, or gene knockout.
10. The tobacco plant as set forth in claim 1, wherein the tobacco plant belongs to Nicotiana tabacum or Nicotiana rustica.
11. The tobacco plant as set forth in claim 2, wherein the tobacco plant belongs to Nicotiana tabacum or Nicotiana rustica.
12. A method of producing a tobacco plant, comprising the step of: (a) introducing a mutation that causes functional suppression of any of the following genes (1) through (3): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppressing development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, the step (a) including inserting, into an outside of a region in which any of the above genes (1) through (3) is present, a polynucleotide expressing a factor which promotes degradation of an mRNA transcribed from any of the above genes (1) through (3), and the factor being an antisense RNA molecule or an RNAi molecule.
13. A method of producing a tobacco plant, comprising the step of: (a) introducing a mutation that causes functional suppression of any of the following genes (1) through (4): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (4) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppressing development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, and the step (a) including introducing the mutation into any of the above genes (1) through (4).
14. The method as set forth in claim 12, further comprising the step of: (b) selecting, from individuals produced by the step (a), an individual in which development of, of all of the axillary buds, secondary axillary buds that develop after removal of primary axillary buds is suppressed.
15. The method as set forth in claim 13, further comprising the step of: (b) selecting, from individuals produced by the step (a), an individual in which development of, of all of the axillary buds, secondary axillary buds that develop after removal of primary axillary buds is suppressed.
16. The method as set forth in claim 14, wherein in the step (b), an individual, in which the number or weight of the secondary axillary buds is decreased in comparison with that of a wild-type plant, is selected.
17. The method as set forth in claim 15, wherein in the step (b), an individual, in which the number or weight of the secondary axillary buds is decreased in comparison with that of a wild-type plant, is selected.
18. The method as set forth in claim 13, wherein the step (a) is carried out by spontaneous mutation, mutagen treatment, genome editing, or gene knockout.
19. An offspring or a bred progeny, wherein: the offspring is of a tobacco plant recited in claim 1; the bred progeny is obtained by crossing a tobacco plant recited in claim 1; and the following (A) is satisfied: (A) a mutation is introduced into a genome, which mutation causes functional suppression of any of the following genes (1) through (3): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppresses development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, the functional suppression is a decrease in abundance of the polypeptide in comparison with a wild-type plant, the functional suppression is promotion of degradation of an mRNA transcribed from any of the above genes (1) through (3), the mutation is insertion, into an outside of a region in which any of the above genes (1) through (3) is present, of a polynucleotide expressing a factor which promotes the degradation of the mRNA, and the factor is an antisense RNA molecule or an RNAi molecule.
20. An offspring or a bred progeny, wherein: the offspring is of a tobacco plant recited in claim 2; the bred progeny is obtained by crossing a tobacco plant recited in claim 2; and the following (B) is satisfied: (B) a mutation is introduced into a genome, which mutation causes functional suppression of any of the following genes (1) through (4): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (4) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppressing development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, and the mutation is introduced into any of the above genes (1) through (4).
21. An offspring or a bred progeny, wherein: the offspring is of a tobacco plant produced by a method recited in claim 12; the bred progeny is obtained by crossing a tobacco plant produced by a method recited in claim 12; and the following (A) is satisfied: (A) a mutation is introduced into a genome, which mutation causes functional suppression of any of the following genes (1) through (3): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppresses development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, the functional suppression is a decrease in abundance of the polypeptide in comparison with a wild-type plant, the functional suppression is promotion of degradation of an mRNA transcribed from any of the above genes (1) through (3), the mutation is insertion, into an outside of a region in which any of the above genes (1) through (3) is present, of a polynucleotide expressing a factor which promotes the degradation of the mRNA, and the factor is an antisense RNA molecule or an RNAi molecule.
22. An offspring or a bred progeny, wherein: the offspring is of a tobacco plant produced by a method recited in claim 13; the bred progeny is obtained by crossing a tobacco plant produced by a method recited in claim 13; and the following (B) is satisfied: (B) a mutation is introduced into a genome, which mutation causes functional suppression of any of the following genes (1) through (4): (1) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7; (2) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (3) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (4) at least one of a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a gene containing, as a coding region, a polynucleotide encoding a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19, the functional suppression suppressing development of, of all of axillary buds, secondary axillary buds which develop after removal of primary axillary buds, and the mutation is introduced into any of the above genes (1) through (4).
23. A leaf tobacco harvested from a tobacco plant recited in claim 1.
24. A leaf tobacco harvested from a tobacco plant recited in claim 2.
25. A leaf tobacco harvested from a tobacco plant produced by a method recited in claim 12.
26. A leaf tobacco harvested from a tobacco plant produced by a method recited in claim 13.
27. A leaf tobacco harvested from an offspring or a bred progeny recited in claim 19.
28. A leaf tobacco harvested from an offspring or a bred progeny recited in claim 20.
29. A leaf tobacco harvested from an offspring or a bred progeny recited in claim 21.
30. A leaf tobacco harvested from an offspring or a bred progeny recited in claim 22.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
DESCRIPTION OF EMBODIMENTS
[0092] [1. Tobacco Plant]
[0093] In one aspect, the present invention provides a tobacco plant in which a mutation is introduced into genome, which mutation causes suppression of the function of a gene containing, as a coding region, a polynucleotide encoding a specific polypeptide. It should be noted that the above functional suppression is to suppress the development of axillary buds.
[0094] Concrete examples of the specific polypeptide encompass (i) at least one of (a) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 1 and (b) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 3; (ii) at least one of (a) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and (b) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7; (iii) at least one of (a) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and (b) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11; (iv) at least one of (a) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and (b) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and (v) at least one of (a) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and (b) a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19.
[0095] As demonstrated in Examples described later, although the tobacco plant does not show any substantial difference from a wild-type one in terms of the number or weight of primary axillary buds, the tobacco plant either (i) shows a considerable decrease (for example, or lower than a wild-type plant) in the number or weight of axillary buds (i.e., secondary axillary buds and tertiary axillary buds) to be generated after the removal of the primary axillary buds or (ii) does not show any axillary buds after the removal of the primary axillary buds. Therefore, axillary buds are completely removed from the tobacco plant in accordance with an aspect of the present invention by substantially a single removal process. This allows the amount of labor, which is involved in control of axillary buds in cultivation of a tobacco plant for harvesting leaf tobaccos, to be less than a fraction of the amount of labor involved in such a conventional control of axillary buds.
[0096] As described above, the literature disclosing the conventional technologies merely discloses that the development of axillary buds is entirely suppressed in plants other than tobacco plants. For the reasons described below, however, suppression of entire development of axillary buds does not necessarily bring only advantages. The capability of development of axillary buds is an important function for maintaining the health of individuals of seed plants. For example, in a case where shoot apical meristem is damaged, an individual tries to survive by causing an axillary bud to start growing instead of the tissue. Therefore, it is expected that in a case where this function is entirely lost, the health of individuals is inevitably at risk. In fact, Non-Patent Literature 9 (legend of
[0097] As used herein, tobacco plant and tobacco encompass (i) an entire individual (such as a mature plant, a seedling, and a seed), (ii) tissue (such as a leaf, a stem, a flower, a root, a reproductive organ, an embryo, and a part of any of these), and (iii) a dried product of any of these.
[0098] As used herein, axillary bud refers to both (i) a bud which is generated from an axillary meristem formed at a leaf axil of a leaf primordia and (ii) a shoot obtained as a result of the development of the bud. After topping, axillary buds develop in an order of primary axillary buds, secondary axillary buds, and then tertiary axillary buds, at a base of the same leaf. First, after topping, the primary axillary buds develop. After the primary axillary buds are removed, the secondary axillary buds develop. The development of an axillary bud means that the axillary bud, which remained as differentiated tissues from the axillary meristem, starts vigorous development due to, for example, removal of a shoot apex (topping), so that the axillary bud grows and extends.
[0099] The number or weight of axillary buds means the number or a total mass (fresh weight) of axillary buds which have developed in one individual and have been collected. The number or weight applies to any of primary axillary buds, secondary axillary buds, and tertiary axillary buds.
[0100] As used herein, sequence identity (of an amino acid sequence) means a percentage ratio at which a concerned (amino acid) sequence matches a reference (amino acid) sequence. Note that a part of the sequence, which part does not match, is a part at which an amino acid residue is substituted, added, deleted, or inserted.
[0101] Note that the term polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by [ . . . ], which specifies the polypeptide with use of an amino acid sequence listed in a sequence listing, means a wild-type polypeptide. The wild-type polypeptide means a polypeptide which is typically present in a Nicotiana plant described later.
[0102] Therefore, a specific polypeptide, which is decreased in abundance in the tobacco plant in accordance with an aspect of the present invention, need only be a polypeptide having a sequence identity of 90% or higher with each of the amino acid sequences listed in the sequence listing. A higher sequence identity is more preferable (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or higher).
[0103] The decrease in abundance of a polypeptide means the presence of the polypeptide in an amount of 70% or lower, 60% or lower, 50% or lower, 40% or lower, 30% or lower, 20% or lower, 10% or lower, 5% or lower, or 1% or lower, relative to the abundance of a wild-type polypeptide as a reference. The abundance of the polypeptide relative to that of the wild-type polypeptide as a reference can be selected as appropriate from the above values which result in a decrease in the number or weight of secondary axillary buds.
[0104] It is preferable that the above-described decrease in abundance of a polypeptide in the tobacco plant in accordance with an aspect of the present invention is, with stability, genetically inherited by cultured cell, callus, protoplast, seed, and offspring, any of which is obtained from the tobacco plant. Therefore, the tobacco plant in accordance with an aspect of the present invention can be an individual developed from cultured cell, cell, callus, protoplast, seed, and offspring, any of which is produced through artificial operation. In addition, these materials, from which the individual develops, are also encompassed in the scope of the present invention.
[0105] The scope of the tobacco plant in accordance with an aspect of the present invention can further encompass bred progeny obtained by crossing. Breeding with use of mutants has been done in many plant species. Representative examples of such plant species encompass rice, wheat, barley, and soybean. For example, a mutant isolated from a mutant population treated by a mutagen has multiple mutations other than at a region of a target gene. In general, therefore, backcrossing is to be performed to remove excess mutations. In the course of breeding, the mutant can be crossed with a cultivar having excellent character so that a character of the mutant is introduced into the cultivar. This results in obtaining a cultivar having high additional values. Since the character of a mutant is derived from a mutation, it is necessary to select an individual having a mutation so as to proceed backcrossing. In order to proceed efficient backcrossing, it is necessary to carry out a method in which it is easy to determine (i) whether or not there is a mutation and (ii) whether or not the mutation is homozygous or heterozygous. This method can be carried out through a method of detecting a mutation (described later). In addition, in a case where marker assisted selection (MAS) is performed with use of a background marker indicative of a polymorphism between the mutant and the cultivar, it is possible to efficiently obtain, with the fewer times of crossing, a line having a high proportion of genome from the cultivar. A polymorphic marker can be SNP or Simple Sequence Repeat (SSR), each of which is publicly known in tobacco. If necessary, a genome sequence of tobacco is analyze so as to identify (i) a difference in nucleotide sequence and (ii) a difference in the number of repeat sequences. This allows a new polymorphic marker to be obtained and utilized.
[0106] As used herein, functional suppression of a gene means a state in which the gene on a genome is not fulfilling its original function. Therefore, functional suppression of a gene is a term encompassing (i) gene disruption, (ii) gene mutation, and (iii) suppression of gene expression by another gene (including an exogenous gene).
[0107] Gene and genome will be described below by taking Nicotiana tabacum (N. tabacum) as a reference. Nicotiana tabacum (N. tabacum), which serves as a reference in the description below, is an amphidiploid and has both an S genome and a T genome derived from Nicotiana sylvestris and Nicotiana tomentosiformis, respectively, each of which is an ancestor species thereof. In N. tabacum, in many cases, genes indicated by an identical name are present in each genome. Therefore, such genes include two alleles in an S genome and two allelic genes in a T genome. In other words, on the genome of N. tabacum, four genes indicated by an identical name are present in many cases.
[0108] Note that in a coding region of a tobacco plant, a nucleotide sequence of part (not the whole) of genes encoding proteins, which possesses the substantially same function between species, may have (i) 1% to several % difference between cultivars and (ii) approximately 10% or lower difference between a cultivar and wild species.
[0109] Gene disruption means that (i) a gene, which is originally present on a genome, is not present on the genome or (ii) a transcribed product is not produced from a gene on a genome. Gene mutation means (i) a mutation of a gene such that a protein having an original function is not produced, (ii) a mutation of the gene such that while a protein is produced, the amount of the protein produced is decreased, or (iii) a mutation of the gene such that although a protein is produced, the stability of the protein is decreased. Suppression of gene expression means a state in which although no change has occurred to the gene, the function of the gene (from transcription into mRNA to subsequent translation into protein) is modified through another factor so that (i) the amount of protein produced is decreased or (ii) no protein is produced. Suppression of gene expression may occur as a result of, for example, degradation of mRNA which is transcribed from the gene.
[0110] As used herein, mutation has the meaning as ordinarily understood in the technical field of the present application, and means, for example, a change in a nucleotide on a wild-type genome or a change in an amino acid residue in a wild-type protein (examples of the change encompass substitution, deletion, insertion, addition, duplication, and inversion). Examples of the change in the nucleotide on the genome further encompass translocation of a plurality of nucleotides.
[0111] A polypeptide, which has a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, or 19, is a polypeptide which is present in a wild-type plant (or a variant thereof). Therefore, the abundance of the polypeptide in the tobacco plant in accordance with an aspect of the present invention is decreased in comparison with that of a wild-type plant. This causes the tobacco plant to be inferior to the wild-type plant in terms of the function. Examples of the function encompass a function of a wild-type plant, such as (i) a function to form axillary meristem, (ii) a function to differentiate an axillary bud from axillary meristem, or (iii) a function to maintain or promote the capability of the development of an axillary bud.
[0112] A polypeptide having an amino acid sequence represented by SEQ ID NO. 1 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 2. A polypeptide having an amino acid sequence represented by SEQ ID NO. 3 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 4. These polynucleotides are each cDNA of NtREV gene demonstrated in Examples described later. SEQ ID NO. 2 represents a cDNA sequence of NtREV gene of an S genome. SEQ ID NO. 4 represents a cDNA sequence of NtREV gene of a T genome. SEQ ID NOs. 21 and 22 represent nucleotide sequences of an S genome and a T genome, respectively, of NtREV gene. SEQ ID NOs. 54 and 55 represent nucleotide sequences of an S genome and a T genome, respectively, of NtREV gene (including 5 upstream and 3 downstream).
[0113] A polypeptide having an amino acid sequence represented by SEQ ID NO. 5 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 6. A polypeptide having an amino acid sequence represented by SEQ ID NO. 7 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 8. These polynucleotides are each cDNA of NtLS gene demonstrated in Examples described later. SEQ ID NO. 6 represents a cDNA sequence of NtLS gene of an S genome. SEQ ID NO. 8 represents a cDNA sequence of NtLS gene of a T genome. SEQ ID NOs. 23 and 24 represent nucleotide sequences of an S genome and a T genome, respectively, of NtLS gene. SEQ ID NOs. 56 and 57 represent nucleotide sequences of an S genome and a T genome, respectively, of NtLS gene (including 5 upstream and 3 downstream).
[0114] A polypeptide having an amino acid sequence represented by SEQ ID NO. 9 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 10. A polypeptide having an amino acid sequence represented by SEQ ID NO. 11 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 12. These polynucleotides are each cDNA of NtBl1 gene demonstrated in Examples described later. SEQ ID NO. 10 represents a cDNA sequence of NtBl1 gene of an S genome. SEQ ID NO. 12 represents a cDNA sequence of NtBl1 gene of a T genome. SEQ ID NOs. 25 and 26 represent nucleotide sequences of an S genome and a T genome, respectively, of NtBl1 gene. SEQ ID NOs. 58 through 61 represent nucleotide sequences of an S genome and a T genome, respectively, of NtBl1 gene (including 5 upstream and 3 downstream).
[0115] A polypeptide having an amino acid sequence represented by SEQ ID NO. 13 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 14. A polypeptide having an amino acid sequence represented by SEQ ID NO. 15 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 16. These polynucleotides are each cDNA of #15360 demonstrated in Examples described later. SEQ ID NO. 14 represents a cDNA sequence of #15360 of an S genome. SEQ ID NO. 16 represents a cDNA sequence of #15360 of a T genome. SEQ ID NOs. 27 and 28 represent nucleotide sequences of an S genome and a T genome, respectively, of #15360. SEQ ID NOs. 62 and 63 represent nucleotide sequences of an S genome and a T genome, respectively, of #15360 (including 5 upstream and 3 downstream).
[0116] A polypeptide having an amino acid sequence represented by SEQ ID NO. 17 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 18. A polypeptide having an amino acid sequence represented by SEQ ID NO. 19 is encoded by, for example, a polynucleotide having a nucleotide sequence represented by SEQ ID NO. 20. These polynucleotides are each cDNA of #07437 demonstrated in Examples described later. SEQ ID NO. 18 represents a cDNA sequence of #07437 of an S genome. SEQ ID NO. 20 represents a cDNA sequence of #07437 of a T genome. SEQ ID NOs. 29 and 30 represent nucleotide sequences of an S genome and a T genome, respectively, of #07437.
[0117] It is believed that the #07437 gene is, due to sequence homology, a gene which is to be classified as CUC. As for CUC genes in Arabidopsis thaliana, three CUC genes, CUC1 through CUC3, have been reported. It is also known that a plurality of accumulated mutations show a larger effect on a phenotype of a mutant than a single mutation. The inventors of the present invention isolated five genes as family genes from tobacco, other than #07437. These family genes are expected to produce a larger effect by being used together with #07437.
[0118] In the tobacco plant in accordance with an aspect of the present invention, an abundance of the above-described specific polypeptide is preferably decreased. Specifically, the abundance is decreased through mutation, disruption, or suppressed expression of a gene encoding the wild-type polypeptide.
[0119] The gene mutation or the gene disruption occurs as a result of, for example, spontaneous mutation, mutagen treatment, genome editing, or gene knockout. The spontaneous mutation of the gene generally occurs due to (i) replication errors and (ii) damage to the gene. The cause of the damage is, for example, exposure to publicly-known, naturally-occurring mutagens or publicly-known mutagens which have been artificially produced and then remaining in a natural environment (for example, radiation, ultraviolet rays, or mutation-inducing substances (such as EMS)). The gene can be subjected to a mutagen treatment by artificially causing the mutagen to take effect on a tobacco plant (as necessary, in combination with suppression of a gene repair function). Recombination of the gene can be performed by homologous recombination of all or part of a target gene with a recombinant sequence according to a publicly-known genetic recombination method. Genome editing of the gene can be performed by a publicly-known technique (for example, zinc-finger nucleases: ZFN, transcription activator-like effector nucleases: TALEN, and CRISPR/Cas9 system). The gene knockout can be performed by (i) transfer of the gene with use of a publicly-known transposase or (ii) introduction of T-DNA.
[0120] As described above, a tobacco plant in many cases has 2 sets of genes in each of a T genome and an S genome. Therefore, in order for the functions of the genes to completely disappear, it is necessary to impair the functions of all of the (four) genes in the T genome and the S genome. However, in a case where a dosage effect is exhibited, the functions of the genes can be suppressed even if the functions of all genes in the T genome and the S genome are not impaired.
[0121] In a case where the functions are impaired by substitution, the substitution can be present in at least one of the following: a promoter sequence (such as a sequence upstream (5 end) and a sequence downstream (3 end) with the coding region as a reference), a 5 untranslated region and a 3 untranslated region, a conserved sequence (5GT-AG3) present at both ends of an intron, and a coding region. It is expected that in a case where substitution occurs to nucleotide sequences (a promoter sequence, a 5 untranslated region, and a 3 untranslated region) which are important for regulating transcription activity of genes, the amount of transcribed product of the genes, which depends on transcriptional activity and stability of the genes, decreases, so that the amount of proteins decreases. In a case where substitution occurs to a conserved sequence of an intron, splicing does not occur normally, so that the intron can be translated additionally. It is expected that proteins having amino acid sequences different from original sequences are therefore generated by the translation due to frame shifting. It is expected that in a case where the substitution occurs to a coding region, for example, substitution into a stop codon which does not encode an amino acid (nonsense mutation) causes translation into a protein having a C-terminus side shortened so as to have an incomplete length, so that a function is impaired. While a position at which a nonsense mutation occurs is not limited provided that a full-length protein is not generated, it is preferable that the length is shortened by equal to or longer than several amino acids.
[0122] Alternatively, it is expected that substitution of an amino acid sequence causes the function of a protein to decrease. It is also expected that substitution of an amino acid sequence results in (i) a change of a tertiary structure and (ii) a change of an amino acid which is important for a function. Non-conservative substitution easily causes a decrease in function, and is therefore preferable as substitution of an amino acid. Examples of the non-conservative substitution encompass (i) substitution of an amino acid by another amino acid having a different electric charge or a different hydrophobicity (e.g., substitution of a basic amino acid by an acidic amino acid or substitution of a polar amino acid by a non-polar amino acid) and (ii) substitution of an amino acid by another amino acid having a different bulk (three-dimensional size) of a side chain.
[0123] In a case of a mutation other than substitution such as deletion and insertion, it is expected that the mutation, which occurred within a promoter sequence, a 5 untranslated region, and a 3 untranslated region, causes a decrease in transcriptional activity and stability as in the case of the substitution, so that (i) the amount of transcribed product is reduced and (ii) the amount of protein is reduced. In a conserved sequence of an intron, it is also expected that as in the case of substitution, proteins having amino acid sequences different from original sequences are generated by the translation. It is expected that the mutation, which occurred in a coding region, causes proteins, which have amino acid sequences different from original sequences, to be generated by the translation, the difference in amino acid sequences occurring due to (i) deletion or insertion of an amino acid residue (caused by deletion or insertion of consecutive nucleotides which are multiples of 3) or (ii) frame shifting. In a case where a large deletion of the entire gene itself or an insertion of a large fragment, it is also expected that the expression of the gene may be completely lost.
[0124] An individual, which was generated as a result of the gene mutation or gene disruption, is herein called a mutant (hereinafter simply referred to as mutant) of a tobacco plant. The mutant can have the mutation in any of an S genome or a T genome, and preferably has the mutation in both the S genome and the T genome. Note that (i) a single mutation or a plurality of mutations can occur in a single gene and (ii) the kind of mutation to impair a function is not limited. The total of four genes, which include two genes in an S genome and two genes in a T genome, can have identical mutations or different mutations.
[0125] Examples of suppression of the gene expression encompass (i) suppression of transcription from the gene to an mRNA, (ii) suppression (e.g., degradation of the mRNA) of translation from the gene into a protein through an mRNA and (iii) suppression of the function of the protein which is generated by the translation. The suppression of the transcription can be achieved by, for example, (i) inhibition of a transcription factor which promotes the transcription from the gene or (ii) inhibition of access of a transcription initiation factor to the gene. The suppression of the translation can be achieved by use of an antisense RNA molecule, an RNAi molecule, or a co-suppression molecule. The suppression of the function of the protein can be achieved by a molecule which inhibits the function of a functional protein by binding to the functional protein. Examples of such a molecule encompass decoy nucleic acid, ribozyme, antibody, and inhibitory peptide.
[0126] The various mutations described above can be easily introduced into a tobacco plant by a person skilled in the art who has referred to, for example, (i) any of the following publicly-known genome sequences of genes and (ii) genome sequences of genes represented by SEQ ID NOs. 54 through 63. Specifically, based on these pieces of sequence information, it is possible to appropriately determine a region which is present in a genome of any of various tobacco plants encompassed in the scope of the present invention and at which a mutation should be introduced.
NtREV: (S genome) Sol Genomics Network (SOL) accession #Ntab-K326_AWOJ-5517907, and (T genome) Sol accession #Ntab-K326_AWOJ-SS9429
NtLS: (S genome) SOL accession #Ntab-K326_AWOJ-551238, and (T genome) SOL accession #Ntab-K326_AWOJ-555309
NtBl1: (S genome) SOL accession #Ntab-K326_AWOJ-SS18396, and (T genome) SOL accession #Ntab-K326_AWOJ-SS12956
#15360: (S genome) SOL accession #Ntab-K326_AWOJ-55587, and (T genome) SOL accession #Ntab-K326_AWOJ-SS20471
#07437: (S genome) SOL accession #Ntab-K326_AWOJ-55943, and (T genome) GeneBank accession #AYMY01348769.1, AWOK01667329.1, and ASAG01052465.1.
[0127] The above-described suppression (of the transcription, translation, and protein function) can be achieved by, for example, (i) directly introducing molecules for achieving the suppression into a plant or (ii) expression of the molecules which are expressed from genes in a vector introduced into a plant by transformation. In the transformation of the plant, the target gene for expressing the molecules only needs to be integrated with any region of a genome of the plant, and does not necessarily need to be integrated with both an S genome and a T genome.
[0128] The tobacco plant is not limited to any particular one provided that the tobacco plant is a Nicotiana plant which is not limited to any particular one provided that the Nicotiana plant is a plant belonging to Nicotiana. Examples of the tobacco plant encompass Nicotiana acaulis, Nicotiana acuminata, Nicotiana acuminata var. multzjlora, Nicotiana africana, Nicotiana alata, Nicotiana amplexicaulis, Nicotiana arentsii, Nicotiana attenuata, Nicotiana benavidesii, Nicotiana benthamiana, Nicotiana bigelovii, Nicotiana bonariensis, Nicotiana cavicola, Nicotiana clevelandii, Nicotiana cordifolia, Nicotiana corymbosa, Nicotiana debneyi, Nicotiana excelsior, Nicotiana forgetiana, Nicotiana fragrans, Nicotiana glauca, Nicotiana glutinosa, Nicotiana goodspeedii, Nicotiana gossei, Nicotiana ingulba, Nicotiana kawakamii, Nicotiana knightiana, Nicotiana langsdorfi, Nicotiana linearis, Nicotiana longiflora, Nicotiana maritima, Nicotiana megalosiphon, Nicotiana miersii, Nicotiana noctiflora, Nicotiana nudicaulis, Nicotiana obtusifolia, Nicotiana occidentalis, Nicotiana occidentalis subsp. Hesperis, Nicotiana otophora, Nicotiana paniculata, Nicotiana pauczjlora, Nicotiana petunioides, Nicotiana plumbaginifolia, Nicotiana quadrivalvis, Nicotiana raimondii, Nicotiana repanda, Nicotiana rosulata, Nicotiana rosulata subsp. Ingulba, Nicotiana rotundifolia, Nicotiana rustica, Nicotiana setchellii, Nicotiana simulans, Nicotiana solanifolia, Nicotiana spegauinii, Nicotiana stocktonii, Nicotiana suaveolens, Nicotiana sylvestris, Nicotiana tabacum, Nicotiana thyrsiflora, Nicotiana tomentosa, Nicotiana tomentosifomis, Nicotiana trigonophylla, Nicotiana umbratica, Nicotiana undulata, Nicotiana velutina, Nicotiana wigandioides, and a hybrid of Nicotiana plants. Among these Nicotiana plants, Nicotiana benthamiana, Nicotiana rustica, and Nicotiana tabacum are more preferable. Nicotiana rustica and Nicotiana tabacum, which are used as materials to produce leaf tobacco, are particularly preferable.
[0129] In addition to the above action, the tobacco plant in accordance with an aspect of the present invention has a characteristic that the position of a primary axillary bud shifts from a base of a leaf. This brings about practicality in an actual cultivation site that axillary buds can be removed without damaging leaves. In connection to this practicality, the tobacco plant in accordance with an aspect of the present invention is preferably configured so that a genome is introduced with a mutation that causes suppression of a function of a gene containing, as a coding region, a polynucleotide encoding any one of: a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7; and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11. The suppression of the function is preferably suppression of the development of an axillary bud. In addition, as demonstrated in Examples described later, the tobacco plant in accordance with an aspect of the present invention is particularly preferably a mutant in which the mutation is introduced into NtBl1 and NtLS.
[0130] [2. Method of Producing Tobacco Plant]
[0131] In one aspect, the present invention provides a method of producing the tobacco plant. The method includes a step of introducing a mutation that causes suppression of a function of a gene containing, as a coding region, a polynucleotide encoding any of the specific polypeptides described above.
[0132] This introducing step results in the suppression of the development of axillary buds through the functional suppression of the gene, which is caused by the mutation. The suppression of the development of axillary buds through the functional suppression of the gene is performed as outlined above. Therefore, as concrete examples of carrying out the introducing step, the following description will discuss suppression of gene expression and introduction of a mutation into a gene, which are performed through transformation of a tobacco plant with use of a vector.
[0133] The vector to be used for the transformation of a tobacco plant for the purpose of the suppression of the gene expression or the introduction of the mutation into the gene is not limited to any particular one, provided that a polynucleotide inserted into the vector can be expressed in a plant cell. Examples of a suitable vector encompass pBI, pPZP, and pSMA vectors each of which allows introduction of a target polynucleotide into a plant cell via Agrobacterium. In particular, plasmids of binary vectors (e.g., pBIG, pBIN19, pBI101, pBI121, pBI221, and pPZP202) are preferable.
[0134] In a case where the suppression of the gene expression is achieved by RNAi, a trigger sequence, which is used by the RNAi to suppress the expression of the target gene, is inserted into the vector. Examples of the trigger sequence encompass (i) a polynucleotide (sense RNA portion) which is (a) a part of a polynucleotide (which can have a substitution of 0.1% to 1%) encoding a polypeptide having an amino acid sequence represented by SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, or 19 or a part of a polynucleotide (which can have a substitution of 0.1% to 1%) having SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20 and (b) represented by a nucleotide sequence of at least 21 to 30 consecutive bases (e.g., 21 or more s, 22 or more s, 23 or more s, 24 or more bases, 25 or more bases, 26 or more bases, 27 or more bases, 28 or more bases, 29 or more bases, and 30 or more bases) and (ii) a polynucleotide (antisense RNA portion) represented by a nucleotide sequence which is complementary to the polynucleotide (i). More specifically, the nucleotide sequence of the at least 21 to 30 consecutive bases described above means a nucleotide sequence of 21 or more consecutive bases, 23 or more consecutive bases, 25 or more consecutive bases, 30 or more consecutive bases, 35 or more consecutive bases, 40 or more consecutive bases, 45 or more consecutive bases, 50 or more consecutive bases, 60 or more consecutive bases, 70 or more consecutive bases, 80 or more consecutive bases, 90 or more consecutive bases, or 100 or more consecutive bases.
[0135] As described above, the suppression of the gene expression in the tobacco plant in accordance with an aspect of the present invention is preferably genetically inherited. Therefore, the trigger sequence is preferably integrated with a genome of the tobacco plant.
[0136] The introduction of a mutation into the gene of the tobacco plant can be achieved by a publicly-known genome editing technique. Examples of the genome editing technique encompass CRISPR/Cas9 system, TALEN, and ZFN. According to the CRISPR/Cas9 system, the genome editing is possible if guide RNAs and a Cas9 protein is present in a target cell. According to TALEN and ZFN, the genome editing is possible if a fusion protein (in which DNA-binding domains and nuclease are fused) is present in a target cell. Therefore, the guide RNAs, the Cas9 proteins, and the fusion proteins can be directly introduced into a target cell. Examples of a method of directly introducing any of these into a target cell encompass a PEG method, an electroporation method, and a particle bombardment method.
[0137] According to the CRISPR/Cas9 system, (i) a sequence, which is complementary to a nucleotide sequence located immediately upstream of XGG on a genome, forms a base pair with part of a guide RNA and (ii) a double stranded genomic DNA is cut by Cas9 in the nucleotide sequence. Examples of the nucleotide sequence encompass a part of (i) a polynucleotide (which can have a substitution of 0.1% to 1%) encoding a polypeptide having an amino acid sequence represented by SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, or 19 or (ii) a polynucleotide (which can have a substitution of 0.1% to 1%) having SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20, which part is 10 or more consecutive bases (e.g., 15 or more consecutive bases, preferably 17 or more consecutive bases, more preferably 18 or more consecutive bases, still more preferably 19 or more consecutive bases, and most preferably 20 or more consecutive bases) located immediately upstream of XGG.
[0138] According to the TALEN, a pair of DNA-binding domains in artificial nucleases forming a dimer each bind to a corresponding one of nucleotide sequences, which is present at each terminus of a FokI cleavage domain so as to be away from the terminus by a spacer of 5 to 20 bases. The nucleotide sequence is present at one and the other strands of double stranded genomic DNA. Therefore, one of the pair of DNA-binding domains binds to the one strand, and the other of the pair of DNA-binding domains binds to the other strand. The DNA binding domain is composed of a repeating unit (module) which include 33 to 34 amino acid residues. The number of module corresponds to the number of nucleotides to which the DNA bind domain bind. Provided that 33 to 34 amino acid residues serve as a repeating unit (module), the DNA-binding domain contains modules, the number of which corresponds to the number of nucleotides to bind to. The nucleotide sequence to which the DNA-binding domain binds is 6 or more consecutive bases, preferably 10 or more consecutive bases, and more preferably 18 or more consecutive bases, which are present at each terminus of a FokI cleavage domain so as to be away from the terminus by a spacer of 5 to 20 bases and which are (i) a part of a polynucleotide (which can have a substitution of 0.1% to 1%) encoding a polypeptide having an amino acid sequence represented by SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, or 19, or a polynucleotide (which can have a substitution of 0.1% to 1%) having SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20 and (ii) a part of a polynucleotide forming complementary strand with the above polynucleotide.
[0139] According to ZFN, as in the case of TALEN, a pair of DNA-binding domains in artificial nucleases forming a dimer each bind to a corresponding one of nucleotide sequences, which is present at each terminus of a FokI cleavage domain so as to be away from the terminus by a spacer of 5 to 20 bases. The DNA-binding domain contains a plurality of zinc finger modules. The nucleotide sequence is 9 or more consecutive bases, preferably 12 or more consecutive bases, and more preferably 18 or more consecutive bases, which are present at respective termini of a FokI cleavage domain with a spacer of 5 to 20 bases therebetween and which are (i) a part of a polynucleotide (which can have a substitution of 0.1% to 1%) encoding a polypeptide having an amino acid sequence represented by SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, or 19, or a polynucleotide (which can have a substitution of 0.1% to 1%) having SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20 and (ii) a part of a polynucleotide forming complementary strand with the above polynucleotide.
[0140] The descriptions of RNAi, CRISPR/Cas9 system, TALEN, and ZFN can each be read so that, according to the description of each detail, the polypeptide having an amino acid sequence represented by SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, or 19 is replaced with an orthologous polypeptide which (i) has a sequence identity of 90% or higher with the polypeptide and (ii) is present in another kind included in Nicotiana plant. Likewise, the description of the previous paragraph can be read so that a polynucleotide having SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20 is replaced with a polynucleotide of orthologous gene, which (i) has a sequence identity of 90% or higher with the polynucleotide and (ii) is present in another kind included in Nicotiana plant.
[0141] As described above, the gene mutation introduced in the tobacco plant in accordance with an aspect of the present invention is preferably genetically inherited. However, an exogenous polynucleotide introduced in a tobacco plant by genome editing is preferably eliminated from the tobacco plant after it is confirmed that a desired mutation is introduced in the tobacco plant. In a case where the exogenous polynucleotide is retained in the tobacco plant, an undesired mutation may (continue to) be introduced. This may cause a desired character (such as suppression of secondary axillary buds) to be lost, or may threaten the survival of the tobacco plant.
[0142] The introduction of a mutation into a gene of a tobacco plant can be achieved through another biotechnological method (e.g., a method in which transposon or Agrobacterium is utilized). Concrete examples of the method encompass a method in which a tobacco plant is introduced with (i) retrotransposon tnt1 of tobacco or transposon of another plant or (ii) T-DNA of T1 plasmid of Agrobacterium.
[0143] Alternatively, the introduction of a mutation into a gene of the tobacco plant can be achieved through another method (mutagen treatment of a tobacco plant). Examples of a source of the mutation encompass small molecule compounds (such as ethyl methane sulfonate (EMS), N-ethyl-N-nitrosourea (ENU), sodium azide) and radiations (such as gamma rays, heavy ion beams, X-rays, neutron beams, and ultraviolet rays).
[0144] A mutation can be introduced into any regenerable tobacco plant. Examples of the tobacco plant encompass seeds, roots, leaves, flowers, reproductive organs, and embryos. A preferable example is embryos.
[0145] What can be obtained by the methods above can be a mutant population of a plant which has various mutations (or no mutation). Therefore, an individual exhibiting a desired phenotype can be further selected from the mutant population. As an example of the selection of an individual, the following description will discuss a procedure for selecting a desired individual from a mutant population (panel) which is obtained in a case where tobacco is treated with use of a mutagen.
[0146] A loss-of-function tobacco mutant, which has mutations in the total of four genes at a T genome and an S genome, can be obtained by, for example, the following method. Tobacco is treated with a mutagen as described above to prepare a population (panel) of tobacco mutants with mutations in the whole tobacco genome, and genomic DNAs are extracted. By utilizing gene-specific primers of each of the S genome and the T genome, target genes (polynucleotide) are amplified from the genomic DNAs of the panel. Subsequently, nucleotide sequences of resulting products are determined, and a line having a homozygous mutation is then selected. First, a line (M2) having a homozygous mutation in an S genome and a line (M2) having a homozygous mutation in a T genome are obtained and then crossed to obtain F.sub.1 individuals. Subsequently, a selfed progeny (F.sub.2) is cultivated from the F.sub.1 individuals. From the selfed progeny (F.sub.2) is obtained a line having homozygous mutations in both an S genome and a T genome (such a line is obtained at a probability of 1/16 since two elements are recessive).
[0147] The method of producing the tobacco plant in accordance with an aspect of the present invention further includes the step of selecting, from the tobacco plant produced by the above producing step, an individual in which the number or weight of secondary axillary buds developing after removal of primary axillary buds is decreased to or lower in comparison with the wild-type plant. This selecting step is carried out based on, for example, disruption, mutation, or suppressed expression of genes encoding specific polypeptides described above.
[0148] The mutation or disruption of a gene is determined by identifying the presence/absence of a mutation of the gene. A method of identifying the mutation of the gene needs to allow the determination of the presence/absence of the mutation. Examples of the method encompass (1) a method in which a DNA sequence is directly decoded with use of a commercially available sequencer, (2) a method in which a difference in sequence is detected by a difference in distance of electrophoresis with use of the Single Strand ConformationPolymorphism (SSCP) method, (3) a method in which Single Nucleotide Polymorphism (SNP) is detected by the Cycleave PCR method, (4) a method in which the presence/absence of a mutation is identified by cleaving a mismatch site(s) with use of T7 EndonucleaseI or the like, (5) a Cleaved Amplified Polymorphic Sequence (CAPS) method in which the presence/absence of a mutation can be determined by the presence/absence of cleavage by a restriction enzyme treatment, (6) a derived CAPS (dCAPS) method in which a set of primers including a mismatch is intentionally used so that the presence/absence of a mutation can be determined by the presence/absence of cleavage by restriction enzymes, (7) a method (e.g., a PCR method in which a TaqMan probe is used, MassARRAY analysis) in which the presence/absence of a mutation is determined by identifying, by use of a probe which specifically hybridizes to a mutant sequence, whether or not a probe is hybridized, and (8) a method in which, in a case where the mutation is deletion or insertion, the mutation is detected by a difference in mobility of electrophoresis. Alternatively, the mutation or disruption of a gene can be determined by detection (e.g., Western blotting) of (i) a protein which results from modification of the gene or (ii) an expression level of a wild-type protein.
[0149] Prior to the above-described step of introducing a mutation, procedures (1 and 2) described below are carried out as necessary so as to determine (i) a gene whose expression is to be suppressed and/or (ii) a gene into which a mutation is to be introduced.
[0150] 1. Isolation of tobacco gene which is predicted to regulate development of axillary bud
[0151] A gene, which possibly regulates axillary buds, can be obtained from genes of tobacco by (i) selecting a gene from other plants based on a prior art document (e.g., Non-Patent Literature in which a relationship between a gene and an axillary bud is confirmed) and (ii) using, as an index, identity of nucleotide sequence and identity of amino acid sequence of the selected genes. For example, a nucleotide sequence and an amino acid sequence of a publicly-known tobacco gene or a gene of a plant species (e.g., tomato) which is closely related to tobacco can be obtained by conducting a search in sequences registered in a publicly-known database with use of Basic Local Alignment Search Tool (blast). In a case where a publicly-known sequence is of a partial length, a full-length cDNA can be obtained from known sequence information by a common method such as (i) screening from a cDNA library or (ii) Rapid amplification of cDNA ends (Race) method.
[0152] A gene, which possibly regulates an axillary bud in a novel manner, can be obtained by, for example, selecting a gene which is expressed according to a target tissue or target a treatment. The target tissue and the target treatment can be selected based on information listed below. It is known that (i) a gene, which is involved in the formation of an axillary meristem, is expressed prior to the formation of the axillary meristem and (ii) a gene, which is involved in maintenance and growth of an axillary meristem, is expressed at the axillary meristem (e.g., LS, Blind gene). It is known that a gene, which is involved in dormancy or development of an axillary bud, is expressed in an increased or decreased amount, depending on the dormancy or non-dormancy of the axillary bud (e.g., BRANCHED1). It is also known that some plant hormones are involved in the regulating of axillary buds. Auxin is involved in apical dominance. Strigolactone is involved in suppression of the development of axillary buds. Cytokinin is involved in outgrowth of axillary buds. Abscisic acid is involved in dormancy.
[0153] New selection of a gene which possibly regulates the development of an axillary bud can be performed by a common method in which expression specificity is utilized. The following (1) through (3) are examples of the method. (1) Methods such as (a) a method in which gene expression profiling data is obtained from a nucleotide sequence of cDNA, (b) a method in which a cDNA library of genes that are expressed in a subject tissue is prepared and then a terminal sequence is sequenced, and (c) a Serial Analysis of Gene Expression (SAGE) method in which restriction fragments are connected in series and sequenced. (2) A method in which gene expression profiling data is obtained by differential hybridization. Macro arrays and DNA chips are well known. (3) Genes (Differentially Expressed Genes: DEGs) which differ in expression level between a plurality of samples can be obtained by a differential display method. Examples encompass a method in which the amounts of PCR amplification fragments are compared.
[0154] Amplification of Isolated Genes
[0155] Amplification of a polynucleotide can be performed by Polymerase Chain Reaction (PCR), but alternatively can be performed by, for example, Ligase Chain Reaction (LCR) or Loop-Mediated Isothermal Amplification (LAMP).
[0156] A primer for amplifying a polynucleotide only needs to be a primer which enables specific amplification of a target gene of each genome from tobacco genomes in which genes of an S genome and a T genome are mixed. Provided that the target gene can be specifically amplified, one or more substitutions, deletions, insertions, and additions can be included. In addition, as necessary, the primer can be labeled with, for example, a fluorescent substance or a radiation.
[0157] Extraction of genomic DNA to be used as a template of the amplification can be performed by a publicly-known method, and can be performed by using a commercially available extraction kit. Genomic DNA can be a crudely purified one obtained through simple extraction or can be a purified one obtained through a purification step.
[0158] 2. Identification of Gene which is Expected to be Involved in Development of Axillary Bud
[0159] Effects of a target gene can be confirmed by (i) preparing recombinants and mutants in which expressions and functions of the target gene are suppressed and (ii) cultivating the recombinants and the mutants in a greenhouse, a phytotron, a mesh house, or a field. By comparing the number and weight of developed axillary buds with the controls, it is possible to confirm effects of the outgrowth and development of axillary buds. While the number and weight of the axillary buds can be performed without performing topping, the number and weight of the axillary buds is preferably performed while (i) the axillary buds are in a non-dormancy state due to topping and (ii) the development of the axillary buds are therefore promoted. Examination of the number and weight of the axillary buds can be performed once or more than once in any season. One-time measurement allows evaluation of primary axillary buds, but is not suitable for evaluations of secondary axillary buds and tertiary axillary buds. Therefore, it is preferable to perform measurement a plurality of times. In order to confirm the effects of secondary axillary buds and tertiary axillary buds, it is preferable to remove primary axillary buds and secondary axillary buds, respectively. While the removal of primary axillary buds and secondary axillary buds can be performed after the development thereof, it is preferable not to leave remaining axillary buds. It is preferable to remove axillary buds when the extension of stems of the axillary buds is confirmed. In a case where the examinations is performed a plurality of times, it is preferable to separately examine the primary axillary buds, the secondary axillary buds, and the tertiary axillary buds. For example, it is possible to carry out a method of (i) separately counting the respective numbers of primary axillary buds, secondary axillary buds, and tertiary axillary buds, once each week, (ii) collecting the primary axillary buds, the secondary axillary buds, and the tertiary axillary buds, and (iii) examining the respective weights of the primary axillary buds, the secondary axillary buds, and the tertiary axillary buds.
[0160] The examination can be performed with the focus only on specific axillary buds (e.g., secondary buds), or the examination can be performed such that examination with the focus only on the number of axillary buds and examination with the focus only on the weight are separately performed. In such a case, it is preferable that a suitable number of times of examinations and suitable intervals between the examinations are determined according to each examination.
[0161] [3. Method of Selectively Suppressing Secondary Axillary Buds of Tobacco Plant]
[0162] In one aspect, the present invention provides a method of selectively suppressing secondary axillary buds of a tobacco plant. Selective suppression of secondary axillary buds occurs as a result of introducing a mutation which causes suppression of the function of a gene containing, as a coding region, a polynucleotide encoding any of the specific polypeptides described above in a tobacco plant. It should be noted that the above functional suppression is to suppress the development of axillary buds. Specifically, the functional suppression occurs in a tobacco plant in accordance with one aspect of the present invention. In the method of producing the tobacco plant in accordance with another aspect of the present invention, the functional suppression occurs in the tobacco plant during a step of producing the tobacco plant. Therefore, for details of the method of causing the functional suppression to occur in a tobacco plant, a reference can be made to the previous descriptions regarding the method of producing the tobacco plant.
[0163] With the above embodiments considered together, the present invention can be summarized as follows.
[0164] Specifically, a tobacco plant in which a mutation is introduced into a genome, which mutation causes functional suppression of a gene containing, as a coding region, a polynucleotide encoding any of the following polypeptides (1) through (5):
(1) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 1 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 3;
(2) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7;
(3) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11;
(4) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and
(5) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19,
[0165] the functional suppression suppressing development of axillary buds.
[0166] According to the tobacco plant, the functional suppression preferably suppresses development of, of all of the axillary buds, secondary axillary buds which develop after removal of primary axillary buds.
[0167] According to the tobacco plant, the functional suppression preferably causes the number or weight of the secondary axillary buds to decrease to not more than of that of a wild-type plant.
[0168] According to the tobacco plant, the functional suppression is preferably a decrease in abundance of the polypeptide in comparison with a wild-type plant.
[0169] According to the tobacco plant, the functional suppression is preferably a decrease in an amount of translation of the polypeptide in comparison with a wild-type plant.
[0170] According to the tobacco plant, the functional suppression is preferably a decrease in an amount of transcription from the gene to an mRNA in comparison with a wild-type plant.
[0171] According to the tobacco plant, the functional suppression is preferably promotion of degradation of an mRNA transcribed from the gene.
[0172] According to the plant, the mutation is preferably introduced into the gene.
[0173] According to the tobacco plant, the mutation is preferably introduced by spontaneous mutation, mutagen treatment, genome editing, or gene knockout.
[0174] According to the tobacco plant, the mutation is preferably insertion, into an outside of a region in which the gene is present, of a polynucleotide expressing a factor which promotes the degradation of the mRNA.
[0175] According to the tobacco plant, the factor is preferably an antisense RNA molecule, an RNAi molecule, or a co-suppression molecule.
[0176] The tobacco plant preferably belongs to Nicotiana tabacum or Nicotiana rustica.
[0177] A method of producing a tobacco plant, including the step of:
[0178] (a) introducing a mutation that causes functional suppression of a gene containing, as a coding region, a polynucleotide encoding any of the following polypeptides (1) through (5):
(1) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 1 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 3;
(2) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 5 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 7;
(3) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 9 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 11;
(4) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 13 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 15; and
(5) at least one of a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 17 and a polypeptide having a sequence identity of 90% or higher with an amino acid sequence represented by SEQ ID NO. 19,
[0179] the functional suppression suppressing development of axillary buds.
[0180] The method preferably further includes the step of: (b) selecting, from individuals produced by the step (a), an individual in which development of, of all of the axillary buds, secondary axillary buds that develop after removal of primary axillary buds is suppressed.
[0181] According to the method, in the step (b), an individual, in which the number or weight of the secondary axillary buds is decreased in comparison with that of a wild-type plant, is preferably selected.
[0182] According to the method, the step (a) preferably includes introducing the mutation into the gene.
[0183] According to the method, the step (a) is preferably carried out by spontaneous mutation, mutagen treatment, genome editing, or gene knockout.
[0184] According to the method, the step (a) preferably includes inserting, into an outside of a region in which the gene is present, a polynucleotide expressing a factor which promotes degradation of an mRNA transcribed from the gene.
[0185] According to the method, the factor is preferably an antisense RNA molecule, an RNAi molecule, or a co-suppression molecule.
[0186] An offspring or a bred progeny, in which: the offspring is of (i) the tobacco plant or (ii) a tobacco plant produced by the above method; and the bred progeny is obtained by crossing (i) the tobacco plant or (ii) a tobacco plant produced by the above method.
[0187] A leaf tobacco harvested from (i) the above tobacco plant, (ii) a tobacco plant produced by the above method, or (iii) the above offspring or the above bred progeny.
[0188] The following description will discuss details of the embodiment of the present invention with reference to Examples. The present invention is of course not limited to the Examples below and particulars can have various aspects. Further, the present invention is not limited to the embodiments, but can be altered by a skilled person in the art within the scope of the claims. An embodiment derived from a proper combination of technical means disclosed in respective different embodiments is also encompassed in the technical scope of the present invention. Moreover, all the literatures described in this specification are hereby incorporated by reference.
EXAMPLES
[0189] [1. Candidate Gene Involved in Development of Axillary Buds of Tobacco]
[0190] Candidates of tobacco orthologue of a plurality of genes (Revolutla (REV) of Arabidopsis thaliana, Lateral suppressor (LS) of tomato, and Blind (Bl) of tomato) involved in the development of axillary buds of other plants (such candidates are hereinafter simply referred to as candidate group A) were determined by Basic Local Alignment Search Tool (blast) analysis. Meanwhile, candidates of genes involved in the development of axillary buds in a tobacco plant (such candidates are hereinafter simply referred to as candidate group B) were determined by transcriptome analysis. The genes, which were obtained based on the analyses and the results of the analyses, will be described below.
[0191] (1-1. Candidate Group A)
[0192] (a) Blast Analysis
[0193] With an amino acid sequence of REV gene of Arabidopsis thaliana serving as a query, tblastn search was conducted on a web page of NCBI (http://blast.ncbi.nlm.nih.gov/Blast.cgi). As a result, REV homologous gene sequences of tomato having a high amino acid sequence identity of 80% were obtained. With an amino acid sequence of REV homologous gene of tomato serving as a query, tblastn search was conducted with respect to the results of analysis of Expressed Sequence Tag (EST) of cDNA library (derived from a mixture of leaves, shoot apex, and roots of Tsukuba No. 1). As a result, putative REV cDNA clone group of tobacco was selected.
[0194] cDNA sequence of tobacco having an amino acid sequence identity of 87% with LS gene of tomato was registered in public DB (Accession number: EU935581). Furthermore, a tobacco EST sequence (Accession number: AM848584) having a high identity with EU935581 was registered in public DB.
[0195] With an amino acid sequence of Bl gene of tomato serving as a query, tblastn search was conducted with respect to the results of analysis of EST of cDNA library (derived from a mixture of leaves, shoot apex, and roots of Tsukuba No. 1). As a result, putative Bl clone group of tobacco was selected.
[0196] (b) Preparation of Individual-Derived Genomic DNA Fragments and cDNA (Total RNA-Derived)
[0197] Genomic DNA fragments were extracted from leaves of tobacco (Tsukuba No. 1 or Petit Havana SR-1 (SR-1)) according to a simple extraction method or a CTAB method. The CTAB method is publicly known, and therefore will not be described in detail. The simple extraction method was carried out according to the following procedure. A leaf segment, which was placed in 0.3 ml to 0.5 ml of extraction buffer (0.2 M Tris-HCl pH 8.0, 0.4 M NaCl, 25 mM EDTA, and 0.5% SDS), was ground (2500 rpm, 1 minute) with use of a crushing device (e.g., Multi
[0198] Beads Shocker (Yasui Kiki Corporation) or Shake Master Neo (Bio Medical Science)). A supernatant is taken from a homogenate after the grinding. Then, genomic DNA fragments are purified from the supernatant through ethanol precipitation.
[0199] Total RNA was extracted as follows. A shoot apex, a seedling, and an axillary bud of tobacco were each immersed in RNAlater (Ambion), and then cryopreserved. Then, a sample was melted, and then 0.5 ml of an RTL buffer (QIAGEN), to which 20 l of 1 M DTT had been added, was added to the melted sample. A resultant mixture was ground (2500 rpm, 1 minute) with use of Multi Beads Shocker (Yasui Kiki Corporation). The homogenate after the grinding was subjected to centrifugal separation (15000 rpm, 10 minutes), so that a supernatant was obtained. From the supernatant, total RNA was purified with use of Magtration (Precision System Science Co., Ltd.) or RNeasy Kit (QIAGEN), in the presence of DNase.
[0200] From the total RNA, cDNA was prepared with use of any one of the following kits according to the manual included in the kit. [0201] PrimeScript II 1st strand cDNA Synthesis Kit (Takara-Bio Inc.) [0202] PrimeScript RT reagent kit with gDNA Eraser (Takara-Bio Inc.)
[0203] (c) Production of Genes of Candidate Group A
[0204] By RT-PCR in which the cDNA obtained in (b) was used as a template, three genes were amplified. In a case where PrimeSTAR Max DNA Polymerase (Takara-Bio Inc.) was used as an enzyme, the reaction conditions were set as follows.
30 seconds at 94 C.
30 cycles to 40 cycles while each cycle includes 10 seconds at 98 C., 5 seconds at 55 C., and 10 seconds at 72 C.
10 seconds at 72 C.*
[0205] * An extension reaction at 72 C. was set to 10 seconds per kb of the length of an amplification fragment.
[0206] In a case where Tks Gflex DNA Polymerase (Takara-Bio Inc.) was used as an enzyme, the reaction conditions were set as follows.
30 seconds at 94 C.
30 cycles to 40 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 55 C., and 60 seconds at 68 C.
60 seconds at 68 C.*
[0207] * An extension reaction at 68 C. was set to 60 seconds per kb of the length of an amplification fragment.
[0208] Combinations of a target gene and a primer for RT-PCR are as follows.
TABLE-US-00001 (Set1:NtLS,Tgenome,seedlingofTsukubaNo.1) CombinationofLS_Tom_F1: (SEQIDNO.130) AGGTTCTTCTTCCTTAATATTGAGTC, and NtLS_qRV1: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT CombinationofLS2_F2: (SEQIDNO.132) ACACCTAATGCATCATCTAATGTT, and LS_Syl_R1: (SEQIDNO.133) CAAATAAAGATTAAGTTCAGGATCTG (Set2;NtLS,Sgenome,seedlingofTsukubaNo.1) CombinationofLS_F2_seq: (SEQIDNO.134) ATTTCCCCTCCTCCATCATTG, and NtLS_qRV1: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT CombinationofLS1_F2: (SEQIDNO.136) CTTGACACCATCTAATGTTGTTG, and LS_Tom_R1: (SEQIDNO.133) CAAATAAAGATTAAGTTCAGGATCTG (Set3;NtREV,Tgenome,seedlingofTsukubaNo.1) CombinationofREV_RT_F2: (SEQIDNO.137) AAGCTGTTTGCAGGGAATATATC, and G053330_RV3: (SEQIDNO.138) TCTCTGGCTAAATGTTCGAAG CombinationofREV_RT_F3: (SEQIDNO.139) GTAAGTTGTGAGTCTGTGGTAACTAC, and REV_RT_R1: (SEQIDNO.140) GGAAACAAACATCTGCACTCAA (Set4:NtB1,Sgenome,seedlingofTsukubaNo.1) CombinationofB11_F1seq2: (SEQIDNO.141) GTCCATCTGTCTATATAGGTAGAATG, and B11-2_RT_R1: (SEQIDNO.142) TGAATCTTCTTGGCAACCCCC (Set5:NtREV,Sgenome,axillarybudofSR-1) NS_in0_F1: (SEQIDNO.143) TTGTTTGGGATTTTGGGGTTTGAGGG, and REV_S_R1: (SEQIDNO.144) AATTGTATGGCCAAGTGGCATTATTATCTGA REV_S_F1: (SEQIDNO.145) CACTTCCGTTCCTCTTTCACCGCTG, and NtREV_S_RV1: (SEQIDNO.146) TCCGTTCAACTGTGTTCCTGG (Set6:NtREV,Tgenome,axillarybudofSR-1) REV_RT_F2: (SEQIDNO.137) AAGCTGTTTGCAGGGAATATATC, andNtREV1_RV1: (SEQIDNO.147) TCCGTTCAACTGTGTTCCTG (Set7:NtLS,Sgenome,axillarybudofSR-1) CombinationofLS_Tom_F1: (SEQIDNO.130) AGGTTCTTCTTCCTTAATATTGAGTC, and LS_Tom_R1: (SEQIDNO.133) CAAATAAAGATTAAGTTCAGGATCTG (Set8:NtLS,Tgenome,axillarybudofSR-1) CombinationofLS_Tom_F1: (SEQIDNO.130) AGGTTCTTCTTCCTTAATATTGAGTC, andLS2-F2compR: (SEQIDNO.148) AACATTAGATGATGCATTAGGTGT CombinationofLS2-F2: (SEQIDNO.132) ACACCTAATGCATCATCTAATGTT, and LS_Syl_R1: (SEQIDNO.149) TTGGCCTCTAATTAAATAGACTGATA.
[0209] By genomic PCR in which the genomic DNA fragment obtained in (b) was used as a template, three genes were amplified. Since the enzymes used and the reaction conditions for the enzymes are similar to those in the RT-PCR, combinations of a target gene and a primer are as follows.
TABLE-US-00002 (Set1:NtREV,Sgenome,leavesofTsukubaNo.1) CombinationofREV_F3: (SEQIDNO.150) TCTCAAAGCTGGCTGTTTTATGTAT, and REV_R14: (SEQIDNO.151) TACCATTCTCCAGGGTGGTTGTGTAT CombinationofNS_in4_F1: (SEQIDNO.152) GAAAATTCAGTATTGCCATGTC, and G053330_RV2: (SEQIDNO.153) GCAAAAACTAGTTCAGAACA CombinationofNtREV_TrFW2: (SEQIDNO.154) CACCGCCTATGTAGCTTCGTCAATG, and NtREV_RT-R1: (SEQIDNO.140) GGAAACAAACATCTGCACTCAA (Set2:NtREV,Tgenome,leavesofTsukubaNo.1) CombinationofREV_F3: (SEQIDNO.150) TCTCAAAGCTGGCTGTTTTATGTAT, and REV_R14: (SEQIDNO.151) TACCATTCTCCAGGGTGGTTGTGTAT CombinationofNt_in4_F1: (SEQIDNO.155) AAAAAAATTCAGTATTGCCACGTGC, and G053330_RV2: (SEQIDNO.153) GCAAAAACTAGTTCAGAACA CombinationofNtREV_TrFW2: (SEQIDNO.154) CACCGCCTATGTAGCTTCGTCAATG, and NtREV_RT-R1: (SEQIDNO.140) GGAAACAAACATCTGCACTCAA (Set3:NtLS,Sgenome,leavesofTsukubaNo.1) CombinationofLS_F1_seq: (SEQIDNO.130) AGGTTCTTCTTCCTTAATATTGAGTC, and LS_TRV_R3: (SEQIDNO.156) TCGCTTGATTAGCAGTCAGC LS_Fl_seq: (SEQIDNO.130) AGGTTCTTCTTCCTTAATATTGAGTC, and NtLS_QPCR_RVl: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT CombinationofLS_TRV_F3: (SEQIDNO.157) CACCGAAGAAACTGATGATCAACGG, and LS_TRV_R2: (SEQIDNO.158) GAAGACCTCTTTGTCCTTCACCATGCAG (Set4:NtLS,Tgenome,leavesofTsukubaNo.1) CombinationofLS_F2_seq: (SEQIDNO.134) ATTTCCCCTCCTCCATCATTG, andNtLS_QPCR_RV1: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT CombinationofLS_TRV_F3: (SEQIDNO.157) CACCGAAGAAACTGATGATCAACGG, and LS_TRV_R2: (SEQIDNO.158) GAAGACCTCTTTGTCCTTCACCATGCAG (Set5:NtB11,Sgenome,leavesofTsukubaNo.1 andSR-1)CombinationofB11_F1seq2: (SEQIDNO.141) GTCCATCTGTCTATATAGGTAGAATG, and B11_R1seq: (SEQIDNO.159) CACCATGTTTGATATTAGGCCTTA CombinationofB11_F3seq2: (SEQIDNO.160) TGATGAGATTTATGTTGGGAACTG, and B11_R2seq: (SEQIDNO.161) TCTCATCATTGAACACGAACATACT (Set6:NtB11,Tgenome,leavesofTsukubaNo.1 andSR-1)CombinationofB11_F1seq1: (SEQIDNO.162) CCACTTGTCTATATAGCAAGAAAGA, and B11_R1seq: (SEQIDNO.159) CACCATGTTTGATATTAGGCCTTA CombinationofB11_F2seq: (SEQIDNO.163) CTAAGGCCTAATATCAAACATGGT, and B11_R2seq: (SEQIDNO.161) TCTCATCATTGAACACGAACATACT.
[0210] (d) Determination of Sequence of Genes Obtained
[0211] Each of the PCR products, which were obtained by amplifying the three genes, were cloned with use of Zero Blunt TOPO PCR Cloning Kit for Sequencing Kit (Life Technologies Corporation). As necessary, the PCR products were purified before the cloning by a common method in which agarose gel electrophoresis and MiniElute column (QIAGEN) were combined. The respective nucleotide sequences of the cloned genes were determined (SEQ ID NOs. 21 through 30) by a capillary sequencer 3730x1 DNA Analyzer (ABI) with use of BigDye (registered trademark) Terminator v3.1 Cycle Sequencing Kit (ABI).
[0212] (1-2. Candidate Group B)
[0213] Transcriptome analysis was performed in order to identify genes which are expected to be increasingly expressed in the leaf primordia of a plant.
[0214] (a) Preparation of RNA Extraction Sample
[0215] A paraffin block, in which the shoot apex portion obtained from a young tobacco plant (variety: SR-1) 4 weeks to 5 weeks after the sowing was embedded, was prepared (for details, see Takahashi H, Kamakura H, Sato Y, Shiono K, Abiko T, Tsutsumi N, Nagamura Y, Nishizawa N K, Nakazono M. (2010) A method for obtaining high quality RNA from paraffin sections of plant tissues by laser microdissection. J Plant Res 123: 807-813). The paraffin block was cut into serial sections having a thickness of 20 m with use of a microtome (RM2125 RTS; Leica). From the serial sections, sections including a center part and its vicinity of Shoot Apical Meristem (SAM) were selected. From the sections, with use of Applied Biosystems (registered trademark) ArcturusxT (trademark) laser capture microdissection system, a base of leaf primordia whose axillary meristem is unformed (axillary meristem sample), leaf primordium, and a lower part of shoot apical meristem (control sample) were cut out to have a size so that the diameter was 100 m to 200 m. The axillary meristem sample and the control sample were each collected in CapSure (registered trademark) LCM Cap (Applied Biosystems, Inc.), transferred to a tube for RNA extraction, and cryopreserved at 80 C. until the RNA extraction.
[0216] (b) RNA Purification
[0217] With use of PicoPure RNA isolation Kit (Arcturus), total RNA was purified from the RNA extraction samples of (a), according to the manual included in the kit. With use of a Bioanalyzer (Agilent Technologies Inc.), the RNA concentration of the solution of the purified RNA was estimated, and the quality of the solution (degree of decomposition of the RNA) was confirmed.
[0218] (c) Sequencing with Use of Next-Generation Sequencer (454 Genome Sequencer Titanium, Roche) and Prediction of Gene Expression Level
[0219] The RNA obtained in (b) was sent to Takara-Bio Inc., and it was requested that Takara-Bio Inc. prepare cDNA library for use in sequencer analysis. Then, Genaris was entrusted with the nucleotide sequence analysis of the 5 ends of cDNAs of the cDNA library. In determination of the nucleotide sequence, of a plate of each plant portion, from which the cDNA libraries were derived, was subjected to the sequencing. By de novo assembly analysis in which entire sequence information obtained for each portion was used, an assembly sequence was obtained. To the assembly sequence thus obtained, a read sequence obtained from the cDNA libraries, which are derived from each portion, was mapped (aligned). The number of reads corresponding to each gene was counted for each portion. The number of reads thus counted was normalized between the cDNA libraries from which the each portion was obtained. Based on the normalized number of reads, the entire gene expression level was predicted for each portion.
[0220] (d) Determination of Candidate Group B
[0221] From the axillary meristem sample (see (a) described above), the following genes were selected as primary candidate genes which are involved in the formation of axillary meristem: Genes which have a sequence of 200 or more bases in data and whose number of reads is 4 or more so as to have an expression level 10 times or more in comparison with that of the control sample. It is expected that a gene, which is to serve as a master switch for controlling the formation of organs such as the formation of axillary meristem, is a transcription factor which controls a plurality of expressions of genes. Therefore, secondary candidate genes, which are likely to encode transcription factors, were further selected (narrowed) from the candidate genes selected by the primary expression characteristics. By examining whether or not the suppression of the expression of these genes suppresses the development of axillary buds of tobacco, the candidate group B (2 genes) were ultimately determined.
[0222] (e) Production of Full-Length Sequence and cDNA Sequence of 2 Genes
[0223] By assembling the read sequence based on the results of the next-generation sequence analysis, consensus sequences isogroup15360 and isogroup07437 were obtained. By Race, RT-PCR, and genomic PCR using these consensus sequences, a full-length sequence and a cDNA sequence of the 2 genes were produced.
[0224] The Race was performed with use of the total RNA prepared according to the description in (b) of 1-1. above and with use of SMARTer RACE cDNA Amplification Kit (Clonetech) according to the manual included in the kit. For nested PCR of the Race, 1st PCR products, which had been 300-fold diluted, were used as a template. The reaction conditions in the Race were set as follows.
(1st PCR)
[0225] 5 cycles while each cycle includes 10 seconds at 98 C. and 10 seconds at 72 C.
5 cycles while each cycle includes 10 seconds at 98 C., 5 seconds at 70 C., and 5 seconds at 72 C.
25 cycles while each cycle includes 10 seconds at 98 C., 5 seconds at 60 C., and 5 seconds at 72 C.
(Nested PCR)
[0226] 25 cycles while each cycle includes 10 seconds at 98 C., 5 seconds at 55 C., and 5 seconds at 72 C.
[0227] As primers for the Race, primers included in the kit and primers specific to the following genes were used.
TABLE-US-00003 (1stPCR:#15360,SgenomeandTgenome, shootapexofSR-1) Combinationof5Race1stprimer: (SEQIDNO.164) R-GAACCACCAGGGACTAAACTCTGCAA, and 3Race1stprimer: (SEQIDNO.165) F-TTGCAGAGTTTAGTCCCTGGTGGTTC (nestedPCR:#15360,SgenomeandTgenome, shootapexofSR-1) Combinationof5RaceNestedprimer: (SEQIDNO.166) R-GAAACGATCACTGATTCTATGCC, and 3RaceNestedprimer: (SEQIDNO.167) F-TACAATGTTAGAAGAAGCAATTCAC.
[0228] According to the description in (c) of 1-1., RT-PCR was performed. The primers used and target genes were as follows.
TABLE-US-00004 (Set1:#07437,Sgenome, shootapexofSR-1) Combinationofforward: (SEQIDNO.168) TACTTCCCTTTCTCACTTTGGTTTC, and reverse: (SEQIDNO.169) AATATTCCCATCAATAGATCACAAC (Set2:#07437,Tgenome, seedlingofTsukubaNo.1) Combinationof07437_T_F1: (SEQIDNO.170) CTACTACATCACTTAATATCATTCATT, and 07437_Tom_RT_R1: (SEQIDNO.171) CAATAGATTGCAACTTTACATTAGTCG (Set3:#07437,Sgenome, seedlingofTsukubaNo.1) Combinationof07437_S_F1: (SEQIDNO.172) TACTATCACTTAATACCATCATTCATC, and 07437_Syl_RT_R1: (SEQIDNO.173) CCCATCAATAGATCACAACTTTAGT (Set4:#15360,Sgenome, seedlingofTsukubaNo.1) Combinationof15360-2_F2: (SEQIDNO.174) AAATAGAGGTAATTAGTTGTATCAATGG, and 15360-NtS_R2: (SEQIDNO.175) ACAACATACCATACTACCACACACTA (Set5:#15360,Tgenome, seedlingofTsukubaNo.1) Combinationof15360-1_F1: (SEQIDNO.176) TGCATGGACAATCTCCTCTT), and 15360-Nts_R2: (SEQIDNO.175) ACAACATACCATACTACCACACACTA (Set6:#15360,Sgenome, axillarybudofSR-1) Combinationof15360-2_F1: (SEQIDNO.177) GCATGGACAATCTCATCTTCTC, and 15360-1R1-2: (SEQIDNO.178) CAACAGGAGTTGAGTTATTCTCAT (Set7:#15360,Tgenome, axillarybudofSR-1) Combinationof15360_TrFW1: (SEQIDNO.179) CACCTTCTTCAAGCAAAATTAATGAC, and 15360_TrRV1: (SEQIDNO.180) ATTAGAGTCATGAGCCATTAGC.
[0229] According to the description in (c) of 1-1., genomic PCR was performed. The primers used and target genes were as follows.
TABLE-US-00005 (Set1:#15360,Sgenome, leavesofTsukubaNo.1) Combinationof15360-2_F1: (SEQIDNO.177) GCATGGACAATCTCATCTTCTC, and 15360-2_R1: (SEQIDNO.181) CTGGGCAATATTCCACCATT Combinationof15360-2_F2: (SEQIDNO.182) AATGGTGGAATATTGCCCAG, and 15360NtsR2: (SEQIDNO.175) ACAACATACCATACTACCACACACTA (Set2:#15360,Tgenome, leavesofTsukubaNo.1) Combinationof15360-1_F1: (SEQIDNO.176) TGCATGGACAATCTCCTCTT, and 15360-1_R1-2: (SEQIDNO.178) CAACAGGAGTTGAGTTATTCTCAT Combinationof15360-1_F2-2: (SEQIDNO.183) ATGAGAATAACTCAACTCCTGTTG, and 15360NtsR2: (SEQIDNO.175) ACAACATACCATACTACCACACACTA (Set3:#07437,Sgenome, leavesofTsukubaNo.1) Combinationof07437-S_F1: (SEQIDNO.172) TACTATCACTTAATACCATCATTCATC, and 07437-SR1: (SEQIDNO.135) TCCCTGTACTTTGGGACATGA Combinationof07437-S_F2: (SEQIDNO.184) GTGTACCAGCTAGTTATTATTGCG, and 07437-S_R2: (SEQIDNO.185) CCTGATCCGTTCTGATAGATCG Combinationof07427-S_F3: (SEQIDNO.186) ATTTGTTAAAAAGTTGTAATAAAATTGG, and 07437-S_R3: (SEQIDNO.187) TTTCTTTGAATTGCTAACGAGGA Combinationof07437-S_F4: (SEQIDNO.188) TCCTCGTTAGCAATTCAAAGAAA, and 07437-S_R5: (SEQIDNO.189) AGAATATAAAGAGCAGCCTGAATTAC Combinationof07437-S_F1: (SEQIDNO.172) TACTATCACTTAATACCATCATTCATC, and 07437-S_R2: (SEQIDNO.185) CCTGATCCGTTCTGATAGATCG Combinationof07437-S_F2: (SEQIDNO.184) GTGTACCAGCTAGTTATTATTGCG, and 07437-S_R3: (SEQIDNO.187) TTTCTTTGAATTGCTAACGAGGA (Set4:#07437,Tgenome, leavesofTsukubaNo.1) Combinationof07437-T_F1: (SEQIDNO.170) CTACTACATCACTTAATATCATTCATT, and 07437-T_R1: (SEQIDNO.135) TCCCTGTACTTTGGGACATGA Combinationof07437-T_F2: (SEQIDNO.190) TGCATTAACATGAATGCGAC, and 07437-T_R2: (SEQIDNO.191) TCTAAATAGCGAGTAATAAGGATGAGA Combinationof07437-T_F3: (SEQIDNO.192) GTTTGTTAAAAAATTGTAATAAACTTGG, and 07437-T_R3: (SEQIDNO.193) TTTCTTTGAAGTGCAAAAGGAAT Combinationof07437-T_F4: (SEQIDNO.194) ATTCCTTTTGCACTTCAAAGAAA, and 07437-T_R4: (SEQIDNO.195) ATTATGGAAAAACAACTCTTCTATT Combinationof07437-T_F1: (SEQIDNO.170) CTACTACATCACTTAATATCATTCATT, and 07437-T_R2: (SEQIDNO.191) TCTAAATAGCGAGTAATAAGGATGAGA Combinationof07437-T_F2: (SEQIDNO.190) TGCATTAACATGAATGCGAC, and 07437-T_R3: (SEQIDNO.193) TTTCTTTGAAGTGCAAAAGGAAT.
[0230] (1-3. Determination of Full-Length Sequence of Target Gene on Genome)
[0231] Genomic DNA fragments were obtained according to the description in (b) of 1-1. By PCR in which the genomic DNA fragments were used as templates, 5 upstream and 3 downstream of the target gene were each amplified. The reaction conditions of the PCR were set as described in (c) of 1-1. The primers used in the PCR are as follows.
TABLE-US-00006 TABLE1 Primername Sequence Targetsample Analyzedgenome REV_Sg_FW1 AAGAACATTGGCTTTAGTCCTCTAA(SEQIDNO.196) TsukubaNo.1 Sgenome_5upstream Ns_ex1_R1 ACCATCACTCATCTAACTTATCCCAT(SEQIDNO.197) REV_3Tg_F1 AGACAGGAACACAGTTGAACGGA(SEQIDNO.198) Sgenome_3downstream REV_Sg_RV1 CTTGACAAACACTCTGATTCTACAC(SEQIDNO.199) REV_Sg_RV2 TTGAGATAGCTTGTATATTATGCATGC(SEQIDNO.200) REV_Tg_FW1 TTGTACCCATTGAAGGATGACTACT(SEQIDNO.201) Tgenome_5upstream Nt_ex1_R1 TCCATCACTGATCTAACTAATCCAAG(SEQIDNO.202) REV_3Tg_F1 AGACAGGAACACAGTTGAACGGA(SEQIDNO.198) Tgenome_3downstream REV_Tg_RV2 CACGGGCGTTACCTCCACTAGTAT(SEQIDNO.203) LS_Sg_FW1 AAGGTCATTAGAATATGCGGAGC(SEQIDNO.204) Sgenome_5upstream LS_Sg_FW2 TCTTCACTAGTTTCGGGCTCAAG(SEQIDNO.205) L52-R1 AACATTAGATGATGCATTAGGTGT(SEQIDNO.148) LS1,2-F4 GTGGAGGCTTTGGATTATTATG(SEQIDNO.206) Sgenome_3downstream LS_Sg_RV1 CGTCAGAACTTCGGATTAATTACTTC(SEQIDNO.207) LS_Tg_FW1 AAATGAGGCCTGAGCACAAG(SEQIDNO.208) Tgenome_5upstream LS1-R1 CAACAACATTAGATGGTGTCAAG(SEQIDNO.209) LS1,2-F4 GTGGAGGCTTTGGATTATTATG(SEQIDNO.206) Tgenome_3downstream LS_Tg_RV1 TTATGGGATTTGATGATGCAGAG(SEQIDNO.210) LS_Tg_RV2 ACCTAGATTCCTTTACATAACCACTC(SEQIDNO.211) BI_Sg_FW1 ATATAGAAGGATGAGACATAGTAACATACC(SEQIDNO.212) Sgenome_5upstream BI_Sg_FW2 GTCTACAAGAAAATATGCATCCGGA(SEQIDNO.213) BI1-2_R1 CTTTGTCCCTTCGATTCATGA(SEQIDNO.214) BI1-2_F4 AGGCCTAAATCATCAGTCCA(SEQIDNO.215) Sgenome_3downstream BI_Sg_RV1 GCTGGTGTCGATAATTGCTATTTAG(SEQIDNO.216) BI_Sg_RV2 CCTTAGTGGTTTTGCATGCTATGTT(SEQIDNO.217) BI_Tg_FW2 GGCAGGATACTATTCTACCACTAGG(SEQIDNO.218) TsukubaNo.1 Tgenome_5upstream BI1-1_R1 CGCTTCGATTCTGGGAATAAG(SEQIDNO.219) BI1-1_F4 TACAGGCCTAAATCAGTCCA(SEQIDNO.220) Tgenome_3downstream BI_Tg_RV2 ATGTGAAGACAATGAATTCCGC(SEQIDNO.221) 15360_Sg_FW1 GTGTCGTCTATGGATATTATCGGC(SEQIDNO.222) Sgenome_5upstream 15360-2_Nsyl_R1 CTGGGCAATATTCCACCATT(SEQIDNO.181) 15360-2_Nsyl_F2 AATGGTGGAATATTGCCCAG(SEQIDNO.182) Sgenome_3downstream 15360_Sg_RV1 GTTCGCAGAATGACAAACAGAGT(SEQIDNO.223) 15360_Tg_FW1 CATGAGTACAGATATTACCAGTGCATC(SEQIDNO.224) Tgenome_5upstream 15360_Tg_FW2 GTGAATAATGTGTTGCAGGTCTC(SEQIDNO.225) 15360-1_Ntom_R1 TCTCAACAGGAGTTGAGTTATTCTC(SEQIDNO.226) 15360-1_Ntom_F2-2 ATGAGAATAACTCAACTCCTGTTG(SEQIDNO.183) Tgenome_3downstream 15360_Tg_RV1 AGTTTGAACATTGGATATGGTG(SEQIDNO.227) 15360_Tg_RV2 TCATACTCACGCTTGTTATACACG(SEQIDNO.228) BI_Sg_FW3 GCTCTCCTCTGATACATGGCTAT(SEQIDNO.229) SR1 Sgenome_5upstream BI1-1,2_R1 TGTTTCAGTCTCAAATTCAT(SEQIDNO.230) BI1-2_F4 AGGCCTAAATCATCAGTCCA(SEQIDNO.215) Sgenome_3downstream BI_Sg_RV1 GCTGGTGTCGATAATTGCTATTTAG(SEQIDNO.216) BI_Tg_FW2 GGCAGGATACTATTCTACCACTAGG(SEQIDNO.218) Tgenome_5upstream BI1-1_R1 CGCTTCGATTCTGGGAATAAG(SEQIDNO.219) BI1-1_F4 TACAGGCCTAAATCAGTCCA(SEQIDNO.220) Tgenome_3downstream BI_Tg_RV2 ATGTGAAGACAATGAATTCCGC(SEQIDNO.221)
[0232] With use of Zero Blunt (registered trademark) TOPO (registered trademark) PCR Cloning Kit (Thermo Fisher Scientific), E. coli (Mach1 (trademark)-T1R) was transformed with each of the amplified PCR products according to the manual included in the kit. The transformed E. coli was inoculated on a plate. Colony PCR was performed with use of the colony formed on the plate. The amplification product obtained by the colony PCR was purified with use of ExoSAP-IT (registered trademark) For PCR Product Clean-UP (Affimetrix) according to the manual thereof. Then, the resulting product was used as a template in a sequence reaction described later. At the same time, the colony was subjected to liquid culture. Then, with use of QIAGEN Plasmid Mini Kit (QIAGEN), a plasmid was extracted from bacterial cells cultured. The plasmid thus extracted was also used as the template in the sequence reaction described later.
[0233] The template was reacted with use of BigDye (registered trademark) Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems) according to the manual thereof. The reaction product was purified with use of BigDye (registered trademark) XTerminator (trademark) Purification Kit (Thermo Fisher Scientific). The nucleotide sequence of the purified reaction product was determined by use of a capillary sequencer 3730x1 DNA Analyzer (Applied Biosystems). The sequence primer was designed as appropriate from sequence information and was used.
[0234] The nucleotide sequence thus determined was connected with use of ATGC sequence assembly software (GENETYX CORPORATION) so that the nucleotide sequence in an untranslated region of the target gene was determined. The untranslated region and the structural gene part were further connected, so that a full-length genomic DNA sequence of the target gene was determined (SEQ ID NOs. 54 through 63).
[0235] (1-4. Results)
[0236] Tobacco orthologous genes of REV, LS, and Bl, which were determined as the candidate group A, were named NtREV, NtLS, and NtBl1, respectively. In addition, from the results of the transcriptome analysis, the genes determined as the candidate group B were named #15360 and #07437.
[0237] [2. Examination of Effects of Expression Suppression of Each of Candidate Groups A and B on Development of Axillary Buds]
[0238] In order to examine the effects of expression suppression of each of the candidate groups A and B on the development of axillary buds, checking was performed of changes in development of axillary buds in recombinants in which each gene expression was suppressed (such a recombinant is hereinafter referred to simply recombinant).
[0239] (2-1. Preparation of Recombinants)
[0240] (a) Preparation for Transformation
[0241] In order to prepare the recombinants, vectors for transformation were first prepared as described below.
[0242] RNAi trigger sequences for suppressing the expression of NtREV, NtBl1, NtLS, #15360, and #07437 (hereinafter also collectively referred to as target genes) were amplified by PCR in which PrimeSTAR Max DNA Polymerase (Takara-Bio Inc.) was used, while cDNA derived from SR-1 produced based on the results of 1. was used as a template. The conditions and primers of the PCR are as follows.
(Conditions of PCR)
[0243] 30 seconds at 94 C.
30 cycles to 40 cycles while each cycle includes 10 seconds at 98 C., 5 seconds at 55 C., and 10 seconds at 72 C.
10 seconds at 72 C.
TABLE-US-00007 (Primerfor#15360) Combinationof15360_TrFW1: (SEQIDNO.179) CACCTTCTTCAAGCAAAATTAATGAC, and 15360_TrRV1: (SEQIDNO.180) ATTAGAGTCATGAGCCATTAGC (Primerfor#07437) Combinationof07437_TrFW1: (SEQIDNO.231) ACCACCTGGTTTTAGGTTTCATCC, and 07437_TrRV1: (SEQIDNO.232) TATTCTGCATATCACCCATTCC (PrimerforNtLs) CombinationofLS_TRV_F3: (SEQIDNO.157) CACCGAAGAAACTGATGATCAACGG, and LS_TRV_R3: (SEQIDNO.156) TCGCTTGATTAGCAGTCAGC (PrimerforNtB11) CombinationofN.t_BL(hit1)_TRV_F1: (SEQIDNO.233) CACCTCAAGAAAAAGCTTATGGG, and N.t_BL(hit1)_TRV_R1: (SEQIDNO.234) GCAGCAGCTAACAAGTTGTA (PrimerforNtREV) CombinationofNtREV_TrFW2: (SEQIDNO.154) CACCGCCTATGTAGCTTCGTCAATG, and NtREV_TrRV2: (SEQIDNO.235) CACTGTAGCCAGAGACCACA.
[0244] For the expression suppression of NtREV, a sequence of a translated region downstream (3 end) of an HD-Zip domain was selected as an RNAi trigger sequence. For the expression suppression of NtBl1, a sequence of a translated region downstream (3 end) of a Myb domain was selected as an RNAi trigger sequence. For the expression suppression of NtLS, a 5 end side of a translated region was selected as an RNAi trigger sequence. For the expression suppression of #15360, a sequence including a bHLH domain was selected as an RNAi trigger sequence. For the expression suppression of #07437, a sequence of a NAM domain region was selected as an RNAi trigger sequence. In addition, each RNAi trigger sequence amplified by the PCR was added with CCAC at the 5 end, and was designed so that the RNAi trigger sequence has a length of 400 bp to 500 bp.
[0245] The PCR products were cloned to pENTR (trademark)/D-TOPO vectors (Life Technologies Corporation). Then, the nucleotide sequence of each RNAi trigger sequence was checked. Then, with use of Gateway LR Clonase II Enzyme Mix (Life Technologies Corporation), each RNAi trigger sequence was introduced into a pSP231 vector. In order to check the introduced sequence, each RNAi trigger sequence introduced into the pSP231 vector was amplified by PCR in which TakaRa Ex Taq and PrimeSTAR Max DNA Polymerase (Takara-Bio Inc.) were used, such that a sense strand and an antisense strand were individually amplified (the vector pSP231 is a vector in which a GFP (Green-fluorescent protein gene) expression cassette was inserted into a SacI site of pHellsgate 12 (see the literature: Wesley et al., 2001, Plant J., 27, 581-590) and is a binary vector that can express, with a cauliflower mosaic virus 35S RNA gene promoter, an RNAi sequence formed with a pdk/cat intron located between inverted repeat sequences of the trigger sequence). The PCR products were purified with use of MiniElute (QIAGEN), and then subjected to sequencing. The nucleotide sequences of the RNAi trigger sequences introduced into the pSP231 vector are as represented by SEQ ID NO. 31 (NtREV), SEQ ID NO. 32 (NtBl1), SEQ ID NO. 33 (NtLS), SEQ ID NO. 34 (#15360), and SEQ ID NO. 35 (#07437). Note that in the nucleotide sequences shown in a sequence listing, CACC at the 5 end is omitted.
[0246] With use of the pSP231 vector containing each trigger sequence, Agrobacterium (Agrobacterium tumefaciens) LBA4404 was transformed by electroporation. After it was confirmed by PCR that each RNAi trigger sequence was amplified in LBA4404, the Agrobacterium was used for the transformation of tobacco.
[0247] (b) Transformation of Tobacco and Collection of Transformed Seeds
[0248] With use of the variety MC1 (transformation of NtBl1) or SR-1 (transformation of each of NtREV, NtLS, #15360, and #07437), tobacco was transformed by a common method as described below. A section of a tobacco leaf was infected with the Agrobacterium thus transformed, and was cultured in Linsmaier and Skoog medium containing kanamycin, so that calluses were obtained. From the calluses thus obtained, redifferentiated individuals, which are kanamycin-resistant, were obtained. From these redifferentiated individuals, the following individuals were selected: the individual in which (i) intense fluorescence based on GFP in the entire leaf was confirmed and (ii) high-level expression at a spacer portion (PPDK intron) was confirmed. The individuals thus selected (T0 individuals) were transplanted to 9-cm pots, and were cultivated under fixed conditions in a containment greenhouse at 23 C. to 25 C. The T0 individuals were selfed, so that T1 seeds were collected.
[0249] (c) Selection of T1 Recombinants
[0250] The T1 seeds were aseptically sowed in Linsmaier and Skoog medium, and fluorescence based on GFP of sprout was observed. From a segregation ratio of genotypes ((homo)/hemizygous (hetero) and null segregant (null)) of transgenes, lines in which the number of loci of the transgenes was predicted to be 1 to 2 were selected.
[0251] By qPCR in which total RNA isolated from a leaf or root of T1 line was used, the expression level of target genes was determined. The expression level was evaluated as a ratio of the expression level in homo lines to the expression level in null lines. From the homo lines and null lines, lines in which the ratio above is small (i.e., the degree to which the expressions of the target genes are suppressed is large) were selected. The details of the qPCR are as follows.
[0252] The primers and probes of the qPCR were designed with use of dedicated software (PrimerExpress, ABI) or Sigma-Aldrich Japan was requested to perform such designing. As described in (b) of 1-1., cDNA was synthesized from total RNA isolated from the leaf or root. The qPCR was performed with use of (i) cDNA which was 2 to 5-fold diluted, (ii) the primers obtained as described above, and (iii) Taq Man Fast Advanced Master Mix (ABI). As a quantification control, eukaryotic elongation factor-1a gene (accession No. AF120093, efla) was amplified. As a quantification probe, a combination of reporter dye and quencher (FAM-TAMURA (gene to be analyzed) and VIC-TAMURA (control)) was used. The sequences of the primers and probes for the qPCR are shown below. In the sequence targeting each gene below, the first is a forward primer, the second is a reverse primer, and the third is a probe.
TABLE-US-00008 (NtLS) NtLS_qFW1: (SEQIDNO.236) CCGGTACTGGAAATGACCTTGA NtLS_qRV1: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT NtLS_P1: (SEQIDNO.237) CCCTTCGTAGAACCGGAGATCGTTTAGCT (NtB11) NtB11_qFW1: (SEQIDNO.238) GAGAAAACAAATGTAAGTACACCATTAGG NtB11_qRV1: (SEQIDNO.239) GAAAAAGTTTGAATCTTCTTGCCAA NtB11_P1: (SEQIDNO.240) GATTTGAAAGGGCGTTTGGGTATGGG (NtREV) NtREV1_qFW1: (SEQIDNO.241) TCTCCAGGCTCCCCTGAAG NtREV1_qRV1: (SEQIDNO.242) TGTCCCCATGTGATAACTGTAGCT NtREV1_P1: (SEQIDNO.243) AACGTTGTCGCACTGGATCTGCCA (#07437) Nt_07437_1-F: (SEQIDNO.244) ATGGCTACCCTACAAGCTTGAAA Nt_07437_1-R: (SEQIDNO.245) TTGCCAATGTGTAGTTGTTGTGG Nt_07437_1-P: (SEQIDNO.246) TCTTAACACAGCAACATCAGCAGAAGCAGC (#15360) Nt_15360_48821-F: (SEQIDNO.247) ACTCCTGTTGAGAATGCACAAATAA Nt_15360_48821-R: (SEQIDNO.248) CCAGAAATATTAGTTTCTTCTCCTTGG Nt_15360_48821-P: (SEQIDNO.249) CCATCTGAAAATGCATAACCTGGAAGCTGC.
[0253] As a result of the selection above, the individuals to be subjected to test for evaluation of axillary bud were selected per target gene whose expression is suppressed. The individuals are as follows. [0254] NtREV: 3 individuals of T1 line, selected from 10 individuals of T1 line whose expression level was evaluated, which has one locus and exhibits remarkable expression suppression (line number: 3, 8, and 14) [0255] NtBl1: 3 individuals of T1 line, selected from 15 individuals of T1 line whose expression level was evaluated, which has one locus and exhibits remarkable expression suppression (line number: 6, 9, and 12) [0256] NtLS: 3 individuals of T1 line, selected from 24 individuals of T1 line whose expression level was evaluated, which has one locus and exhibits remarkable expression suppression (line number: 10, 15, and 19) [0257] #15360: 3 individuals of T1 line, selected from 22 individuals of T1 line whose expression level was evaluated, which has one or two loci and exhibits remarkable expression suppression (line number: 11, 14, and 17) [0258] #07437: 3 individuals of T1 line, selected from 20 individuals of T1 line whose expression level was evaluated, which has one locus and exhibits remarkable expression suppression (line number: 1, 10, and 22)
[0259] The ratios of expression levels of the target genes in the T1 family of each recombinant (where the expression level in null lines is set to 1) are as follows. [0260] NtREVline 3: 0.56, line 8: 0.57, line 14: 0.74 [0261] NtBl1line 6: 0.33, line 9: 0.35, line 12: 0.25 [0262] NtLSline 10: 0.50, line 15: 0.58, line 19: 0.43 [0263] #15360line 11: 0.07, line 14: 0.10, line 17: 0.08 [0264] #07437line 1: 0.24, line 10: 0.17, line 22: 0.13
[0265] (2-2. Evaluation of Axillary Buds in Greenhouse)
[0266] The seeds of T1 line of each recombinant obtained as described above were sowed and cultivated in a containment greenhouse or Koitotron (Koito Manufacturing Co., Ltd.). The conditions of the containment greenhouse were set so that the temperature was maintained at room temperature of 23 C. to 25 C., and the day length was that of a natural day. The conditions of Koitotron were set so that the day length was 12 hours, and the temperature was 25 C. (light period) and 18 C. (dark period). The individuals were cultivated in 15-cm pots which were filled with rich soil having a volume of 500 mL/pot. The composition of the rich soil was as follows. Compost: 40 L, wild soil: 30 L, Akadama soil (small): 10 L, Akadama soil (medium): 10 L, vermiculite: 10 L, fertilizer (S625): 1000 g.
[0267] Topping was performed when 12 to 13 true leaves were produced during a period starting at budding and ending before flowering. The target selected to be evaluated was an axillary bud which was produced in a fourth true leaf from the bottom of an aerial part or a higher leaf. Each week since the topping, the number of axillary buds with a stem having a length of approximately 5 mm or longer was recorded. The axillary buds thus recorded were picked by hand from the base thereof, and the fresh weight (FW) of the axillary buds thus picked was measured. Until the development of new axillary buds was no longer found, the number and weight of axillary buds were measured over substantially 5 times.
[0268] First,
[0269]
[0270]
[0271]
[0272]
[0273] From the results above, it was found that the suppressed expression in the 5 target genes can selectively suppress the development of secondary axillary buds without suppressing the development of primary axillary buds.
[0274] [3. Confirmation of Effect of Mutation Introduced into Target Gene on Development of Axillary Buds (1)]
[0275] (3-1. Mutant Produced by EMS Treatment)
[0276] (a) Screening of Mutant
[0277] Seeds were subjected to ethylmethane sulfonate (EMS) treatment so that mutant panel (TUM) of tobacco (variety: Tsukuba No. 1) was prepared (Literature: The 2011 Annual Meeting of the Phytopathological Society of Japan, P234, Construction of mutant panel in Nicotiana tabacum L.). This mutant panel consists of (i) a set of seeds (M2 bulk seeds) of selfed mutant progeny obtained from each individual (M1 generation) bred from several thousands of seeds which were subjected to the EMS treatment as a mutagen treatment and (ii) a set of bulk DNA extracted from seedlings of 8 individuals of each line grown from the sown M2 seeds. Mutants having mutations in NtREV or NUS were selected based on the results of performing, with this DNA samples as a template, Single-strand conformation polymorphism (SSCP) analysis of genomes of a mutant library or direct sequencing of PCR amplification fragments. In the SSCP, the target site was amplified by PCR using PCR primers to which fluorescent dye was binding. Then, the amplified fragments were detected with use of a capillary electrophoresis apparatus (ABI 3130x1DNA analyzer). With use of QIAGEN Multiplex PCR Kit (QIAGEN), PCR was performed according to the manual included in the kit. The sequences of the PCR primers are as follows.
TABLE-US-00009 (NtREV,Sgenome) CombinationofNt_in0_F1: (SEQIDNO.250) TTGGTTTGGGATTTTGAGGTTTGAGG, and Nt_ex1_R1: (SEQIDNO.202) TCCATCACTGATCTAACTAATCCAAG CombinationofNs_in1_F1: (SEQIDNO.251) TTTGGAATTGAGGGTGAACATTGTGC, and Ns_in2_R1: (SEQIDNO.252) ACGTTACCATTCGTCTACAGTAAGC CombinationofNs_in2_F1: (SEQIDNO.253) CCAATAAACAAGAAACAGATGATGG, and Ns_in3_R1: (SEQIDNO.254) GAATGGACACCATAGACGGAAAGGA CombinationofNs_in3_F1: (SEQIDNO.255) TTTCCGTCTATGGTGTCCATTCTCC, and Ns_in4_R1: (SEQIDNO.256) GAGACATGGCAATACTGAATTTTCA CombinationofNs_in4_F1: (SEQIDNO.152) GAAAATTCAGTATTGCCATGTC, and Ns_in6_R1: (SEQIDNO.257) AGCCTACGTGAAGATTGATGAGAAG (NtREV,Tgenome) CombinationofNt_in0_F1: (SEQIDNO.250) TTGGTTTGGGATTTTGAGGTTTGAGG, and Nt_ex1_R1: (SEQIDNO.202) TCCATCACTGATCTAACTAATCCAAG CombinationofNt_in1_F1: (SEQIDNO.258) TCGATTGGGTTGTATGAGTTAACCGT, and Nt_in2_R1: (SEQIDNO.259) GTTACCATAAGCTGTGGAATATCAGG CombinationofNt_in2_F1: (SEQIDNO.260) AACCAATGGACAAGAAACGGATGGCA, and Nt_in4_R1: (SEQIDNO.261) TTTAGCTATCCAGTCAAAGAGGCACG CombinationofNt_in4_F1: (SEQIDNO.155) AAAAAAATTCAGTATTGCCACGTGC, and Nt_in6_R1: (SEQIDNO.262) AGCCTACGTGAAGATTGATGAGAAA (NtLS,Sgenome) CombinationofLS_F2_seq: (SEQIDNO.134) ATTTCCCCTCCTCCATCATTG, and LS1-R1: (SEQIDNO.209) CAACAACATTAGATGGTGTCAAG CombinationofLS1-F2: (SEQIDNO.136) CTTGACACCATCTAATGTTGTTG, and NtLS_QPCR_RV1: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT CombinationofLS1,2-F3: (SEQIDNO.263) TTCGTAGAACCGGAGATCGT, and LS1,2_R3: (SEQIDNO.264) GCAAAGTTGCTTCCAATGAAT CombinationofLS1,2_F4: (SEQIDNO.206) GTGGAGGCTTTGGATTATTATG, and N.t_LS_TRV_R2: (SEQIDNO.158) GAAGACCTCTTTGTCCTTCACCATGCAG (NtLS,Tgenome) CombinationofLS_F2_seq: (SEQIDNO.134) ATTTCCCCTCCTCCATCATTG, and LS2-R1: (SEQIDNO.148) AACATTAGATGATGCATTAGGTGT CombinationofLS2-F2: (SEQIDNO.132) ACACCTAATGCATCATCTAATGTT, and NtLS_QPCR_RV1: (SEQIDNO.131) ATCTAAGGCCTAAAGAGTGAGCAAAT CombinationofLS1,2-F3: (SEQIDNO.263) TTCGTAGAACCGGAGATCGT, and LS1,2_R3: (SEQIDNO.264) GCAAAGTTGCTTCCAATGAAT CombinationofLS1,2_F4: (SEQIDNO.206) GTGGAGGCTTTGGATTATTATG, and N.t_LS_TRV_R2: (SEQIDNO.158) GAAGACCTCTTTGTCCTTCACCATGCAG.
[0278] The sequence of the genes into which the mutation was introduced was identified by (i) cloning PCR amplification fragments obtained from the genomes of mutants of M2 generation and (ii) determining the nucleotide sequence of fragments of the clones. The differences between polypeptide, which were expressed by the genes into which mutations was introduced and wild-type protein (WT), are as follows.
[0279] The polypeptide (MT, Ns1630 mutant, SEQ ID NO. 36) expressed by NtREV into which a mutation at an S genome was introduced had the following difference from the wild-type protein. [0280] Mt: 111aa, Wt: 838aa
[0281] The full length was shortened to 111aa due to the fact that 112th glutamine (Q) was changed to a stop codon.
[0282] The polypeptide (Nt1605 mutant, SEQ ID NO. 37) expressed by NtREV into which a mutation at a T genome was introduced had the following difference from the wild-type protein. [0283] Mt: 116aa, Wt: 839aa
[0284] The full length was shortened to 116aa due to the fact that 117th glutamine (Q) was changed to a stop codon.
[0285] The polypeptide (Nt5850 mutant, SEQ ID NO. 38) expressed by NtREV into which a mutation at a T genome was introduced had the following difference from the wild-type protein. [0286] Mt: 68aa, Wt: 839aa
[0287] The full length was shortened to 68aa due to the fact that 69th glutamine (Q) was changed to a stop codon.
[0288] The polypeptide (Nt1145 mutant, SEQ ID NO. 39) expressed by NtLS into which a mutation at a T genome was introduced had the following difference from the wild-type protein. [0289] Mt: 398aa, Wt: 410aa
[0290] The full length was shortened to 398aa due to the fact that 399th glutamine (Q) was changed to a stop codon.
[0291] The polypeptide (Nt1025 mutant, SEQ ID NO. 40) expressed by NtLS into which a mutation at a T genome was introduced had the following difference from the wild-type protein. [0292] Mt: 145aa, Wt: 410aa
[0293] The full length was shortened to 145aa due to the fact that 146th glutamine (Q) was changed to a stop codon.
[0294] The polypeptide (Ns369 mutant, SEQ ID NO. 41) expressed by NtLS into which a mutation at an S genome was introduced had the following difference from the wild-type protein. [0295] Mt: 163aa, Wt: 407aa
[0296] The full length was shortened to 163aa due to the fact that 164th glutamine (Q) was changed to a stop codon.
[0297] (b) Selection of Desired Mutant from M2 Mutant Population
[0298] From the M2 mutant population predicted to have mutations in the target genes, mutants (T.sup.+S.sup.+) homozygously having a mutation in each target gene in both a T genome and an S genome and mutants (T.sup.S.sup.) having no mutation in each target gene in both a T genome and an S genome were prepared according to the following procedure.
[0299] First, the following 4 groups were selected from the M2 mutant population:
M2 mutants (T.sup.+) homozygously having mutations in target gene in T genome
M2 mutants (S.sup.+) homozygously having mutations in target gene in S genome
M2 mutants (T.sup.) having no mutation in target gene in T genome
M2 mutants (S.sup.) having no mutation in target gene in S genome
Then, F1 line prepared by crossing T.sup.+ and S.sup.+ was selfed, so that target F2 mutants (T.sup.+S.sup.+) were prepared. T.sup.S.sup. was likewise prepared.
[0300] In the procedure above, Cycleave PCR method was carried out as described in the next paragraph in order to determine the presence/absence of a mutation on a genome. Genomic DNA which was extracted by use of a simple extraction method was used as a template in the Cycleave PCR for checking a mutation of NtREV gene. Fragments amplified by PCR from genomic DNA (each of T genome and S genome) were 300-fold to 500-fold diluted and then used as templates in the Cycleave PCR for checking a mutation of NtLS gene. The PCR was performed with use of Tks Gflex (trademark) DNA polymerase (Takara-Bio Inc.). The reaction conditions and primers of the PCR are as follows.
(Reaction Conditions)
[0301] 30 seconds at 94 C.
35 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 55 C., and 90 seconds at 68 C.
90 seconds at 68 C.
TABLE-US-00010 (Primers) Tgenome NtLS_prePCR_Ntom_F1: (SEQIDNO.265) CCCAGACCCCCTTTTCCTCT NtLS_prePCR_Ntom_R1: (SEQIDNO.266) AATTTCCCTTATAATTTAACGCC Sgenome NtLS_prePCR_Nsy1_F1: (SEQIDNO.267) CCCTAGAGAGACCCCTTTTTC NtLS_prePCR_Nsy1_R1: (SEQIDNO.268) GGGTTTTAAATTTAACGCCAA.
[0302] The primers and probes for the Cycleave PCR method (Table 1) were designed with use of Cycleave (registered trademark) PCR Assay Designer (SNPs) which is available on a web page of Takara-Bio Inc. Along with the primers and probes, Cycleave PCR Reaction Mix (Takara-Bio Inc.) was used according to the manual provided by Takara-Bio Inc. to carry out the Cycleave PCR method. PCR reaction was made with use of Applied Biosystems (registered trademark) StepOnePlus (trademark) real-time PCR system (Thermo Fisher Scientific Inc.).
TABLE-US-00011 TABLE2 Gene Primer/probename Sequence Genometype REV Nt_5850_P2-1PrimerF GTGAATGCCCTATTCTGTC(SEQIDNO.269) Tgenome Nt_5850_P2-1PrimerR ATCACTGATCTAACTAATCCAAG(SEQIDNO.270) Nt_5850_P2-1ProbeT-FAM ctttgatct(A)ct5-Eclipse/3-FAM(SEQIDNO.271) Nt_5850_P2-1ProbeC-HEX tgatct(G)ctt5-Eclipse/3-HEX(SEQIDNO.272) Nt_1605_P4-2PrimerF ATTGATGGAGGAGAATGAT(SEQIDNO.273) Tgenome Nt_1605_P4-2PrimerR GACAAGATACGTTAAGTGAAA(SEQIDNO.274) Nt_1605_P4-2ProbeT-FAM acaagct(A)cg5-Eclipse/3-FAM(SEQIDNO.275) Nt_1605_P4-2ProbeC-HEX caagct(G)cg5-Eclipse/3-HEX Ns_1630_P3-1PrimerF CCATTTCAGGTGTCGAG(SEQIDNO.276) Sgenome Ns_1630_P3-1PrimerR ACGTTACCATTCGTCTACAG(SEQIDNO.277) Ns_1630_P3-1ProbeT-FAM tt(A)caagcga5-Eclipse/3-FAM(SEQIDNO.278) Ns_1630_P3-1ProbeC-HEX gC(a)aaaacag5-Eclipse/3-HEX(SEQIDNO.279) LS 369_Ns-1PrimerF TCCCTAAACCAAGTGACTCC(SEQIDNO.280) Sgenome 369_Ns-1PrimerR GGTATCAAGGTCATTTCCAG(SEQIDNO.281) 369_Ns-1ProbeT-FAM tgT(a)agcacta5-Eclipse/3-FAM(SEQIDNO.282) 369_Ns-1ProbeC-HEX gC(a)agcact5-Eclipse/3-HEX L6_1145-3PrimerF AGAGGATGACAGTGGAGCAA(SEQIDNO.283) Tgenome L6_1145-3PrimerR TAACGCCAAGAAGATATGGAA(SEQIDNO.284) L6_1145-3ProbeT-FAM ggT(a)aaatcaac5-Eclipse/3-FAM(SEQIDNO.285) L6_1145-3ProbeC-HEX ggC(a)aaatca5-Eclipse/3-HEX(SEQIDNO.286) 1025_1547-3PrimerF GTTGAAAGTTCAAATGATTCAG(SEQIDNO.287) Tgenome 1025_1547-3PrimerR GAGGAGGGTAACGATCAG(SEQIDNO.288) 1025_1547-3ProbeT-FAM gcttgttA(g)tt5-Eclipse/3-FAM(SEQIDNO.289) 1025_1547-3ProbeC-HEX cttgttG(g)tta5-Eclipse/3-HEX(SEQIDNO.290)
[0303] (c) Evaluation of Axillary Buds in Field
[0304] Cultivation in Field
[0305] In the field of Leaf Tobacco Research Center, during an ordinary cultivation period (sowing in March and planting in April), each line of the mutants was cultivated by a high-ridge, mulch-cultivation method under the following conditions. ridge length: 16 m, ridge intervals: 120 cm, planting distance: 43 cm, and the number of plan per ridge: 37. 1 ridge was assigned for cultivation of 1 line, and, one month after transplant, 10 to 15 individuals showing approximately identical growth were determined by appearance and were preliminarily selected. Then, 10 individuals from those were subjected to a subsequent examination. During the examination, no agrochemicals for suppressing axillary buds (such as Contact) was used at all.
[0306] Determination of Flowering Time
[0307] During flowering time, the number of above-ground leaves was determined. Immediately before topping, predicted flowering time was determined. By performing topping through cutting off 1 to 4 leaves below the first flower branch, the numbers of above-ground leaves were made the same among lines to be compared and evaluated.
[0308] Evaluation of Development of Axillary Buds
[0309] Over the total of 7 times on the day of topping and each week since the topping, the number of axillary buds with a stem having a length of approximately 5 mm was recorded. The axillary buds thus recorded were picked by hand from the base thereof, and the fresh weight (FW) of the axillary buds thus picked was measured. The primary axillary buds, the secondary axillary buds, and the tertiary axillary buds were individually measured and recorded. The measurement records are then put together.
[0310]
[0311]
[0312] The results above indicate that in the mutants of NtREV and NtLS also, the development of secondary axillary buds (and tertiary axillary buds) was selectively suppressed as in the case of suppression of gene expression.
[0313] (3-3. Mutant of NtBl1 Produced by CRISPR/Cas9 System)
[0314] (a) Preparation for Transformation
[0315] As a vector for transforming Agrobacterium, a binary vector pRI-201-AN (Takara-Bio Inc.) was used. Between NdeI-SalI of pRI-201-AN, pcoCas9 (Reference 2) which had been subjected to codon optimization for plants was introduced. Between KpnI-BamHI, a sgRNA expression cassette was introduced. As a promoter for guide sequence GN.sub.20GG, AtU6-1 (Reference 3) was used. As a promoter for guide sequence AN.sub.20GG, AtU3B (Reference 4) was used. As a scaffold-polyT sequence, the sequence reported in Reference 2 was used. A diagram of the constructed vector is shown in
TABLE-US-00012 [Chem.1] (SEQIDNO.291) aattggtaccTTTACTTTAAATTTTTTCTTATGCAGCCTGTGATGGATAAC TGAATCAAACAAATGGCGTCTGGGTTTAAGAAGATCTGTTTTGGCTATGTT GGACGAAACAAGTGAACTTTTAGGATCAACTTCAGTTTATATATGGAGCTT ATATCGAGCAATAAGATAAGTGGGCTTTTTATGTAATTTAATGGGCTATCG TCCATAGATTCACTAATACCCATGCCCAGTACCCATGTATGCGTTTCATAT AAGCTCCTAATTTCTCCCACATCGCTCAAATCTAAACAAATCTTGTTGTAT ATATAACACTGAGGGAGCAACATTGGTCacaatgatatcaagaattacGTT TTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA AAAAGTGGCACCGAGTCGGTGCTTTTTTTggatccaatt
The underlined portion indicates the guide sequence. The portion upstream to the underlined portion indicates the AtU3B promoter sequence. The portion downstream to the underlined portion indicates the scaffold-polyT sequence. The lower case letters at the terminus indicate restriction enzyme sequences of KpnI and BamHI.
TABLE-US-00013 [Chem.2] Cas9sequence (SEQIDNO.292) catATGGATTACAAGGATGATGATGATAAGGATTACAAGGATGATGATGAT AAGATGGCTCCAAAGAAGAAGAGAAAGGTTGGAATCCACGGAGTTCCAGCT GCTGATAAGAAGTACTCTATCGGACTTGACATCGGAACCAACTCTGTTGGA TGGCCTGTTATCACCGATGAGTACAAGGTTCCATCTAAGAAGTTCAAGGTT CTTGGAAACACCGATAGACACTCTATCAAGAAGAACCTTATCGGTGCTCTT CTTTTCGATTCTGGAGAGACCGCTGAGGCTACCAGATTGAAGAGAACCGCT AGAAGAAGATACACCAGAAGAAAGAACAGAATCTGCTACCTTCAGGAAATC TTCTCTAACGAGATGGCTAAGGTTGATGATTCTTTCTTCCACAGACTTGAG GAGTCTTTCCTTGTTGAGGAGGATAAGAAGCACGAGAGACACCCAATCTTC GGAAACATCGTTGATGAGGTTGCTTACCACGAGAAGTACCCAACCATCTAC CACCTTAGAAAGAAGTTGGTTGATTCTACCGATAAGGCTGATCTTAGACTT ATCTACCTTGCTCTTGCTCACATGATCAAGTTCAGAGGACACTTCCTTATC GAGGGAGACCTTAACCCAGATAACTCTGATGTTGATAAGTTGTTCATCCAG CTTGTTCAGACCTACAACCAGCTTTTCGAGGAGAAACCCAATCAACGCTTC TGGAGTTGATGCTAAGGCTATCCTTTCTGCTAGATTTCTAAGTCTCGTAGA CTTGAGAACCTTATCGCTCAGCTTCCAGGAGAGAAGAAGAACGGACTTTTC GGAAACCTTATCGCTCTTTCTCTTGGACTTACCCCAAACTTCAAGTCTAAC TTCGATCTTGCTGAGGATGCTAAGTTGCAGCTTTCTAAGGATACCTACGAT GATGATCTTGATAACCTTCTTGCTCAGATCGGAGATCAGTACGCTGATCTT TTCCTTGCTGCTAAGAACCTTTCTGATGCTATCCTTCTTTCTGACATCCTT AGAGTTAACACCGAGATCACCAAGGCTCCACTTTCTGCTTCTATGATCAAG AGATACGATGAGCACCACCAGGATCTTACCCTTTTGAAGGCTCTTGTTAGA CAGCAGCTTCCAGAGAAGTACAAGGAAATCTTCTTCGATCAGTCTAAGAAC GGATACGCTGGATACATCGATGGAGGAGCTTCTCAGGAGGAGTTCTACAAG TTCATCAAGCCAATCCTTGAGAAGATGGATGGAACCGAGGAGCTTCTTGTT AAGTTGAACAGAGAGGATCTTCTTAGAAAGCAGAGAACCTTCGATAACGGA TCTATCCCACACCAGATCCACCTTGGAGAGCTTCACGCTATCCTTCGTAGA CAGGAGGATTTCTACCCATTCTTGAAGGATAACAGAGAGAAGATCGAGAAG ATCCTTACCTTCAGAATCCCATACTACGTTGGACCACTTGCTAGAGGAAAC TCTCGTTTCGCTTGGATGACCAGAAAGTCTGAGGAGACCATCACCCCTTGG AACTTCGAGGAGGTAAGTTTCTGCTTCTACCTTTGATATATATATAATAAT TATCATTAATTAGTAGTAATATAATATTTCAAATATTTTTTTCAAAATAAA AGAATGTAGTATATAGCAATTGCTTTTCTGTAGTTTATAAGTGTGTATATT TTAATTTATAACTTTTCTAATATATGACCAAAATTTGTTGATGTGCAGGTT GTTGATAAGGGAGCTTCTGCTCAGTCTTTCATCGAGAGAATGACCAACTTC GATAAGAACCTTCCAAACGAGAAGGTTCTTCCAAAGCACTCTCTTCTTTAC GAGTACTTCACCGTTTACAACGAGCTTACCAAGGTTAAGTACGTTACCGAG GGAATGAGAAAGCCAGCTTTCCTTTCTGGAGAGCAGAAGAAGGCTATCGTT GATCTTCTTTTCAAGACCAACAGAAAGGTTACCGTTAAGCAGTTGAAGGAG GATTACTTCAAGAAGATCGAGTGCTTCGATTCTGTTGAAATCTCTGGAGTT GAGGATAGATTCAACGCTTCTCTTGGAACCTACCACGATCTTTTGAAGATC ATCAAGGATAAGGATTTCCTTGATAACGAGGAGAACGAGGACATCCTTGAG GACATCGTTCTTACCCTTACCCTTTTCGAGGATAGAGAGATGATCGAGGAG AGACTCAAGACCTACGCTCACCTTTTCGATGATAAGGTTATGAAGCAGTTG AAGAGAAGAAGATACACCGGATGGGGTAGACTTTCTCGTAAGTTGATCAAC GGAATCAGAGATAAGCAGTCTGGAAAGACCATCCTTGATTTCTTGAAGTCT GATGGATTCGCTAACAGAAACTTCATGCAGCTTATCCACGATGATTCTCTT ACCTTCAAGGAGGACATCCAGAAGGCTCAGGTTTCTGGACAGGGAGATTCT CTTCACGAGCACATCGCTAACCTTGCTGGATCTCCAGCTATCAAGAAGGGA ATCCTTCAGACCGTTAAGGTTGTTGATGAGCTTGTTAAGGTT
The sequence continues to the next page.
TABLE-US-00014 [Chem.3] ATGGGTAGACACAAGCCAGAGAACATCGTTATCGAGATGGCTAGAGAGAAC CAGACCACCCAGAAGGGACAGAAGAACTCTCGTGAGAGAATGAAGAGAATC GAGGAGGGAATCAAGGAGCTTGGATCTCAAATCTTGAAGGAGCACCCAGTT GAGAACACCCAGCTTCAGAACGAGAAGTTGTACCTTTACTACCTTCAGAAC GGAAGAGATATGTACGTTGATCAGGAGCTTGACATCAACAGACTTTCTGAT TACGATGTTGATCACATCGTTCCACAGTCTTTCTTGAAGGATGATTCTATC GATAACAAGGTTCTTACCCGTTCTGATAAGAACAGAGGAAAGTCTGATAAC GTTCCATCTGAGGAGGTTGTTAAGAAGATGAAGAACTACTGGAGACAGCTT CTTAACGCTAAGTTGATCACCCAGAGAAAGTTCGATAACCTTACCAAGGCT GAGAGAGGAGGACTTTCTGAGCTTGATAAGGCTGGATTCATCAAGAGACAG CTTGTTGAGACCAGACAGATCACCAAGCACGTTGCTCAGATCCTTGATTCT CGTATGAACACCAAGTACGATGAGAACGATAAGTTGATCAGAGAGGTTAAG GTTATCACCTTGAAGTCTAAGTTGGTTTCTGATTTCAGAAAGGATTTCCAG TTCTACAAGGTTAGAGAGATCAACAACTACCACCACGCTCACGATGCTTAC CTTAACGCTGTTGTTGGAACCGCTCTTATCAAGAAGTACCCAAAGTTGGAG TCTGAGTTCGTTTACGGAGATTACAAGGTTTACGATGTTAGAAAGATGATC GCTAAGTCTGAGCAGGAGATCGGAAAGGCTACCGCTAAGTACTTCTTCTAC TCTAACATCATGAACTTCTTCAAGACCGAGATCACCCTTGCTAACGGAGAG ATCAGAAAGAGACCACTTATCGAGACCAACGGAGAGACCGGAGAGATCGTT TGGGATAAGGGAAGAGATTTCGCTACCGTTAGAAAGGTTCTTTCTATGCCA CAGGTTAACATCGTTAAGAAAACCGAGGTTCAGACCGGAGGATTCTCTAAG GAGTCTATCCTTCCAAAGAGAAACTCTGATAAGTTGATCGCTAGAAAGAAG GATTGGGACCCAAAGAAGTACGGAGGATTCGATTCTCCAACCGTTGCTTAC TCTGTTCTTGTTGTTGCTAAGGTTGAGAAGGGAAAGTCTAAGAAGTTGAAG TCTGTTAAGGAGCTTCTTGGAATCACCATCATGGAGCGTTCTTCTTTCGAG AAGAACCCAATCGATTTCCTTGAGGCTAAGGGATACAAGGAGGTTAAGAAG GATCTTATCATCAAGTTGCCAAAGTACTCTCTTTTCGAGCTTGAGAACGGA AGAAAGAGAATGCTTGCTTCTGCTGGAGAGCTTCAGAAGGGAAACGAGCTT GCTCTTCCATCTAAGTACGTTAACTTCCTTTACCTTGCTTCTCACTACGAG AAGTTGAAGGGATCTCCAGAGGATAACGAGCAGAAGCAGCTTTTCGTTGAG CAGCACAAGCACTACCTTGATGAGATCATCGAGCAAATCTCTGAGTTCTCT AAGAGAGTTATCCTTGCTGATGCTAACCTTGATAAGGTTCTTTCTGCTTAC AACAAGCACAGAGATAAGCCAATCAGAGAGCAGGCTGAGAACATCATCCAC CTTTTCACCCTTACCAACCTTGGTGCTCCAGCTGCTTTCAAGTACTTCGAT ACCACCATCGATAGAAAAAGATACACCTCTACCAAGGAGGTTCTTGATGCT ACCCTTATCCACCAGTCTATCACCGGACTTTACGAGACCAGAATCGATCTT TCTCAGCTTGCAGGAGATAAGAGACCAGCTGCTACCAAGAAGGCTGGACAG GCTAAGAAGAAGAAGTGAgtcgac
In the above Cas9 sequence over 2 pages, the underlined portions indicate the NdeI sequence and the SalI sequence.
[0316] With use of pRI201-AN in which the Cas9 and the sgRNA expression cassette were introduced, Agrobacterium LBA4404 was transformed by electroporation. The Agrobacterium was grown on an AB plate containing kanamycin at 25 g/ml. Then, Agrobacterium of a single colony was isolated.
[0317] (b) Transformation of Tobacco and Cultivation of a Transformant
[0318] Segments of a cotyledon collected from tobacco (variety: SR-1) 10 days after sowing were co-cultured for 3 days with the transformed Agrobacterium obtained as described above. Then, the Agrobacterium was then removed from the segments of the cotyledon by washing the segments with use of distilled water containing an antibacterial agent (cefotaxime). Then, the Agrobacterium was completely removed by culturing, for 4 days, the washed segments of the cotyledon in Linsmaier and Skoog medium containing an antibacterial agent. Then, the segments of the cotyledon were transferred to and cultured in Linsmaier and Skoog medium containing antibiotics (kanamycin), so that redifferentiated individuals (shoots) having kanamycin resistance were obtained. The shoots were transferred to Linsmaier and Skoog medium and then rooted. From the rooted shoots, individuals having high-level expression of Cas9 mRNA (having an expression level twice as much or higher in comparison with eukaryotic elfa which is the control) were selected, and then transplanted into and grown in a 9-cm pot containing soil for transplantation (Compost: 40 L, wild soil: 30 L, Akadama soil (small): 10 L, Akadama soil (medium): 10 L, vermiculite: 10 L, fertilizer (S625): 1000 g).
[0319] (c) Confirmation of Presence/Absence of Mutation and Mutant Sequence
[0320] PCR was performed by use of Tks Gflex (trademark) DNA polymerase (Takara-Bio Inc.) with genomic DNA as a template, which genomic DNA was extracted from a leaf of a transformant of tobacco. The reaction conditions and primers of the PCR are as follows.
(Reaction Conditions)
[0321] 30 seconds at 94 C.
40 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 55 C., and 60 seconds at 68 C.
60 seconds at 68 C.
TABLE-US-00015 (Primers) Tgenome CombinationofNtB11-1_2A_F1: (SEQIDNO.293) AAGTATTACTACTACAAAATTCCAACG, and Nb_B11_2A_R1: (SEQIDNO.294) CCATCTGATGAAGAACAACTTGC Sgenome CombinationofNtB11-2_1A_F1: (SEQIDNO.295) TTAAACACTAGAGAGTGAGAGAGTGC, and NtB11-2_2A_F1: (SEQIDNO.296) CAGATGTTTAATTATTAAGACAAAGTTCC.
[0322] After the PCR reactions, denaturation and annealing were performed under the following conditions. Denaturation: 5 minutes at 95 C., annealing: 1 second at 85 C./1 second at 85 C., 1 second at 60 C., constant at 30 C. The Ramp Rate at 85 C. to 60 C. was 5% (drop rate of 0.1 C./second), and the Ramp Rate at 60 C. to 30 C. was 10% (drop rate of 0.1 C./second). The PCR products of 5 l after the denaturation and annealing were treated in a reaction system of 10 l with use of T7 endonuclease I (New England Biolabs) of 1 U, and then were separated by electrophoresis. Then, it was checked whether or not the PCR products were cleaved by an enzyme. Separately, the PCR products were cloned with use of Zero Blunt TOPO PCR Cloning Kit, and the nucleotide sequence of the clone was determined.
[0323] (d) Selection of a Transformant
[0324] Individuals of T0 generation having mutations (deletion or insertion of 1 or more bases) in a T genome and an S genome were selfed and collected, so that a T1 line was obtained. The presence/absence of the mutations in the individuals of the T1 line was confirmed as in (c) above. Based on the results of the confirmation, individuals of a T1 line (T.sup.+S.sup.+) having homozygous mutations in a T genome and an S genome were selected. The individuals of the T1 line (T.sup.+S.sup.+) were selfed so that individuals of a T2 line (T.sup.+S.sup.+) were obtained. The individuals of a T2 line (T.sup.+S.sup.+) were used for a test.
[0325] Mutant polypeptide in individuals of T2 line obtained [0326] 2A-1_121, 2 -1_126, 2 -133_1, 2 -161_17 (Bl1-1-T genome: 1b deletion)
[0327] While WT consists of 336 amino acids, polypeptides (SEQ ID NOs. 92, 94, 96, 106) are produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NOs. 92, 94, 96, 106)) are added in addition to up to 107 amino acids identical to those of WT. [0328] 2A-1_121, 2A-1_126 (Bl1-2-S genome: 5b deletion)
[0329] While WT consists of 337 amino acids, polypeptides (SEQ ID NOs. 91, 93) are produced such that unrelated 3 amino acids (LEY) are added in addition to up to 106 amino acids identical to those of WT. [0330] 2A-133_1 (Bl1-2-S genome: 3b deletion)
[0331] A polypeptide (SEQ ID NO. 95) of 337 amino acids in which 107th N (asparagine) is deleted from 337 amino acids constituting WT is produced. [0332] 2A-161_8, 2A-161_122 (Bl1-1-T genome: 22b deletion)
[0333] While WT consists of 336 amino acids, polypeptides (SEQ ID NOs. 104, 108) are produced such that unrelated 11 amino acids (EILNSRKSLWD (positions 102 through 112 in SEQ ID NOs. 104, 108)) are added in addition to up to 101 amino acids identical to those of WT. [0334] 2A-161_8, 2A-161_17, 2A-161_122 (Bl1-2-S genome: 2b deletion)
[0335] While WT consists of 337 amino acids, polypeptides (SEQ ID NOs. 103, 105, 107) are produced such that unrelated 4 amino acids (KLEY (positions 107 through 110 in SEQ ID NOs. 103, 105, 107)) are added in addition to up to 106 amino acids identical to those of WT.
[0336] (e) Evaluation of Axillary Buds in Greenhouse
[0337] The individuals of T2 line (T.sup.+S.sup.+) obtained in (d) above were cultivated in a greenhouse, and axillary buds were evaluated. The details of the evaluation are as described in 2-2. above.
[0338]
[0339] The results above indicate that in the mutants of NtBl1 also, the development of secondary axillary buds was selectively suppressed as in the case of suppression of gene expression.
[0340] [4. Confirmation of Effect of Mutation Introduced into Target Gene on Position at which Axillary Buds Develop]
[0341] The NtBl1 mutants prepared by CRISPR/Cas9 system were cultivated in Koitotron as in the case of WT (SR-1). 1 week after topping, the positions at which primary axillary buds developed was checked (upper part of
[0342] As shown in
[0343] [5. Confirmation of Effect of Mutation Introduced into Target Gene on Growth of Tobacco Plant]
[0344] (a) Target to be tested
[0345] The effects of each gene mutation in the following lines on the growth of a plant were examined as described below: (i) the line evaluated in (c) of 3-2. and (ii) the T3 line which is a selfed progeny of Bl1_2A-1_121 evaluated in (e) of 3-3. As a comparison group, the varieties used for producing each mutant were used.
[0346] (b) Conditions
[0347] In a greenhouse (at a fixed temperature of 25 C.), each individual planted in a 9-cm pot was cultivated until budding. The composition of the rich soil is identical to that described in 2-2. At the time of budding, the plant height, fresh weight, and dry weight of each individual, and the leaf length and leaf width at each leaf position were measured. A plant height is a length from the surface of rich soil in a pot to the base of the topmost flower branch. A fresh weight is a total weight of 16 above-ground leaves (NtLS mutant, NtREV mutant) or 14 above-ground leaves (NtBl1 mutant) immediately after the leaves are harvested. A dry weight is a weight of harvested leaves (whose fresh weight has been measured) after they are dried by hot air at a temperature of 70 C. and a relative humidity of 7%. A leaf length is a length-wise distance from the petiole to the tip of a leaf. A leaf width is a maximum width of a leaf. In order to determine the leaf length and leaf width, numbers to indicate leaf positions were assigned from a bottommost leaf (1) to a topmost one in order.
[0348] (c) Results
[0349] As is clear from
[0350] The above facts indicate that each mutant shows growth and leaf yields which are substantially identical to the control group. It was therefore found that because of the following reasons (1) through (3), the mutants in accordance with these Examples are extremely useful as tobacco plants from which leaves are intended to be harvested: (1) it is easy to control axillary buds, (2) there is no decrease in yield, and (3) the plant is highly likely to survive.
[0351] [6. Confirmation of Effect of Mutation Introduced into Target Gene on Development of Axillary Buds (2)]
[0352] Mutants having profiles below were prepared, and the following of the mutants were evaluated: (i) a growth state, (ii) development of axillary buds, and (iii) development of axillary buds in a case where an agrochemical for suppressing axillary buds was used.
[0353] LS_21_Nul1: A mutant (T.sup.+S.sup.+) which (i) is an F3 individual obtained by causing an F1 individual, which was obtained by crossing Ns369 mutant and Nt1025 mutant, to self twice, (ii) homozygously has a mutation of the Ns369 mutant (expressing a polypeptide of SEQ ID NO. 41) in an S genome, and (iii) homozygously has a mutation of the Nt1025 mutant (expressing a polypeptide of SEQ ID NO. 40) in a T genome.
[0354] LS19_WT: A mutant (T.sup.S.sup.) which (i) is an F3 individual obtained by causing an F1 individual, which was obtained by crossing Ns369 mutant and Nt1025 mutant, to self twice and (ii) has no mutation of LS gene in a T genome or an S genome.
[0355] LS15_Nul1, LS85_Nul1: Mutants (T.sup.+S.sup.+) each of which (i) is an F3 individual obtained by causing an F1 individual, which was obtained by crossing Ns369 mutant and Ns1145 mutant, to self twice, (ii) homozygously has a mutation of the Ns369 mutant (expressing a polypeptide of SEQ ID NO. 41) in an S genome, and (iii) homozygously has a mutation of the Nt1145 mutant (expressing a polypeptide of SEQ ID NO. 39) in a T genome.
[0356] LS_57_WT: A mutant (T.sup.S.sup.) which (i) is an F3 individual obtained by causing an F1 individual, which was obtained by crossing Ns369 mutant and Ns1145 mutant, to self twice and (ii) has no mutation of LS gene in a T genome or an S genome.
[0357] REV_26_Nu-W and REV_89_Nu-W: Mutants each of which was obtained as follows. K326 was crossed with the following mutant (T.sup.+S.sup.+) so as to obtain F1: the mutant (T.sup.+S.sup.+) which (i) homozygously has a mutation of the Nt1605 mutant (expressing a polypeptide of SEQ ID NO. 37) in a T genome and (ii) homozygously has a mutation of the Ns1630 mutant (expressing a polypeptide of SEQ ID NO. 39) in an S genome. K326 was backcrossed with F1 once so as to obtain BC1F1. The BC1F1 was selfed twice so as to obtain BC1F3 individuals. Of the BC1F3 individuals, the following mutant (T.sup.+S.sup.) was regarded as each of REV_26_Nu-W and REV_89_Nu-W: the mutant (T.sup.+S.sup.) which (i) homozygously has a mutation of the Nt1605 mutant (expressing a polypeptide of SEQ ID NO. 37) in a T genome and (ii) has no mutation of REV gene in an S genome.
[0358] REV_26_Nu-He and REV_89 Nu-He: Mutants each of which was obtained as follows. K326 was crossed with the following mutant (T.sup.+S.sup.+) so as to obtain F1: the mutant (T.sup.+S.sup.+) which (i) homozygously has a mutation of the Nt1605 mutant (expressing a polypeptide of SEQ ID NO. 37) in a T genome and (ii) homozygously has a mutation of the Ns1630 mutant (expressing a polypeptide of SEQ ID NO. 39) in an S genome. K326 was backcrossed with F1 once so as to obtain BC1F1. The BC1F1 was selfed twice so as to obtain BC1F3 individuals. Of the BC1F3 individuals, the following mutant (T.sup.+S.sup.+/) was regarded as each of REV_26_Nu-He and REV_89_Nu-He: the mutant (T.sup.+S.sup.+/) which (i) homozygously has a mutation of the Nt1605 mutant (expressing a polypeptide of SEQ ID NO. 37) in a T genome and (ii) heterozygously has a mutation of the Ns1630 mutant (expressing a polypeptide of SEQ ID NO. 39) in an S genome.
[0359] REV35_WT: A mutant which was obtained as follows. K326 was crossed with the following mutant (T.sup.+S.sup.+) so as to obtain F1: the mutant (T.sup.+S.sup.+) which (i) homozygously has a mutation of the Nt1605 mutant (expressing a polypeptide of SEQ ID NO. 37) in a T genome and (ii) homozygously has a mutation of the Ns1630 mutant (expressing a polypeptide of SEQ ID NO. 39) in an S genome. K326 was backcrossed with F1 once so as to obtain BC1F1. The BC1F1 was selfed twice so as to obtain BC1F3 individuals. Of the BC1F3 individuals, the mutant (T.sup.+S.sup.) which has no mutation of REV gene in a T genome or an S genome was regarded as REV35_WT.
[0360] REV_F3_Nul1: A mutant (T.sup.+S.sup.+) which (i) is an F3 individual obtained by causing an F1 individual, which was obtained by crossing Nt1605 mutant and Ns1630 mutant, to self twice, (ii) homozygously has a mutation of the Nt1605 mutant (expressing a polypeptide of SEQ ID NO. 37) in a T genome, and (iii) homozygously has a mutation of the Ns1630 mutant (expressing a polypeptide of SEQ ID NO. 39) in an S genome.
[0361] REV_F3_WT: A mutant (T.sup.S.sup.) which (i) is an F3 individual obtained by causing an F1 individual, which was obtained by crossing Nt1605 mutant and Ns1630 mutant, to self twice and (ii) has no mutation of REV gene in a T genome or an S genome.
[0362] (1) Evaluation of Growth
[0363] Examination was conducted using (i) 3 lines of LS mutant null lines, (ii) 2 lines which serve as controls of the mutant null lines, and (iii) Tsukuba No. 1 which is a parent variety of the mutant. As the mutant null lines, the following were used: LS_21-1_Nul1, LS_15_Nul1, and LS_85_Nul1. The controls of the mutant null lines were as follows. LS_19_WT, which is an F2 segregated line and has no mutation in LS, was used as the control of the mutant null line LS_21-1_Nul1. LS_57_WT, which is an F2 segregated line and has no mutation in LS, was used as the control of the mutant null lines LS_15_Nul1 and LS_85_Nul1.
[0364] In the field of Leaf Tobacco Research Center, during a cultivation period slightly later than an ordinary cultivation period (sowing in March through April and planting in May), the individuals of each line above were cultivated by a high-ridge, mulch-cultivation method under the following conditions. Planting distance: 43 cm and ridge intervals: 120 cm. As a fertilizer, compost in an amount of 2000 kg/10 a and Agri 622 in an amount of 120 kg/10 a were used. Evaluation was made for the days of flowering, the plant height, the number of above-ground leaves, the fresh leaf weight, and the dry weight of individuals of each line cultivated. The days of flowering is herein the number of days from the date on which sowing was performed to the date on which the first flower was bloomed. The plant height refers to a height from the ground to the base of the topmost flower branch. The number of above-ground leaves refers to a total number of leaves located from the ground through leaves located immediately below the first flower branch. The fresh leaf weight was the total weight of all of the above-ground leaves before drying. The dry weight was the weight of all of the above-ground leaves after drying. 6 individuals of each line were evaluated, and an average of evaluated values and a standard deviation were calculated. It was examined whether or not there was any statistically significant difference in evaluated value between the mutant null lines and the controls.
[0365] The results will be described below with reference to
[0366] (2) Evaluation of Development of Axillary Buds
[0367] Each individual was cultivated as in (1) above. LS mutants and the controls thereof were as follows. The mutant null line (LS_21) and the control thereof (LS_19_WT), and the LS null mutants (LS_15, LS_85) and the controls thereof (LS57_WT) were used for a test. LS_21 was cultivated in two ridges so as to conduct a replicated test. As REV mutants, 4 lines (REV_26_Nu-W, REV_26_Nu-He, REV89_Nu-W, REV_89_Nu-He) of BC2F3 segregated lines having been subjected to backcrossing (backcrossing parent: K326) were used. As the control of the REV mutants, the control (REV_35_WT) of the 4 lines was used. Furthermore, REV null mutant (REV_F3_Nul1) not having been subjected to backcrossing and the control thereof (REV_F3_WT) were also used as the REV mutant and the control thereof. Furthermore, Tsukuba No. 1, which is a parent variety of each mutant, and K326, which is a backcrossing parent of BC2F3 segregated line were also used for the test.
[0368] During flowering time, topping was performed immediately below the first flower branch. Then, axillary buds produced on above-ground leaves were examined. The first examination was conducted on the day of the topping and, on the subsequent weeks, 1 examination was conducted each week so that the total of 8 examinations were conducted. The axillary buds having a stem length of 5 mm or more were examined such that for each individual, the positions of axillary buds collected were recorded, and, after the axillary buds were collected, the weight of the axillary buds was measured. Primary axillary buds, secondary axillary bud, and tertiary axillary buds were separately examined and counted.
[0369] The results will be described below with reference to
[0370] As shown in
[0371] As shown in
[0372] Meanwhile, according to 2 lines (REV_26_Nu-W, REV_89_Nu-W) in which 2 alleles in a T genome have mutations and no mutation has occurred in an S genome, the number of secondary axillary buds and the fresh leaf weight were equivalent to those of the control (REV_35_WT). Therefore, in terms of REV gene, it was confirmed that introduction of mutations into the total of 3 alleles produces the effect of suppressing secondary axillary buds even if the mutations are not introduced into all of alleles in a T genome and an S genome.
[0373] (3) Development of Axillary Buds in a Case where Agrochemical for Suppressing Axillary Buds is Used
[0374] With use of a pot (inner diameter: 25 cm, height: 24 cm) which was filled with 5 L of rich soil, individuals were cultivated in a mesh house. The composition of the rich soil was as follows. Compost: 40 L, wild soil: 10 L, Kiryu sand: 15 L, Akadama soil (small): 15 L, Akadama soil (medium): 15 L, vermiculite: 10 L, Burley 5625 (fertilizer): 1000 g. Sowing was performed in May, and, after approximately 1.5 months passed since transplantation, 2 L of rich soil was added. During flowering time, up to 2 leaves below the first flower branch were cut off (topping), and, 3 days later, 30-fold diluted Contact (OAT Agrio Co., Ltd.) was applied in an amount of 20 ml per individual. 4 to 7 days after the application, it was checked whether or not Contact came into contact with primary axillary buds, and the primary axillary buds with which Contact was not in contact were recorded. After outgrowth, the primary axillary buds with which Contact was not in contact were removed. Thereafter, secondary axillary buds formed at sites where Contact was not in contact with the primary axillary buds were excluded from the subjects of examination. An individual had an average of 1 to 2 sites where Contact was not in contact with primary axillary buds. After the application of Contact, the occurrence of secondary axillary buds was examined once a week, over the total of 13 times. Since the average number of leaves produced per line varied between 25 and 31, comparisons were made between ratios of secondary axillary buds to the number of leaves produced. LS_15_null and LS_85_null, which are null mutants of LS, were compared with their control LS_77_wt in which no mutation occurred to LS. LS_14_null and LS24_null, which are null mutants of LS, were compared with their control LS_19_wt in which no mutation occurred to LS.
[0375] The results will be described below with reference to
[0376] [7. Confirmation of Effect of Mutation Introduced into Target Gene on Development of Axillary Buds (3)]
[0377] (7-1. REV Mutant and #15360 Mutant)
[0378] With use of CRISPR/Cas9 system, new mutants were prepared, and the development of axillary buds was evaluated. Since the procedure of the preparation was in compliance with the description of 3-3., only the differences from 3-3. will be described below.
[0379] (a) Preparation for Transformation
[0380] In construction of vectors for transforming Agrobacterium, Life Technologies Corporation was entrusted with the synthesis of sgRNA expression cassettes. The nucleotide sequences of the sgRNA expression cassettes obtained are as follows.
TABLE-US-00016 [Chem.4] REVG2 (SEQIDNO.297) aattggtaccAAGCTTCGTTGAACAACGGAAACTCGACTTGCCTTCCGCAC AATACATCATTTCTTCTTAGCTTTTTTTCTTCTTCTTCGTTCATACAGTTT TTTTTTGTTTATCAGCTTACATTTTCTTGAACCGTAGCTTTCGTTTTCTTC TTTTTAACTTTCCATTCGGAGTTTTTGTATCTTGTTTCATAGTTTGTCCCA GGATTAGAATGATTAGGCATCGAACCTTCAAGAATTTGATTGAATAAAACA TCTTCATTCTTAAGATATGAAGATAATCTTCAAAAGGCCCCTGGGAATCTG AAAGAAGAGAAGCAGGCCCATTTATATGGGAAAGAACAATAGTATTTCTTA TATAGGCCCATTTAAGTTGAAAACAATCTTCAAAAGTCCCACATCGCTTAG ATAAGAAAACGAAGCTGAGTTTATATACAGCTAGAGTCGAAGTAGTGATTg agttcctttccaaggctacGTTTTAGAGCTAGAAATAGCAAGTTAAAATAA GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTTTTT ggatccaatt [Chem.5] REVG5 (SEQIDNO.298) aattggtaccAAGCTTCGTTGAACAACGGAAACTCGACTTGCCTTCCGCAC AATACATCATTTCTTCTTAGCTTTTTTTCTTCTTCTTCGTTCATACAGTTT TTTTTTGTTTATCAGCTTACATTTTCTTGAACCGTAGCTTTCGTTTTCTTC TTTTTAACTTTCCATTCGGAGTTTTTGTATCTTGTTTCATAGTTTGTCCCA GGATTAGAATGATTAGGCATCGAACCTTCAAGAATTTGATTGAATAAAACA TCTTCATTCTTAAGATATGAAGATAATCTTCAAAAGGCCCCTGGGAATCTG AAAGAAGAGAAGCAGGCCCATTTATATGGGAAAGAACAATAGTATTTCTTA TATAGGCCCATTTAAGTTGAAAACAATCTTCAAAAGTCCCACATCGCTTAG ATAAGAAAACGAAGCTGAGTTTATATACAGCTAGAGTCGAAGTAGTGATTg gagtggcagcccgagcatgGTTTTAGAGCTAGAAATAGCAAGTTAAAATAA GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTTTTT ggatccaatt [Chem.6] ROXG1 (SEQIDNO.299) aattggtaccAAGCTTCGTTGAACAACGGAAACTCGACTTGCCTTCCGCAC AATACATCATTTCTTCTTAGCTTTTTTTCTTCTTCTTCGTTCATACAGTTT TTTTTTGTTTATCAGCTTACATTTTCTTGAACCGTAGCTTTCGTTTTCTTC TTTTTAACTTTCCATTCGGAGTTTTTGTATCTTGTTTCATAGTTTGTCCCA GGATTAGAATGATTAGGCATCGAACCTTCAAGAATTTGATTGAATAAAACA TCTTCATTCTTAAGATATGAAGATAATCTTCAAAAGGCCCCTGGGAATCTG AAAGAAGAGAAGCAGGCCCATTTATATGGGAAAGAACAATAGTATTTCTTA TATAGGCCCATTTAAGTTGAAAACAATCTTCAAAAGTCCCACATCGCTTAG ATAAGAAAACGAAGCTGAGTTTATATACAGCTAGAGTCGAAGTAGTGATTg tgtagcagctcgtgaaagaGTTTTAGAGCTAGAAATAGCAAGTTAAAATAA GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTTTTT ggatccaatt
In each of the above three sgRNA expression cassettes, (i) the underlined portion indicates the guide sequence, (ii) the portion upstream to the underlined portion indicates the AtU6-26 promoter sequence, (iii) the portion downstream to the underlined portion indicates the scaffold-polyT sequence, and (iv) the lower case letters at the terminus indicate restriction enzyme sequences of KpnI and BamHI.
[0381] (b) Transformation of Tobacco and Cultivation of Transformant
[0382] The transformation of a tobacco plant and the cultivation of the transformant were as described in (b) of 3-3. except that selection of individuals based on Cas9 mRNA level was not performed.
[0383] (c) Confirmation of Presence/Absence of Mutation and Mutant Sequence
[0384] The following were checked as described in (c) of 3-3.: (i) the presence/absence of a mutation in the cultivated transformants and (ii) the mutant sequences. Primers for specifically amplifying a region containing a guide sequence on genomic DNA were designed. The sequences of the primers are shown in the following Table.
TABLE-US-00017 TABLE3 Primername Sequence Targetsample Analyzedgenome REV_Nt_in2_F1 AACCAATGGACAAGAAACGGATGGCA REVG2 Tgenome (SEQIDNO.260) REV_Nt_in4_R1 TTTAGCTATCCAGTCAAAGAGGCACG (SEQIDNO.261) REV_Ns_in2_F1 CCAATAAACAAGAAACAGATGATGG Sgenome (SEQIDNO.253) REV_Ns_in4_R1 GAGACATGGCAATACTGAATTTTCA (SEQIDNO.256) REV_Nt_in4_F1 AAAAAAATTCAGTATTGCCACGTGC REVG5 Tgenome (SEQIDNO.155) REV_Nt_in6_R1 AGCCTACGTGAAGATTGATGAGAAA (SEQIDNO.262) REV_Ns_in4_F1 GAAAATTCAGTATTGCCATGTC Sgenome (SEQIDNo.152) REV_Ns_in6_R1 AGCCTACGTGAAGATTGATGAGAAG (SEQIDNO.257) 15360-1_F1 TGCATGGACAATCTCCTCTT ROXG1 Tgenome (SEQIDNO.176) 15360-1_R1-2 CAACAGGAGTTGAGTTATTCTCAT (SEQIDNO.178) 15360-2_F1 GCATGGACAATCTCATCTTCTC Sgenome (SEQIDNo.177) 15360-2_R1 CTGGGCAATATTCCACCATT (SEQIDNO.181)
[0385] The reaction conditions of PCR were as follows.
(REVG2)
[0386] 60 seconds at 94 C.
45 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 60 C., and 50 seconds at 68 C.
(REVG5, ROXG1)
[0387] 60 seconds at 94 C.
45 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 62 C., and 50 seconds at 68 C.
[0388] (d) Selection of Transformants
[0389] Individuals of T0 generation having mutations (deletion or insertion of 1 or more bases) in a T genome and an S genome were selfed and collected, so that a T1 line was obtained. The presence/absence of the mutation in the individuals of the T1 line and the sequence in the individuals of the T1 line were confirmed with use of the primers shown in Table 3. T1 individuals, in which mutations occurred to all of 4 alleles of an S genome and a T genome, were selected and used for the test. The details of the T1 individuals obtained are as follows.
REV_G2-15
[0390] T genome: 6 bases CAAGGC are deleted. While WT consists of 839 amino acids, a polypeptide (SEQ ID NO. 65) is produced such that 2 amino acids (KA) (175th and 176th amino acids) are deleted so as to constitute 837 amino acids.
S genome: 1 base A is inserted. While WT consists of 838 amino acids, a polypeptide (SEQ ID NO. 64) is produced such that unrelated 5 amino acids (YRNCC) are added in addition to an amino acid sequence in which up to 176 amino acids are identical to those of WT.
REV_G2_94
[0391] T genome: 1 base T is inserted. While WT consists of 839 amino acids, a polypeptide (SEQ ID NO. 67) is produced such that unrelated 5 amino acids (YRNCC) are added in addition to an amino acid sequence in which up to 176 amino acids are identical to those of WT.
S genome: 1 base T is inserted. While WT consists of 838 amino acids, a polypeptide (SEQ ID NO. 66) is produced such that unrelated 5 amino acids (YRNCC (positions 177 through 181 in SEQ ID NO. 66)) are added in addition to an amino acid sequence in which up to 176 amino acids are identical to those of WT.
REV_G5_18
[0392] T genome: 1 base C is inserted. While WT consists of 839 amino acids, a polypeptide (SEQ ID NO. 68) is produced such that unrelated 4 amino acids (MWSC (positions 213 through 216 in SEQ ID NO. 68)) are added in addition to an amino acid sequence in which up to 212 amino acids are identical to those of WT.
S genome: 5 bases TCGAC are inserted. While WT consists of 838 amino acids, a polypeptide (SEQ ID NO. 69) is produced such that unrelated 7 amino acids (RHVVLLV (positions 213 through 219 in SEQ ID NO. 69)) are added in addition to an amino acid sequence in which up to 212 amino acids are identical to those of WT.
REV_G5_59
[0393] T genome: 28 bases are deleted. While WT consists of 839 amino acids, a polypeptide (SEQ ID NO. 71) is produced such that unrelated 54 amino acids (QRLLRSSKIDLLGSEIAGTLKFSQCFLQEMEQLNFCTRRYMLLPPW LLHVIFGL (positions 212through 265 in SEQ ID NO. 71)) are added in addition to an amino acid sequence in which up to 211 amino acids are identical to those of WT.
S genome: 3 bases GCA are deleted. While WT consists of 838 amino acids, a polypeptide (SEQ ID NO. 70) is produced such that 1 amino acid (A) (212th amino acid) is deleted so as to constitute 837 amino acids.
ROX_G1-1 (15360_G1-1), ROXG1-30 (15360_G1-30)
[0394] T genome: 1 base A is inserted. While WT consists of 165 amino acids, polypeptides (SEQ ID NOs. 123, 125) are produced such that unrelated 3 amino acids (KKA) are added in addition to an amino acid sequence in which up to 40 amino acids are identical to those of WT.
S genome: 1 base A is deleted. While WT consists of 168 amino acids, polypeptides (SEQ ID NOs. 122, 124) are produced such that unrelated 14 amino acids (EGIESVIVSRFCRV (positions 41 through 54 in SEQ ID NOs. 122, 124)) are added in addition to an amino acid sequence in which up to 40 amino acids are identical to those of WT.
ROX_G1-131 (15360_G1-131)
[0395] T genome: 1 base A is deleted. While WT consists of 165 amino acids, a polypeptide (SEQ ID NO. 129) is produced such that unrelated 14 amino acids (EGIESVIVSRFCRV (positions 41 through 54 in SEQ ID NO. 129)) are added in addition to an amino acid sequence in which up to 40 amino acids are identical to those of WT.
S genome: 39 bases and 13 bases are inserted. While WT consists of 168 amino acids, a polypeptide (SEQ ID NO. 128) is produced such that unrelated 4 amino acids (FLCG) are added in addition to an amino acid sequence in which up to 39 amino acids are identical to those of WT.
ROX_G1-46 (15360_G1-46)
[0396] T genome: 20 bases are deleted. While WT consists of 165 amino acids, a polypeptide (SEQ ID NO. 127) is produced such that unrelated 3 amino acids (ENQ) are added in addition to an amino acid sequence in which up to 36 amino acids are identical to those of WT.
S genome: 1 base G is inserted. While WT consists of 168 amino acids, a polypeptide (SEQ ID NO. 126) is produced such that unrelated 3 amino acids (EKA) are added in addition to an amino acid sequence in which up to 40 amino acids are identical to those of WT.
[0397] (e) Evaluation of Development of Axillary Buds in Greenhouse
[0398] The individuals of T1 line obtained in (d) above were cultivated in a greenhouse, and evaluated according to the description of 2-2.
[0399] As shown in
[0400] (7-2. Bl1 Mutant and LS Mutant)
[0401] (a) Preparation for Transformation
[0402] In the construction of the vectors for transforming Agrobacterium, Life Technologies Corporation was entrusted with synthesis, through GeneArt (registered trademark) Strings (trademark) DNA Fragments, of sgRNA expression cassette in which KpnI site and BamHI site are added to 5 end and 3 end, respectively. The base sequences of the sgRNA expression cassettes obtained are as follows.
TABLE-US-00018 [Chem.7] 2G-36_10,2G-37_103,2G-126_10,2G-126_139 (SEQIDNO.300) aattggtaccAGAAATCTCAAAATTCCGGCAGAACAATTTTGAATCTCGAT CCGTAGAAACGAGACGGTCATTGTTTTAGTTCCACCACGATTATATTTGAA ATTTACGTGAGTGTGAGTGAGACTTGCATAAGAAAATAAAATCTTTAGTTG GGAAAAAATTCAATAATATAAATGGGCTTGAGAAGGAAGCGAGGGATAGGC CTTTTTCTAAAATAGGCCCATTTAAGCTATTAACAATCTTCAAAAGTACCA CAGCGCTTAGGTAAAGAAAGCAGCTGAGTTTATATATGGTTAGAGACGAAG TAGTGATTggaagagttgtagattgagaGTTTTAGAGCTAGAAATAGCAAG TTAAAATAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT GCTTTTTTTggatccaatt
In the above sequence, (i) the underlined portion indicates the guide sequence, (ii) the portion upstream to the underlined portion indicates the AtU6-1 promoter sequence, (iii) the portion downstream to the underlined portion indicates the scaffold-polyT sequence, and (iv) the lower case letters at the terminus indicate restriction enzyme sequences of KpnI and BamHI.
[0403] In addition, sgRNA expression cassettes, in which KpnI site and BamHI site are added to 5 end and 3 end, respectively, were synthesized by utilizing gene synthesis service of Eurofins Genomics K.K. The nucleotide sequences of the sgRNA expression cassettes obtained are as follows. Note that the subsequent transformation of tobacco and the cultivation of the transformant are not different from the description in 3-3. above, and therefore will not be described.
TABLE-US-00019 [Chem.8] LS_1A (SEQIDNO.301) aattggtaccTTTACTTTAAATTTTTTCTTATGCAGCCTGTGATGGATAAC TGAATCAAACAAATGGCGTCTGGGTTTAAGAAGATCTGTTTTGGCTATGTT GGACGAAACAAGTGAACTTTTAGGATCAACTTCAGTTTATATATGGAGCTT ATATCGAGCAATAAGATAAGTGGGCTTTTTATGTAATTTAATGGGCTATCG TCCATAGATTCACTAATACCCATGCCCAGTACCCATGTATGCGTTTCATAT AAGCTCCTAATTTCTCCCACATCGCTCAAATCTAAACAAATCTTGTTGTAT ATATAACACTGAGGGAGCAACATTGGTCactgtgtattttatcttcacGTT TTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA AAAAGTGGCACCGAGTCGGTGCTTTTTTTggatccaatt [Chem.9] LS_3A (SEQIDNO.302) aattggtaccTTTACTTTAAATTTTTTCTTATGCAGCCTGTGATGGATAAC TGAATCAAACAAATGGCGTCTGGGTTTAAGAAGATCTGTTTTGGCTATGTT GGACGAAACAAGTGAACTTTTAGGATCAACTTCAGTTTATATATGGAGCTT ATATCGAGCAATAAGATAAGTGGGCTTTTTATGTAATTTAATGGGCTATCG TCCATAGATTCACTAATACCCATGCCCAGTACCCATGTATGCGTTTCATAT AAGCTCCTAATTTCTCCCACATCGCTCAAATCTAAACAAATCTTGTTGTAT ATATAACACTGAGGGAGCAACATTGGTCacgagtaattctttcttcttGTT TTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA AAAAGTGGCACCGAGTCGGTGCTTTTTTTggatccaatt [Chem.10] B1_4A (SEQIDNO.303) aattggtaccTTTACTTTAAATTTTTTCTTATGCAGCCTGTGATGGATAAC TGAATCAAACAAATGGCGTCTGGGTTTAAGAAGATCTGTTTTGGCTATGTT GGACGAAACAAGTGAACTTTTAGGATCAACTTCAGTTTATATATGGAGCTT ATATCGAGCAATAAGATAAGTGGGCTTTTTATGTAATTTAATGGGCTATCG TCCATAGATTCACTAATACCCATGCCCAGTACCCATGTATGCGTTTCATAT AAGCTCCTAATTTCTCCCACATCGCTCAAATCTAAACAAATCTTGTTGTAT ATATAACACTGAGGGAGCAACATTGGTCagctaacaagttgtaccaaGTTT TAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGAA AAAGTGGCACCGAGTCGGTGCTTTTTTTggatccaatt
In each of the above three sequences, (i) the underlined portion indicates the guide sequence, (ii) the portion upstream to the underlined portion indicates the AtU3B promoter sequence, (iii) the portion downstream to the underlined portion indicates the scaffold-polyT sequence, and (iv) the lower case letters at the terminus indicate restriction enzyme sequences of KpnI and BamHI.
[0404] (b) Confirmation of Presence/Absence of Mutation and Mutant Sequence
[0405] The following were checked as described in (c) of 3-3.: (i) the presence/absence of a mutation in the cultivated transformants and (ii) the mutant sequences. Primers for specifically amplifying a region containing a guide sequence on genomic DNA were designed. The sequences of the primers are as follows. In addition, as shown below, PCR was performed with only part of the conditions changed.
TABLE-US-00020 (2A-1_14,2A-1_19,2A-1_119,2A-1_120,2A_133_17, 2A_133_122,2A_133_142:Tgenome) CombinationofNtB11-1_2A_F1: (SEQIDNO.293) AAGTATTACTACTACAAAATTCCAACG, and Nb_B11_2A_R1: (SEQIDNO.294) CCATCTGATGAAGAACAACTTGC (2A-1_14,2A-1_19,2A-1_119,2A-1_120,2A_133_17, 2A_133_122,2A_133_142:Sgenome) CombinationofNtB11-2_1A_F1: (SEQIDNO.295) TTAAACACTAGAGAGTGAGAGAGTGC, and NtB11-2_2A_F1: (SEQIDNO.296) CAGATGTTTAATTATTAAGACAAAGTTCC (2G-35_102G-37_103,2G-126_10,2G-126_139: Tgenome) NtB11-1_2G_F1: (SEQIDNO.304) ATATGTTTGAATATAGGGGGAGGG, and NtB11-1_2G_R1: (SEQIDNO.305) TGGTTTACAAAAGGAAAAGTTTTC (2G-35_10,2G-37_103,2G-126_10,2G-126_139: Sgenome) CombinationofNtB11-2_2G_F1: (SEQIDNO.306) ATATGTTTGAGTATAAAGGGAGGA, and NtB11-2_2G_R1: (SEQIDNO.307) TTGGTTTACTAGAGAAAAAATTTCC (LS_1A-8_4,13,LS_1A-9_32,48:Tgenome) CombinationofLS_1A_F_T: (SEQIDNO.308) TACCGGTACTGGAAATGACCTC, and LS_1A_R_T: (SEQIDNO.309) TCCTTAACATTTCGCGGTCT (LS_1A-8_4,13,LS_1A-9_32,48:Sgenome) CombinationofLS_1A_F_S: (SEQIDNO.310) CCGGTACTGGAAATGACCTTG, and LS_1,2_R3: (SEQIDNO.264) GCAAAGTTGCTTCCAATGAAT (LS_3A-12,LS_3A-15,andLS_3A-30:Tgenome) CombinationofLS_3A_4G_F_T: (SEQIDNO.311) GTTTGGTTCGGAAGAGAAATTATAG, and LS_3A_4G_R_T: (SEQIDNO.312) CTTTGTCCTTCACCATGCAG (LS_3A-12,LS_3A-15,andLS_3A-30:Sgenome) CombinationofLS_3A_4G_F_S: (SEQIDNO.313) TTGGTTCGGGAGAGAAATAATTGA, and LS_3A_4G_R_S: (SEQIDNO.314) CGCCAAGAAGATATGGAAAA (B1_4A-11,B1_4A-13,B14A-16:Tgenome) CombinationofB1_3A_4A_F_T: (SEQIDNO.315) ATTTCTTCTGCCCACCAGC, and B1_3A_4A_R_ST: (SEQIDNO.316) TCTCATCATTGAACACGAACA (B1_4A-11,B1_4A-13,B14A-16:Sgenome) CombinationofB1_3A_4A_F_S: (SEQIDNO.317) CCTAATTTGGGTGCTACAAATAAT, and B1_3A_4A_R_ST: (SEQIDNO.316) TCTCATCATTGAACACGAACA
(Changes in PCR conditions)
T genome of LS_1A
60 seconds at 94 C.
40 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 57 C., and 50 seconds at 68 C.
S genome of LS_1A
60 seconds at 94 C.
45 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 65 C., and 50 seconds at 68 C.
T genome of LS_3A
60 seconds at 94 C.
45 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 55 C., and 35 seconds at 68 C.
S genome of LS_3A
60 seconds at 94 C.
40 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 60 C., and 50 seconds at 68 C.
T genome and S genome of Bl_4A
60 seconds at 94 C.
40 cycles while each cycle includes 10 seconds at 98 C., 15 seconds at 60 C., and 50 seconds at 68 C.
[0406] (c) Selection of Transformants
[0407] According to the description in 3-3. above, T2 line and T1 line below were selected. First, mutant polypeptides in individuals of T2 line obtained are as follows.
2A-1_14
[0408] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 84) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 84)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide identical to WT is produced, and a polypeptide (SEQ ID NO. 83) is produced such that unrelated 3 amino acids (LEY) are added in addition to up to 106 amino acids identical to those of WT.
2A-1_19
[0409] T genome: While WT consists of 336 amino acids, a polypeptide identical to WT is produced, and a polypeptide (SEQ ID NO. 86) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 86)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide (SEQ ID NO. 85) is produced such that unrelated 3 amino acids (LEY) are added in addition to up to 106 amino acids identical to those of WT.
2A_133_17
[0410] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 98) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 98)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: A polypeptide (SEQ ID NO. 97) consisting of 337 amino acids identical to those of WT is produced. 2A_133_122
T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 100) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 100)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide identical to WT is produced, and a polypeptide (SEQ ID NO. 99) is produced such that 107th asparagine of WT is deleted so as to constitute 336 amino acids.
2A_133_142
[0411] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 102) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 102)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide identical to WT is produced, and a polypeptide (SEQ ID NO. 101) is produced such that 107th asparagine of WT is deleted so as to constitute 336 amino acids.
2A_1_119
[0412] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 88) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 88)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: A polypeptide (SEQ ID NO. 87) consisting of 337 amino acids identical to those of WT is produced. 2A_1_120
T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 90) is produced such that unrelated 12 amino acids (TGILNSRKSLWD (positions 108 through 119 in SEQ ID NO. 90)) are added in addition to up to 107 amino acids identical to those of WT.
S genome: A polypeptide (SEQ ID NO. 89) consisting of 337 amino acids identical to those of WT is produced. 2G-35_10
T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 110) is produced such that unrelated 8 amino acids (KMAKLSKA (positions 57 through 64 in SEQ ID NO. 110)) are added in addition to up to 56 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide (SEQ ID NO. 109) is produced such that up to 56 amino acids are identical to those of WT.
2G-37_103
[0413] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 112) is produced such that 2 amino acids (55th and 56th amino acids) are deleted so as to constitute 334 amino acids.
S genome: While WT consists of 337 amino acids, a polypeptide (SEQ ID NO. 111) is produced such that unrelated 7 amino acids (MAKLFKA (positions 55 through 61 in SEQ ID NO. 111)) are added in addition to up to 54 amino acids identical to those of WT.
2G-126_10
[0414] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 114) is produced such that unrelated 2 amino acids (DG) are added in addition to up to 56 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide (SEQ ID NO. 113) is produced such that up to 56 amino acids are identical to those of WT.
2G-126_139
[0415] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 118) is produced such that unrelated 1 amino acids (I) are added in addition to up to 54 amino acids identical to those of WT.
S genome: While WT consists of 337 amino acids, a polypeptide (SEQ ID NO. 117) is produced such that unrelated 6 amino acids (AKLFKA (positions 53 through 58 in SEQ ID NO. 117)) are added in addition to up to 52 amino acids identical to those of WT.
[0416] Next, the mutant polypeptides in individuals of T1 line obtained are as follows.
LS_1A-8
[0417] T genome: While WT consists of 410 amino acids, a polypeptide (SEQ ID NO. 73) is produced such that unrelated 15 amino acids (TQALKRPRNVKDFFA (positions 248 through 262 in SEQ ID NO. 73)) are added in addition to up to 247 amino acids identical to those of WT.
S genome: While WT consists of 407 amino acids, a polypeptide (SEQ ID NO. 72) is produced such that unrelated 15 amino acids (PQALERPRKVKDFFA (positions 244 through 258 in SEQ ID NO. 72)) are added in addition to up to 243 amino acids identical to those of WT.
LS_1A-9
[0418] T genome: While WT consists of 410 amino acids, a polypeptide (SEQ ID NO. 76) is produced such that unrelated 3 amino acids (TGS) are added in addition to up to 246 amino acids identical to those of WT.
S genome: While WT consists of 407 amino acids, (i) a polypeptide (SEQ ID NO. 75) is produced such that unrelated 15 amino acids (SQALERPRKVKDFFA (positions 245 through 259 in SEQ ID NO. 75)) are added in addition to up to 244 amino acids identical to those of WT and (ii) a polypeptide (SEQ ID NO. 74) is produced such that unrelated 15 amino acids (TQALERPRKVKDFFA (positions 245 through 259 in SEQ ID NO. 74)) are added in addition to up to 244 amino acids identical to those of WT.
LS_3A-12
[0419] T genome: While WT consists of 410 amino acids, a polypeptide (SEQ ID NO. 78) is produced such that unrelated 18 amino acids (SWVGKINPFFPYLLGVKL (positions 395 through 412 in SEQ ID NO. 78)) are added in addition to up to 394 amino acids identical to those of WT.
S genome: While WT consists of 407 amino acids, a polypeptide (SEQ ID NO. 77) is produced such that unrelated 66 amino acids (SWVGKINPFFPYLLGVKFKTLKNKIFIYLHGEGQRGLQSQVLFFFFY IYILFGFKVIGLMNVLILT (positions 392 through 457 in SEQ ID NO. 77)) are added in addition to up to 391 amino acids identical to those of WT.
LS_3A-15
[0420] T genome: While WT consists of 410 amino acids, a polypeptide (SEQ ID NO. 80) is produced such that unrelated 18 amino acids (SWVGKINPFFPYLLGVKL (positions 395 through 412 in SEQ ID NO. 80)) are added in addition to up to 394 amino acids identical to those of WT.
S genome: While WT consists of 407 amino acids, a polypeptide (SEQ ID NO. 79) is produced such that unrelated 66 amino acids (SWVGKINPFFPYLLGVKFKTLKNKIFIYLHGEGQRGLQSQVLFFFFY IYILFGFKVIGLMNVLILT (positions 392 through 457 in SEQ ID NO. 79)) are added in addition to up to 391 amino acids identical to those of WT.
LS_3A-30
[0421] T genome: While WT consists of 410 amino acids, a polypeptide (SEQ ID NO. 82) is produced such that unrelated 14 amino acids (LAKSTPFFHIFLAL (positions 398 through 411 in SEQ ID NO. 82)) are added in addition to up to 397 amino acids identical to those of WT.
S genome: While WT consists of 407 amino acids, a polypeptide (SEQ ID NO. 81) is produced such that unrelated 18 amino acids (LAKSTPFFHIFLALNLKP (positions 395 through 412 in SEQ ID NO. 81)) are added in addition to up to 394 amino acids identical to those of WT.
Bl_4A-11
[0422] T genome: While WT consists of 336 amino acids, a polypeptide (SEQ ID NO. 121) is produced such that unrelated 29 amino acids (MATMAVLLDVTTTTVCSCSMMRIITSQMR (positions 302 through 330 in SEQ ID NO. 121)) are added in addition to up to 301 amino acids identical to those of WT.
[0423] S genome: While WT consists of 337 amino acids, (i) a polypeptide (SEQ ID NO. 120) is produced such that unrelated 5 amino acids (QWQQW (positions 303 through 307 in SEQ ID NO. 120)) are added in addition to up to 302 amino acids identical to those of WT and (ii) a polypeptide (SEQ ID NO. 119) is produced such that unrelated 4 amino acids (YYWM (positions 303 through 306 in SEQ ID NO. 119)) are added in addition to likewise up to 302 amino acids identical to those of WT.
[0424] (e) Evaluation of Development of Axillary Buds in Greenhouse
[0425] Individuals of 7 of T2 lines (2A-1_14, 2A-133_122, 2A-133_142, 2A-1_19, 2A-133_17, 2A-1_119, and 2A-1_120), in which at least one of alleles of Bl1 gene was not mutated, were cultivated in a greenhouse, and axillary buds thereof were evaluated according to the description of 3-3. above. 2A-1_14, 2A-133_122, and 2A-133_142 did not have a mutation of one of alleles of Bl1 in an S genome (T.sup.+/+S.sup.+/). 2A-1_19 did not have a mutation of one of alleles of Bl1 in a T genome (T.sup.+/S.sup.+/+). 2A-133_17, 2A-1_119, and 2A-1_120 did not have a mutation of any of alleles of Bl1 in an S genome (T.sup.+/+S.sup./). Although none of the 7 lines evaluated did not show any difference from the control WT (SR-1) in terms of the number and weight of primary axillary buds, there was a significant decrease in the number and weight of secondary axillary buds (
[0426] Axillary buds of 5 of T2 lines (2G-35_10, 2 G-37_103, 2 G-126_10, 2G-126_139, Bl_4A-11) were evaluated. Although these lines have mutations introduced into different genes (LS or Bl1), these lines share commonality in that the mutation causes frame shifting, so that a polypeptide shorter than a wild-type polypeptide is produced.
[0427] Next, 5 of T1 lines (LS_1A-8, LS_1A-9, LS_3A-12, LS_3A-15, LS_3A-30) were likewise evaluated.
REFERENCES
[0428] 1. Takahashi H, Kamakura H, Sato Y, Shiono K, Abiko T, Tsutsumi N, Nagamura Y, Nishizawa NK, Nakazono M. (2010) A method for obtaining high quality RNA from paraffin sections of plant tissues by laser microdissection. J Plant Res 123: 807-813 [0429] 2. Li J F, Norville J E, Aach J, McCormack M, Zhang D, Bush J, Church G M, Sheen J. (2013) Multiplex and homologous recombination-mediated genome editing in Arabidopsis and Nicotiana benthamiana using guide RNA and Cas9. Nat Biotechnol. 31(8), 688-91. [0430] 3. Waibel F, Filipowicz W. (1990) U6 snRNA genes of Arabidopsis are transcribed by RNA polymerase III but contain the same two upstream promoter elements as RNA polymerase II-transcribed U-snRNA genes. Nucleic Acids Res. 25; 18(12), 3451-8.4. Marshallsay Cl, Kiss T, Filipowicz W. (1990) Amplification of plant U3 and U6 snRNA gene sequences using primers specific for an upstream promoter element and conserved intragenic regions. Nucleic Acids Res. 25; 18(12), 3459-66.
INDUSTRIAL APPLICABILITY
[0431] With an embodiment of the present invention, it is possible to suppress the development of unnecessary axillary buds during cultivation of tobacco plant. This allows for a reduction in labor and cost during cultivation, and leads to an increase in quality of leaves to be harvested. In addition, with an embodiment of the present invention, it is possible to selectively suppress the development of secondary axillary buds. This can increase the possibility of preventing the death of a plant caused by damage due to a disaster or the like.