USE OF A MULTIMERIC ANTI-DR5 BINDING MOLECULE IN COMBINATION WITH A CHEMOTHERAPEUTIC AGENT FOR TREATING CANCER
20200392239 ยท 2020-12-17
Inventors
Cpc classification
A61K39/395
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K31/4745
HUMAN NECESSITIES
A61K31/437
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
A61K31/4745
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K31/437
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
Abstract
This disclosure provides therapeutic methods for treating cancer including combination therapy with a multimeric anti-DR5 antibody and a chemotherapeutic agent, e.g., a type I topoisomerase inhibitor, a nucleoside analog, or a pro-apoptotic agent, e.g., a BCL-2 inhibitor.
Claims
1. A method for inhibiting, delaying, or reducing malignant cell growth in a subject with cancer, comprising administering to a subject in need of treatment a combination therapy comprising: (a) an effective amount of a dimeric IgA antibody or a hexameric or pentameric IgM antibody, or a multimerized, antigen-binding fragment, variant, or derivative thereof that specifically and agonistically binds to DR5, wherein at least three antigen binding domains of the IgA or IgM antibody or fragment thereof are DR5-specific and agonistic; and (b) an effective amount of a chemotherapeutic agent;
2. The method of claim 1, wherein the chemotherapeutic agent is a DNA topoisomerase I inhibitor.
3. The method of claim 2, wherein the DNA topoisomerase I inhibitor is a camptothecin derivative or an active variant, isomer, or salt thereof.
4. The method of claim 2, wherein the topoisomerase I inhibitor comprises Irinotecan or Topotecan.
5. The method of claim 4, wherein the topoisomerase I inhibitor comprises Irinotecan.
6. The method of claim 1, wherein the chemotherapeutic agent comprises a nucleoside analog or an active variant, isomer, or salt thereof.
7. The method of claim 6, wherein the nucleoside analog is Gemcitabine.
8. The method of claim 1, wherein the chemotherapeutic agent is a pro-apoptotic agent.
9. The method of claim 8, wherein the pro-apoptotic agent is a BCL-2 inhibitor or an active variant, isomer, or salt thereof.
10. The method of claim 9, wherein the BCL-2 inhibitor is Venetoclax.
11. The method of claim any one of claims 1 to 10, wherein at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or twelve antigen-binding domains of the antibody or fragment, variant or derivative thereof comprise a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH and VL comprise six immunoglobulin complementarity determining regions HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3, wherein the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprise the CDRs of an antibody comprising the VH and VL amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 5 and SEQ ID NO: 6; SEQ ID NO: 7 and SEQ ID NO: 8; SEQ ID NO: 9 and SEQ ID NO: 10; SEQ ID NO: 11 and SEQ ID NO: 12; SEQ ID NO: 13 and SEQ ID NO: 14; SEQ ID NO: 15 and SEQ ID NO: 16; SEQ ID NO: 17 and SEQ ID NO: 18; SEQ ID NO: 19 and SEQ ID NO: 20; SEQ ID NO: 21 and SEQ ID NO: 22; SEQ ID NO: 23 and SEQ ID NO: 24; SEQ ID NO: 25 and SEQ ID NO: 26; SEQ ID NO: 27 and SEQ ID NO: 28; SEQ ID NO: 29 and SEQ ID NO: 30; SEQ ID NO: 31 and SEQ ID NO: 32; SEQ ID NO: 33 and SEQ ID NO: 34; SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 37 and SEQ ID NO: 38; SEQ ID NO: 39 and SEQ ID NO: 40; SEQ ID NO: 41 and SEQ ID NO: 42; SEQ ID NO: 43 and SEQ ID NO: 44; SEQ ID NO: 45 and SEQ ID NO: 46; SEQ ID NO: 47 and SEQ ID NO: 48; SEQ ID NO: 49 and SEQ ID NO: 50; SEQ ID NO: 51 and SEQ ID NO: 52; SEQ ID NO: 53 and SEQ ID NO: 54; SEQ ID NO: 55 and SEQ ID NO: 56; SEQ ID NO: 82 and SEQ ID NO: 83; SEQ ID NO: 84 and SEQ ID NO: 85; SEQ ID NO: 86 and SEQ ID NO: 87; or SEQ ID NO: 88 and SEQ ID NO: 89; respectively, or the ScFv sequence SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, or SEQ ID NO: 73 or the six CDRs with one or two amino acid substitutions in one or more of the CDRs.
12. The method of claim any one of claims 1 to 10, wherein at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or twelve antigen-binding domains of the antibody or fragment, variant or derivative thereof comprise an antibody VH and a VL, wherein the VH and VL comprise amino acid sequences at least 90% identical to SEQ ID NO: 1 and SEQ ID NO: 2; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 5 and SEQ ID NO: 6; SEQ ID NO: 7 and SEQ ID NO: 8; SEQ ID NO: 9 and SEQ ID NO: 10; SEQ ID NO: 11 and SEQ ID NO: 12; SEQ ID NO: 13 and SEQ ID NO: 14; SEQ ID NO: 15 and SEQ ID NO: 16; SEQ ID NO: 17 and SEQ ID NO: 18; SEQ ID NO: 19 and SEQ ID NO: 20; SEQ ID NO: 21 and SEQ ID NO: 22; SEQ ID NO: 23 and SEQ ID NO: 24; SEQ ID NO: 25 and SEQ ID NO: 26; SEQ ID NO: 27 and SEQ ID NO: 28; SEQ ID NO: 29 and SEQ ID NO: 30; SEQ ID NO: 31 and SEQ ID NO: 32; SEQ ID NO: 33 and SEQ ID NO: 34; SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 37 and SEQ ID NO: 38; SEQ ID NO: 39 and SEQ ID NO: 40; SEQ ID NO: 41 and SEQ ID NO: 42; SEQ ID NO: 43 and SEQ ID NO: 44; SEQ ID NO: 45 and SEQ ID NO: 46; SEQ ID NO: 47 and SEQ ID NO: 48; SEQ ID NO: 49 and SEQ ID NO: 50; SEQ ID NO: 51 and SEQ ID NO: 52; SEQ ID NO: 53 and SEQ ID NO: 54; SEQ ID NO: 55 and SEQ ID NO: 56; SEQ ID NO: 82 and SEQ ID NO: 83; SEQ ID NO: 84 and SEQ ID NO: 85; SEQ ID NO: 86 and SEQ ID NO: 87; or SEQ ID NO: 88 and SEQ ID NO: 89; respectively, or wherein the VH and VL are contained in an ScFv with an amino acid sequence at least 90% identical to SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, or SEQ ID NO: 73.
13. The method of claim 12, wherein at least four, at least ten, or twelve antigen-binding domains of the antibody or fragment, variant or derivative thereof comprise antibody VH and VL regions comprising the amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, SEQ ID NO: 84 and SEQ ID NO: 85, or SEQ ID NO: 88 and SEQ ID NO: 89, respectively.
14. The method of any one of claims 1 to 13, wherein the antibody or fragment, variant or derivative thereof is a dimeric IgA antibody comprising two bivalent IgA binding units or fragments thereof and a J chain or fragment or variant thereof, wherein each binding unit comprises two IgA heavy chain constant regions or fragments thereof each associated with an antigen-binding domain.
15. The method of claim 14, wherein the IgA antibody or fragment thereof further comprises a secretory component, or fragment or variant thereof.
16. The method of claim 14 or claim 15, wherein the IgA heavy chain constant regions or fragments thereof each comprise a C1 domain, a C2 domain, and a C3-tp domain.
17. The method of any one of claims 14 to 16, wherein the IgA heavy chain constant region is a human IgA constant region.
18. The method of any one of claims 14 to 17, wherein each binding unit comprises two IgA heavy chains each comprising a VH situated amino terminal to the IgA constant region or fragment thereof, and two immunoglobulin light chains each comprising a VL situated amino terminal to an immunoglobulin light chain constant region.
19. The method of any one of claims 1 to 13, wherein the antibody or fragment, variant or derivative thereof is a pentameric or a hexameric IgM antibody comprising five or six bivalent IgM binding units, respectively, wherein each binding unit comprises two IgM heavy chain constant regions or fragments thereof each associated with an antigen-binding domain, and wherein the IgM heavy chain constant regions or fragments thereof each comprise a C1 domain, a C2 domain, a C3 domain and a C4-tp domain.
20. The method of claim 19, wherein the antibody or fragment, variant or derivative thereof is pentameric, and further comprises a J chain, or fragment thereof, or variant thereof.
21. The method of claim 19 or claim 20, wherein the IgM heavy chain constant region is a human IgM constant region.
22. The method of any one of claims 19 to 21, wherein each binding unit comprises two IgM heavy chains each comprising a VH situated amino terminal to the IgM constant region or fragment thereof, and two immunoglobulin light chains each comprising a VL situated amino terminal to an immunoglobulin light chain constant region.
23. The method of any one of claims 1 to 22, wherein administration of the combination therapy results in enhanced therapeutic efficacy relative to administration of the antibody or fragment thereof or the chemotherapeutic agent alone.
24. The method of claim 23, wherein the enhanced therapeutic efficacy comprises a reduced tumor growth rate, tumor regression, or increased survival.
25. The method of any one of claims 1 to 24, wherein the subject is human.
Description
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
Definitions
[0028] It is to be noted that the term a or an entity refers to one or more of that entity; for example, a binding molecule, is understood to represent one or more binding molecules. As such, the terms a (or an), one or more, and at least one can be used interchangeably herein.
[0029] Furthermore, and/or where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term and/or as used in a phrase such as A and/or B herein is intended to include A and B, A or B, A (alone), and B (alone). Likewise, the term and/or as used in a phrase such as A, B, and/or C is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[0030] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary of Biochemistry and Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.
[0031] Units, prefixes, and symbols are denoted in their Systme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects or aspects of the disclosure, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.
[0032] As used herein, the term polypeptide is intended to encompass a singular polypeptide as well as plural polypeptides, and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). The term polypeptide refers to any chain or chains of two or more amino acids and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, protein, amino acid chain, or any other term used to refer to a chain or chains of two or more amino acids are included within the definition of polypeptide, and the term polypeptide can be used instead of, or interchangeably with any of these terms. The term polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, and derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide can be derived from a biological source or produced by recombinant technology but is not necessarily translated from a designated nucleic acid sequence. It can be generated in any manner, including by chemical synthesis.
[0033] A polypeptide as disclosed herein can be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids. Polypeptides can have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations and are referred to as unfolded. As used herein, the term glycoprotein refers to a protein coupled to at least one carbohydrate moiety that is attached to the protein via an oxygen-containing or a nitrogen-containing side chain of an amino acid, e.g., a serine or an asparagine.
[0034] By an isolated polypeptide or a fragment, variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required. For example, an isolated polypeptide can be removed from its native or natural environment. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated as disclosed herein, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
[0035] As used herein, the term a non-naturally occurring polypeptide or any grammatical variants thereof, is a conditional definition that explicitly excludes, but only excludes, those forms of the polypeptide that are, or might be, determined or interpreted by a judge or an administrative or judicial body, to be naturally-occurring.
[0036] Other polypeptides disclosed herein are fragments, derivatives, analogs, or variants of the foregoing polypeptides, and any combination thereof. The terms fragment, variant, derivative and analog as disclosed herein include any polypeptides which retain at least some of the properties of the corresponding native antibody or polypeptide, for example, specifically binding to an antigen. Fragments of polypeptides include, for example, proteolytic fragments, as well as deletion fragments, in addition to specific antibody fragments discussed elsewhere herein. Variants of, e.g., a polypeptide include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. In certain aspects, variants can be non-naturally occurring. Non-naturally occurring variants can be produced using art-known mutagenesis techniques. Variant polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or additions. Derivatives are polypeptides that have been altered so as to exhibit additional features not found on the original polypeptide. Examples include fusion proteins. Variant polypeptides can also be referred to herein as polypeptide analogs. As used herein a derivative of a polypeptide can also refer to a subject polypeptide having one or more amino acids chemically derivatized by reaction of a functional side group. Also included as derivatives are those peptides that contain one or more derivatives of the twenty standard amino acids. For example, 4-hydroxyproline can be substituted for proline; 5-hydroxylysine can be substituted for lysine; 3-methylhistidine can be substituted for histidine; homoserine can be substituted for serine; and ornithine can be substituted for lysine.
[0037] A conservative amino acid substitution is one in which one amino acid is replaced with another amino acid having a similar side chain. Families of amino acids having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). For example, substitution of a phenylalanine for a tyrosine is a conservative substitution. In certain embodiments, conservative substitutions in the sequences of the polypeptides and antibodies of the present disclosure do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence, to the antigen to which the binding molecule binds. Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen-binding are well-known in the art (see, e.g., Brummell et al., Biochem. 32: 1180-1 187 (1993); Kobayashi et al., Protein Eng. 12(10):879-884 (1999); and Burks et al., Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
[0038] The term polynucleotide is intended to encompass a singular nucleic acid as well as plural nucleic acids and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA), cDNA, or plasmid DNA (pDNA). A polynucleotide can comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)). The terms nucleic acid or nucleic acid sequence refer to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide.
[0039] By an isolated nucleic acid or polynucleotide is intended any form of the nucleic acid or polynucleotide that is separated from its native environment. For example, gel-purified polynucleotide, or a recombinant polynucleotide encoding a polypeptide contained in a vector would be considered to be isolated. Also, a polynucleotide segment, e.g., a PCR product, which has been engineered to have restriction sites for cloning is considered to be isolated. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in a non-native solution such as a buffer or saline. Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides, where the transcript is not one that would be found in nature. Isolated polynucleotides or nucleic acids further include such molecules produced synthetically. In addition, polynucleotide or a nucleic acid can be or can include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
[0040] As used herein, the term a non-naturally occurring polynucleotide or any grammatical variants thereof, is a conditional definition that explicitly excludes, but only excludes, those forms of the nucleic acid or polynucleotide that are, or might be, determined or interpreted by a judge, or an administrative or judicial body, to be naturally-occurring.
[0041] As used herein, a coding region is a portion of nucleic acid which consists of codons translated into amino acids. Although a stop codon (TAG, TGA, or TAA) is not translated into an amino acid, it can be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region. Two or more coding regions can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors. Furthermore, any vector can contain a single coding region, or can comprise two or more coding regions, e.g., a single vector can separately encode an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region. In addition, a vector, polynucleotide, or nucleic acid can include heterologous coding regions, either fused or unfused to another coding region. Heterologous coding regions include without limitation, those encoding specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
[0042] In certain embodiments, the polynucleotide or nucleic acid is DNA. In the case of DNA, a polynucleotide comprising a nucleic acid which encodes a polypeptide normally can include a promoter and/or other transcription or translation control elements operably associated with one or more coding regions. An operable association is when a coding region for a gene product, e.g., a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s). Two DNA fragments (such as a polypeptide coding region and a promoter associated therewith) are operably associated if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed. Thus, a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid. The promoter can be a cell-specific promoter that directs substantial transcription of the DNA in predetermined cells. Other transcription control elements, besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription.
[0043] A variety of transcription control regions are known to those skilled in the art. These include, without limitation, transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (the immediate early promoter, in conjunction with intron-A), simian virus 40 (the early promoter), and retroviruses (such as Rous sarcoma virus). Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit -globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as lymphokine-inducible promoters (e.g., promoters inducible by interferons or interleukins).
[0044] Similarly, a variety of translation control elements are known to those of ordinary skill in the art. These include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from picornaviruses (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
[0045] In other embodiments, a polynucleotide can be RNA, for example, in the form of messenger RNA (mRNA), transfer RNA, or ribosomal RNA.
[0046] Polynucleotide and nucleic acid coding regions can be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide as disclosed herein. According to the signal hypothesis, proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated. Those of ordinary skill in the art are aware that polypeptides secreted by vertebrate cells can have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the complete or full length polypeptide to produce a secreted or mature form of the polypeptide. In certain embodiments, the native signal peptide, e.g., an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it. Alternatively, a heterologous mammalian signal peptide, or a functional derivative thereof, can be used. For example, the wild-type leader sequence can be substituted with the leader sequence of human tissue plasminogen activator (TPA) or mouse -glucuronidase.
[0047] As used herein, the terms DR5 or TRAILR2 refer to a member of the family of Tumor Necrosis Factor transmembrane receptor proteins expressed on the surface of various cells and tissues, which, upon activation, can induce apoptosis of the cell.
[0048] Disclosed herein are certain binding molecules, or antigen-binding fragments, variants, or derivatives thereof that bind to DR5, thereby eliciting cellular apoptosis. Unless specifically referring to full-sized antibodies, the term binding molecule encompasses full-sized antibodies as well as antigen-binding subunits, fragments, variants, analogs, or derivatives of such antibodies, e.g., engineered antibody molecules or fragments that bind antigen in a manner similar to antibody molecules, but which use a different scaffold. Where a binding molecule is a polymeric binding molecule, e.g., a pentameric or hexameric IgM antibody or a dimeric IgA antibody, it is understood when referring to multimeric fragments, variants, or derivatives, that the fragment, variant, or derivative continues to be multimeric.
[0049] As used herein, the term binding molecule refers in its broadest sense to a molecule that specifically binds to a receptor, e.g., an epitope or an antigenic determinant. As described further herein, a binding molecule can comprise one of more antigen binding domains described herein. A non-limiting example of a binding molecule is an antibody or fragment thereof that retains antigen-specific binding.
[0050] As used herein, the terms binding domain or antigen binding domain refer to a region of a binding molecule that is necessary and sufficient to specifically bind to an epitope. For example, an Fv, e.g., a variable heavy chain and variable light chain of an antibody, either as two separate polypeptide subunits or as a single chain, is considered to be a binding domain. Other binding domains include, without limitation, the variable heavy chain (VHH) of an antibody derived from a camelid species, or six immunoglobulin complementarity determining regions (CDRs) expressed in a fibronectin scaffold. A binding molecule as described herein can include one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve or more antigen binding domains.
[0051] The terms antibody and immunoglobulin can be used interchangeably herein. An antibody (or an antigen-binding fragment, variant, or derivative thereof, or a multimeric fragment, variant, or derivative thereof, as disclosed herein) includes at least the variable domain of a heavy chain (for camelid species) or at least the variable domains of a heavy chain and a light chain, and for a multimeric molecule, at least the C4-tp or C3-tp constant region domains to allow multimerization. Basic immunoglobulin structures in vertebrate systems are relatively well understood. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988). Unless otherwise stated, the term antibody encompasses anything ranging from a small antigen-binding fragment of an antibody to a full sized antibody, e.g., an IgG antibody that includes two complete heavy chains and two complete light chains, a dimeric IgA antibody that includes four complete heavy chains and four complete light chains and includes a J chain and/or a secretory component, or a pentameric or hexameric IgM antibody that includes ten or twelve complete heavy chains and ten or twelve complete light chains and optionally includes a J chain.
[0052] As will be discussed in more detail below, the term immunoglobulin comprises various broad classes of polypeptides that can be distinguished biochemically. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon, (, , , , ) with some subclasses among them (e.g., 1-4 or 1-2)). It is the nature of this chain that determines the isotype of the antibody as IgG, IgM, IgA IgG, or IgE, respectively. The immunoglobulin subclasses (subtypes) e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, IgA.sub.2, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these immunoglobulins are readily discernible to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of this disclosure.
[0053] Light chains are classified as either kappa or lambda (, ). Each heavy chain class can be bound with either a kappa or lambda light chain. In general, the light and heavy chains are covalently bonded to each other, and the tail portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are expressed, e.g., by hybridomas, B cells or genetically engineered host cells. In the heavy chain, the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain. The basic structure of certain antibodies, e.g., IgG antibodies, includes two heavy chain subunits and two light chain subunits covalently connected via disulfide bonds to form a Y structure, also referred to herein as an H2L2 structure, or a binding unit.
[0054] The term binding unit is used herein to refer to the portion of a binding molecule, e.g., an antibody or antigen-binding fragment thereof, which corresponds to a standard H2L2 immunoglobulin structure, i.e., two heavy chains or fragments thereof and two light chains or fragments thereof. In certain aspects, e.g., where the binding molecule is a bivalent IgG antibody or antigen-binding fragment thereof, the terms binding molecule and binding unit are equivalent. In other aspects, e.g., where the binding molecule is an IgA dimer, an IgM pentamer, or an IgM hexamer, the binding molecule comprises two, five, or six binding units, respectively. A binding unit need not include full-length antibody heavy and light chains, but will typically be bivalent, i.e., will include two binding domains, as defined herein. Certain binding molecules provided in this disclosure are dimeric and include two bivalent binding units that include IgA constant regions or fragments thereof. Certain binding molecules provided in this disclosure are pentameric or hexameric and include five or six bivalent binding units that include IgM constant regions or the necessary fragments thereof to allow multimerization. A binding molecule comprising two or more, e.g., two, five, or six binding units, is referred to herein as multimeric.
[0055] The terms valency, bivalent, multivalent and grammatical equivalents, refer to the number of binding domains in given binding molecule or binding unit. As such, the terms bivalent, tetravalent, and hexavalent in reference to a given binding molecule, e.g., an IgM antibody or fragment thereof, denote the presence of two binding domains, four binding domains, and six binding domains, respectively. In a typical IgM-derived binding molecule where each binding unit is bivalent, the binding molecule itself can have 10 or 12 valencies. A bivalent or multivalent binding molecule can be monospecific, i.e., all of the binding domains are the same, or can be bispecific or multispecific, e.g., where two or more binding domains are different, e.g., bind to different epitopes on the same antigen, or bind to entirely different antigens.
[0056] The term epitope includes any molecular determinant capable of specific binding to an antibody. In certain aspects, an epitope can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain aspects, can have a three-dimensional structural characteristics, and or specific charge characteristics. An epitope is a region of a target that is bound by an antibody.
[0057] The term target is used in the broadest sense to include substances that can be bound by a binding molecule. A target can be, e.g., a polypeptide, a nucleic acid, a carbohydrate, a lipid, or other molecule. Moreover, a target can, for example, be a cell, an organ, or an organism that comprises an epitope bound that can be bound by a binding molecule.
[0058] Both the light and heavy chains are divided into regions of structural and functional homology. The terms constant and variable are used functionally. In this regard, it will be appreciated that the variable domains of both the variable light (VL) and variable heavy (VH) chain portions determine antigen recognition and specificity. Conversely, the constant domains of the light chain (CL) and the heavy chain (e.g., CH1, CH2, CH3, or CH4 (where present)) confer biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like. By convention the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino-terminus of the antibody. The N-terminal portion is a variable region and at the C-terminal portion is a constant region; the CH3 (or CH4-tp in the case of IgM) and CL domains actually comprise the carboxy-terminus of the heavy and light chain, respectively.
[0059] A full length IgM antibody heavy chain is a polypeptide that includes, in N-terminal to C-terminal direction, an antibody heavy chain variable domain (VH), an antibody constant heavy chain constant domain 1 (CM1 or C1), an antibody heavy chain constant domain 2 (CM2 or C2), an antibody heavy chain constant domain 3 (CM3 or C3), and an antibody heavy chain constant domain 4 (CM4 or C4) that can include a tailpiece.
[0060] A full length IgA antibody heavy chain is a polypeptide that includes, in N-terminal to C-terminal direction, an antibody heavy chain variable domain (VH), an antibody constant heavy chain constant domain 1 (CA1 or C1), an antibody heavy chain constant domain 2 (CA2 or C2), and an antibody heavy chain constant domain 3 (CA3 or C3) that can include a tailpiece.
[0061] As indicated above, variable regions allow a binding molecule to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain, or subset of the complementarity determining regions (CDRs), of a binding molecule, e.g., an antibody, combine to form the antigen binding domain. More specifically, an antigen binding domain can be defined by three CDRs on each of the VH and VL chains. Certain antibodies form larger structures. For example, IgA can form a molecule that includes two H2L2 binding units and a J chain covalently connected via disulfide bonds, which can be further associated with a secretory component, and IgM can form a pentameric or hexameric molecule that includes five or six H2L2 binding units and optionally a J chain covalently connected via disulfide bonds.
[0062] The six complementarity determining regions or CDRs present in an antibody antigen-binding domain are short, non-contiguous sequences of amino acids that are specifically positioned to form the binding domain as the antibody assumes its three-dimensional configuration in an aqueous environment. The remainder of the amino acids in the binding domain, referred to as framework regions, show less inter-molecular variability. The framework regions largely adopt a -sheet conformation and the CDRs form loops which connect, and in some cases form part of, the -sheet structure. Thus, framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions. The binding domain formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to its cognate epitope. The amino acids that make up the CDRs and the framework regions, respectively, can be readily identified for any given heavy or light chain variable region by one of ordinary skill in the art, since they have been defined in various different ways (see, Sequences of Proteins of Immunological Interest, Kabat, E., et al., U.S. Department of Health and Human Services, (1983); and Chothia and Lesk, J. Mol. Biol., 196:901-917 (1987), which are incorporated herein by reference in their entireties).
[0063] In the case where there are two or more definitions of a term which is used and/or accepted within the art, the definition of the term as used herein is intended to include all such meanings unless explicitly stated to the contrary. A specific example is the use of the term complementarity determining region (CDR) to describe the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described, for example, by Kabat et al., U.S. Dept. of Health and Human Services, Sequences of Proteins of Immunological Interest (1983) and by Chothia et al., J. Mol. Biol. 196:901-917 (1987), which are incorporated herein by reference. The Kabat and Chothia definitions include overlapping or subsets of amino acids when compared against each other. Nevertheless, application of either definition (or other definitions known to those of ordinary skill in the art) to refer to a CDR of an antibody or variant thereof is intended to be within the scope of the term as defined and used herein, unless otherwise indicated. The appropriate amino acids which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison. The exact amino acid numbers which encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which amino acids comprise a particular CDR given the variable region amino acid sequence of the antibody.
TABLE-US-00001 TABLE 1 CDR Definitions* Kabat Chothia VH CDR1 31-35 26-32 VH CDR2 50-65 52-58 VH CDR3 95-102 95-102 VL CDR1 24-34 26-32 VL CDR2 50-56 50-52 VL CDR3 89-97 91-96 *Numbering of all CDR definitions in Table 1 is according to the numbering conventions set forth by Kabat et al. (see below).
[0064] Antibody variable domains can also be analyzed, e.g., using the IMGT information system (www://imgt.cines.fr/) (IMGT/V-Quest) to identify variable region segments, including CDRs. (See, e.g., Brochet et al., Nucl. Acids Res., 36:W503-508, 2008).
[0065] Kabat et al. also defined a numbering system for variable domain sequences that is applicable to any antibody. One of ordinary skill in the art can unambiguously assign this system of Kabat numbering to any variable domain sequence, without reliance on any experimental data beyond the sequence itself. As used herein, Kabat numbering refers to the numbering system set forth by Kabat et al., U.S. Dept. of Health and Human Services, Sequence of Proteins of Immunological Interest (1983). Unless use of the Kabat numbering system is explicitly noted, however, consecutive numbering is used for all amino acid sequences in this disclosure.
[0066] Binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, or multimeric fragments, variants, or derivatives thereof include, but are not limited to, polyclonal, monoclonal, human, humanized, or chimeric antibodies, single chain antibodies, epitope-binding fragments, e.g., Fab, Fab and F(ab).sub.2, Fd, Fvs, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv), fragments comprising either a VL or VH domain, fragments produced by a Fab expression library. ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019.
[0067] By specifically binds, it is generally meant that a binding molecule, e.g., an antibody or fragment, variant, or derivative thereof binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, a binding molecule is said to specifically bind to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope. The term specificity is used herein to qualify the relative affinity by which a certain binding molecule binds to a certain epitope. For example, binding molecule A can be deemed to have a higher specificity for a given epitope than binding molecule B, or binding molecule A can be said to bind to epitope C with a higher specificity than it has for related epitope D.
[0068] A binding molecule, e.g., an antibody or fragment, variant, or derivative thereof disclosed herein can be said to bind a target antigen with an off rate (k(off)) of less than or equal to 510.sup.2 sec.sup.1, 10.sup.2 sec.sup.1, 510.sup.3 sec.sup.1, 10.sup.3 sec.sup.1, 510.sup.4 sec.sup.1, 10.sup.4 sec.sup.1, 510.sup.5 sec.sup.1, or 10.sup.5 sec.sup.1 510.sup.6 sec.sup.1, 10.sup.6 sec.sup.1, 510.sup.7 sec.sup.1 or 10.sup.7 sec.sup.1.
[0069] A binding molecule, e.g., an antibody or antigen-binding fragment, variant, or derivative disclosed herein can be said to bind a target antigen with an on rate (k(on)) of greater than or equal to 10.sup.3 M.sup.1 sec.sup.1, 510.sup.3M.sup.1 sec.sup.1, 10.sup.4 M.sup.1 sec.sup.1, 510.sup.4 M.sup.1 sec.sup.1, 10.sup.5 M.sup.1 sec.sup.1, 510.sup.5 M.sup.1 sec.sup.1, 10.sup.6 M.sup.1 sec.sup.1, or 510.sup.6 M.sup.1 sec.sup.1 or 10.sup.7 M.sup.1 sec.sup.1.
[0070] A binding molecule, e.g., an antibody or fragment, variant, or derivative thereof is said to competitively inhibit binding of a reference antibody or antigen binding fragment to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody or antigen binding fragment to the epitope. Competitive inhibition can be determined by any method known in the art, for example, competition ELISA assays. A binding molecule can be said to competitively inhibit binding of the reference antibody or antigen binding fragment to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
[0071] As used herein, the term affinity refers to a measure of the strength of the binding of an individual epitope with one or more binding domains, e.g., of an immunoglobulin molecule. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) at pages 27-28. As used herein, the term avidity refers to the overall stability of the complex between a population of binding domains and an antigen. See, e.g., Harlow at pages 29-34. Avidity is related to both the affinity of individual binding domains in the population with specific epitopes, and also the valencies of the immunoglobulins and the antigen. For example, the interaction between a bivalent monoclonal antibody and an antigen with a highly repeating epitope structure, such as a polymer, would be one of high avidity. An interaction between a between a bivalent monoclonal antibody with a receptor present at a high density on a cell surface would also be of high avidity.
[0072] Binding molecules or antigen-binding fragments, variants or derivatives thereof as disclosed herein can also be described or specified in terms of their cross-reactivity. As used herein, the term cross-reactivity refers to the ability of a binding molecule, e.g., an antibody or fragment, variant, or derivative thereof, specific for one antigen, to react with a second antigen; a measure of relatedness between two different antigenic substances. Thus, a binding molecule is cross reactive if it binds to an epitope other than the one that induced its formation. The cross-reactive epitope generally contains many of the same complementary structural features as the inducing epitope, and in some cases, can actually fit better than the original.
[0073] A binding molecule, e.g., an antibody or fragment, variant, or derivative thereof can also be described or specified in terms of their binding affinity to an antigen. For example, a binding molecule can bind to an antigen with a dissociation constant or K.sub.D no greater than 510.sup.2M, 10.sup.2M, 510.sup.3M, 10.sup.3M, 510.sup.4M, 10.sup.4M, 510.sup.5M, 10.sup.5M, 510.sup.6 M, 10.sup.6M, 510.sup.7M, 10.sup.7M, 510.sup.8M, 10.sup.8M, 510.sup.9 M, 10.sup.9 M, 510.sup.1 M, 10.sup.1 M, 510.sup.11M, 10.sup.11M, 510.sup.12M, 10.sup.12M, 510.sup.13M, 10.sup.13M, 510.sup.14M, 10.sup.14M, 510.sup.15 M, or 10.sup.15M.
[0074] Antibody fragments including single-chain antibodies or other binding domains can exist alone or in combination with one or more of the following: hinge region, CH1, CH2, CH3, or CH4-tp domains, J chain, or secretory component. Also included are antigen-binding fragments that can include any combination of variable region(s) with one or more of a hinge region, CH1, CH2, CH3, or CH4 domains, a J chain, or a secretory component, e.g., to allow multimerization. Binding molecules, e.g., antibodies, or antigen-binding fragments thereof can be from any animal origin including birds and mammals. The antibodies can be human, murine, donkey, rabbit, goat, guinea pig, camel, llama, horse, or chicken antibodies. In another embodiment, the variable region can be condricthoid in origin (e.g., from sharks). As used herein, human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins and can in some instances express endogenous immunoglobulins and some not, as described infra and, for example in, U.S. Pat. No. 5,939,598 by Kucherlapati et al.
[0075] As used herein the term subunit refers to a single polypeptide chain that combines with other identical or heterologous polypeptide chains to produce a binding molecule, e.g., an antibody or antigen-binding fragment thereof.
[0076] As used herein, the term heavy chain subunit includes amino acid sequences derived from an immunoglobulin heavy chain, a binding molecule, e.g., an antibody comprising a heavy chain subunit can include at least one of: a VH domain, a CH1 domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4-tp domain, or a variant or fragment thereof. For example, a binding molecule, e.g., an antibody or fragment, variant, or derivative thereof can include without limitation, in addition to a VH domain: a CH1 domain; a CH1 domain, a hinge, and a CH2 domain; a CH1 domain and a CH3 domain; a CH1 domain, a hinge, and a CH3 domain; or a CH1 domain, a hinge domain, a CH2 domain, and a CH3 domain. In certain aspects a binding molecule, e.g., an antibody or fragment, variant, or derivative thereof can include, in addition to a VH domain, a CH3 domain and a CH4-tp domain; or a CH3 domain, a CH4-tp domain, and a J chain. The constant region portions can in some instances be from the same isotype, e.g., all C constant domains, or they can be a mixture, e.g., some of the constant domains can be C constant domains (e.g., the C.4-tp domain) while other constant domains can be from another antibody isotype (e.g., a Cy2 and Cy3 constant domain). Further, a binding molecule for use in the disclosure can lack certain constant region portions, e.g., all or part of a CH2 domain. It will be understood by one of ordinary skill in the art that these domains (e.g., the heavy chain subunit) can be modified such that they vary in amino acid sequence from the original immunoglobulin molecule.
[0077] As used herein, the term light chain subunit includes amino acid sequences derived from an immunoglobulin light chain. The light chain subunit includes at least a VL, and can further include a CL (e.g., C or C) domain.
[0078] Binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof can be described or specified in terms of the epitope(s) or portion(s) of an antigen that they recognize or specifically bind. The portion of a target antigen that specifically interacts with the antigen binding domain of an antibody is an epitope, or an antigenic determinant. A target antigen can comprise a single epitope or at least two epitopes, and can include any number of epitopes, depending on the size, conformation, and type of antigen.
[0079] As previously indicated, the structures and three-dimensional configuration of the constant regions of the various immunoglobulin classes are well known. As used herein, the term VH domain includes the amino terminal variable domain of an immunoglobulin heavy chain and the term CH1 domain includes the first (most amino terminal) constant region domain of an immunoglobulin heavy chain. The CH1 domain is adjacent to the VH domain and is amino terminal to the hinge region of a typical IgG heavy chain molecule.
[0080] As used herein the term CH2 domain includes the portion of a heavy chain molecule that extends, e.g., from about amino acid 244 to amino acid 360 of an IgG antibody using conventional numbering schemes (amino acids 244 to 360, Kabat numbering system; and amino acids 231-340, EU numbering system; see Kabat E A et al., op. cit. The CH3 domain extends from the CH2 domain to the C-terminal of the IgG molecule and comprises approximately 108 amino acids. Certain immunoglobulin classes, e.g., IgM, further include a CH4-tp region.
[0081] As used herein, the term hinge region includes the portion of a heavy chain molecule that joins the CH1 domain to the CH2 domain in IgG, IgA, and IgD heavy chains. This hinge region comprises approximately 25 amino acids and is flexible, thus allowing the two N-terminal antigen binding regions to move independently.
[0082] As used herein the term disulfide bond includes the covalent bond formed between two sulfur atoms. The amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a second thiol group.
[0083] As used herein, the term chimeric antibody refers to an antibody in which the immunoreactive region or site is obtained or derived from a first species and the constant region (which can be intact, partial or modified) is obtained from a second species. In some embodiments the target binding region or site will be from a non-human source (e.g. mouse or primate) and the constant region is human.
[0084] The terms multispecific antibody or bispecific antibody refer to an antibody that has binding domains for two or more different epitopes within a single antibody molecule. Other binding molecules in addition to the canonical antibody structure can be constructed with two binding specificities. Epitope binding by bispecific or multispecific antibodies can be simultaneous or sequential. Triomas and hybrid hybridomas are two examples of cell lines that can secrete bispecific antibodies. Bispecific antibodies can also be constructed by recombinant means. (Strohlein and Heiss, Future Oncol. 6:1387-94 (2010); Mabry and Snavely, I Drugs. 13:543-9 (2010)). A bispecific antibody can also be a diabody.
[0085] As used herein, the term engineered antibody refers to an antibody in which the variable domain in either the heavy and light chain or both is altered by at least partial replacement of one or more amino acids in either the CDR or framework regions. In certain aspects entire CDRs from an antibody of known specificity can be grafted into the framework regions of a heterologous antibody. Although alternate CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, CDRs can also be derived from an antibody of different class, e.g., from an antibody from a different species. An engineered antibody in which one or more donor CDRs from a non-human antibody of known specificity are grafted into a human heavy or light chain framework region is referred to herein as a humanized antibody. In certain aspects not all of the CDRs are replaced with the complete CDRs from the donor variable region and yet the antigen binding capacity of the donor can still be transferred to the recipient variable domains. Given the explanations set forth in, e.g., U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional engineered or humanized antibody.
[0086] As used herein the term engineered includes manipulation of nucleic acid or polypeptide molecules by synthetic means (e.g. by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques).
[0087] As used herein, the terms linked, fused or fusion or other grammatical equivalents can be used interchangeably. These terms refer to the joining together of two more elements or components, by whatever means including chemical conjugation or recombinant means. An in-frame fusion refers to the joining of two or more polynucleotide open reading frames (ORFs) to form a continuous longer ORF, in a manner that maintains the translational reading frame of the original ORFs. Thus, a recombinant fusion protein is a single protein containing two or more segments that correspond to polypeptides encoded by the original ORFs (which segments are not normally so joined in nature.) Although the reading frame is thus made continuous throughout the fused segments, the segments can be physically or spatially separated by, for example, in-frame linker sequence. For example, polynucleotides encoding the CDRs of an immunoglobulin variable region can be fused, in-frame, but be separated by a polynucleotide encoding at least one immunoglobulin framework region or additional CDR regions, as long as the fused CDRs are co-translated as part of a continuous polypeptide.
[0088] As used herein, the term cross-linked refers to joining together of two or more molecules by a third molecule. For example, a bivalent antibody with two binding domains that specifically bind to the same antigen can cross-link two copies of that antigen, e.g., as they are expressed on a cell. Many TNF superfamily receptor proteins, including DR5, require cross-linking of three or more receptors on the surface of a cell for activation. Cross-linking of DR5 proteins means, for instance, contacting a binding molecule, as disclosed herein, with DR5 expressed on the surface of a cell such that at least three DR5 monomers are simultaneously bound together by one or more binding molecules, thereby activating the receptors.
[0089] In the context of polypeptides, a linear sequence or a sequence is an order of amino acids in a polypeptide in an amino to carboxyl terminal direction in which amino acids that neighbor each other in the sequence are contiguous in the primary structure of the polypeptide. A portion of a polypeptide that is amino-terminal or N-terminal to another portion of a polypeptide is that portion that comes earlier in the sequential polypeptide chain. Similarly, a portion of a polypeptide that is carboxy-terminal or C-terminal to another portion of a polypeptide is that portion that comes later in the sequential polypeptide chain. For example, in a typical antibody, the variable domain is N-terminal to the constant region, and the constant region is C-terminal to the variable domain.
[0090] The term expression as used herein refers to a process by which a gene produces a biochemical, for example, a polypeptide. The process includes any manifestation of the functional presence of the gene within the cell including, without limitation, gene knockdown as well as both transient expression and stable expression. It includes without limitation transcription of the gene into RNA, e.g., messenger RNA (mRNA), and the translation of such mRNA into polypeptide(s). If the final desired product is a biochemical, expression includes the creation of that biochemical and any precursors. Expression of a gene produces a gene product. As used herein, a gene product can be either a nucleic acid, e.g., a messenger RNA produced by transcription of a gene, or a polypeptide that is translated from a transcript. Gene products described herein further include nucleic acids with post transcriptional modifications, e.g., polyadenylation, or polypeptides with post translational modifications, e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, proteolytic cleavage, and the like.
[0091] As used herein, the terms cancer and cancerous refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. Cancers can be categorized, e.g., as solid tumors or malignancies, or hematological cancers or malignancies. Both types can migrate to remote sites as metastases. A solid tumor can be categorized, e.g., as a sarcoma, a carcinoma, a melanoma, or a metastasis thereof.
[0092] The terms proliferative disorder and proliferative disease refer to disorders associated with abnormal cell proliferation such as cancer. Tumor and neoplasm as used herein refer to any mass of tissue that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions.
[0093] The terms metastasis, metastases, metastatic, and other grammatical equivalents as used herein refer to cancer cells which spread or transfer from the site of origin (e.g., a primary tumor) to other regions of the body with the development of a similar cancerous lesion at the new location. A metastatic or metastasizing cell is one that loses adhesive contacts with neighboring cells and migrates via the bloodstream or lymph from the primary site of disease to invade neighboring body structures. The terms also refer to the process of metastasis, which includes, but is not limited to detachment of cancer cells from a primary tumor, intravasation of the tumor cells to circulation, their survival and migration to a distant site, attachment and extravasation into a new site from the circulation, and microcolonization at the distant site, and tumor growth and development at the distant site.
[0094] Examples of such solid tumors can include, e.g., squamous cell carcinoma, adenocarcinoma, basal cell carcinoma, renal cell carcinoma, ductal carcinoma of the breast, soft tissue sarcoma, osteosarcoma, melanoma, small-cell lung cancer, non-small cell lung cancer (NSCLC), adenocarcinoma of the lung, cancer of the peritoneum, hepatocellular carcinoma, gastrointestinal cancer, gastric cancer, pancreatic cancer, neuroendocrine cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, brain cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, esophageal cancer, salivary gland carcinoma, kidney cancer, prostate cancer, vulval cancer, thyroid cancer, head and neck cancer, any metastases thereof, or any combination thereof.
[0095] Examples of hematologic cancers or malignancies include without limitation leukemia, lymphoma, myeloma, acute myeloid leukemia, chronic myeloid leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, hairy cell leukemia, Hodgkin lymphoma, non-Hodgkin lymphoma, multiple myeloma, any metastases thereof, or any combination thereof.
[0096] In certain embodiments, cancers that are amenable to treatment via the methods provided herein include, but are not limited to sarcomas, breast carcinomas, ovarian cancer, cervical cancer, head and neck cancer, NSCLC, esophageal cancer, gastric cancer, kidney cancer, liver cancer, bladder cancer, colorectal cancer, and pancreatic cancer.
[0097] The term therapeutically effective amount refers to an amount of an antibody, polypeptide, polynucleotide, small organic molecule, or other drug effective to treat or in some instances, prevent a disease or disorder in a subject, e.g., a human. In the case of cancer, the therapeutically effective amount of the drug can reduce the number of cancer cells; retard or stop cancer cell division, reduce or retard an increase in tumor size; inhibit, e.g., suppress, retard, prevent, stop, delay, or reverse cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit, e.g., suppress, retard, prevent, shrink, stop, delay, or reverse tumor metastasis; inhibit, e.g., suppress, retard, prevent, stop, delay, or reverse tumor growth; relieve to some extent one or more of the symptoms associated with the cancer, reduce morbidity and mortality; improve quality of life; or a combination of such effects. To the extent the drug prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic.
[0098] Terms such as treating or treatment or to treat or alleviating or to alleviate refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, reverse, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus, those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented. A subject is successfully treated according to the methods of the present disclosure if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; or retardation or reversal of tumor growth, inhibition, e.g., suppression, prevention, retardation, shrinkage, delay, or reversal of metastases, e.g., of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of, e.g., suppression of, retardation of, prevention of, shrinkage of, reversal of, delay of, or an absence of tumor metastases; inhibition of, e.g., suppression of, retardation of, prevention of, shrinkage of, reversal of, delay of, or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; or some combination of effects. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
[0099] By subject or individual or animal or patient or mammal, is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, swine, cows, bears, and so on.
[0100] As used herein, phrases such as a subject that would benefit from therapy and an animal in need of treatment includes subjects, such as mammalian subjects, that would benefit from administration of a binding molecule such as an antibody, comprising one or more antigen binding domains. Such binding molecules, e.g., antibodies, can be used, e.g., for a diagnostic procedures and/or for treatment or prevention of a disease.
[0101] IgM Binding Molecules
[0102] IgM is the first immunoglobulin produced by B cells in response to stimulation by antigen and is present at around 1.5 mg/ml in serum with a half-life of 5 days. IgM is a pentameric or hexameric molecule. An IgM binding unit includes two light and two heavy chains. While IgG contains three heavy chain constant domains (CH1, CH2 and CH3), the heavy () chain of IgM additionally contains a fourth constant domain (CH4), that includes a C-terminal tailpiece (tp). The human IgM constant region typically comprises the amino acid sequence SEQ ID NO: 74. The human CO region ranges from about amino acid 5 to about amino acid 102 of SEQ ID NO: 74; the human C2 region ranges from about amino acid 114 to about amino acid 205 of SEQ ID NO: 74, the human C3 region ranges from about amino acid 224 to about amino acid 319 of SEQ ID NO: 74, the C4 region ranges from about amino acid 329 to about amino acid 430 of SEQ ID NO: 74, and the tailpiece ranges from about amino acid 431 to about amino acid 453 of SEQ ID NO: 74. SEQ ID NO: 74 is presented below:
TABLE-US-00002 GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITL SWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDV MQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVF VPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQV GSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQS MFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFA SIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHT NISESHPNATFSAVGEASICEDDWNSGERFTCTVTHTDLP SPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATITC LVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAP GRYFAHSILTVSEEEWNTGETYTCVAHEALPNRVTERTV DKSTGKPTLYNVSLVMSDTAGTCY
[0103] Five IgM binding units can form a complex with an additional small polypeptide chain (the J chain) to form an IgM antibody. The mature human J chain comprises the amino acid sequence SEQ ID NO: 76. Without the J chain, IgM binding units typically assemble into a hexamer. While not wishing to be bound by theory, the assembly of IgM binding units into a pentameric or hexameric binding molecule is thought to involve the C3 and C4 domains. Accordingly, a pentameric or hexameric binding molecule provided in this disclosure typically includes IgM constant regions that include at least the C3 and C.4 domains. SEQ ID NO: 76 is presented below:
TABLE-US-00003 QEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIV PLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDN QIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYG GETKMVETALTPDACYPD
[0104] An IgM heavy chain constant region can additionally include a C2 domain or a fragment thereof, a C1 domain or a fragment thereof, and/or other IgM heavy chain domains. In certain aspects, a binding molecule as provided herein can include a complete IgM heavy () chain constant domain, e.g., SEQ ID NO: 74, or a variant, derivative, or analog thereof.
[0105] Pentameric or Hexameric anti-DR5 Binding Molecules
[0106] This disclosure provides a pentameric or hexameric binding molecule, i.e., a binding molecule with five or six binding units as defined herein, that can specifically bind to DR5. A binding molecule as provided herein can possess improved binding characteristics or biological activity as compared to a binding molecule composed of a single binding unit, e.g., a bivalent IgG antibody. For example, a pentameric or hexameric binding molecule can more efficiently cross-link three or more DR5 molecules on the surface of a cell, e.g., a tumor cell, thereby facilitating apoptosis of the cell.
[0107] A binding molecule as provided herein can likewise possess distinctive characteristics compared to multivalent binding molecule composed of synthetic or chimeric structures. For example, use of human IgM constant regions can afford reduced immunogenicity and thus increased safety relative to a binding molecule containing chimeric constant regions or synthetic structures. Moreover, an IgM-based binding molecule can consistently form hexameric or pentameric oligomers resulting in a more homogeneous expression product. Superior complement fixation can also be an advantageous effector function of IgM-based binding molecules.
[0108] In certain aspects, the disclosure provides a pentameric or hexameric binding molecule comprising five or six bivalent binding units, respectively, where each binding unit includes two IgM heavy chain constant regions or fragments thereof. In certain aspects, the two IgM heavy chain constant regions are human heavy chain constant regions.
[0109] Where the binding molecule provided herein is pentameric, the binding molecule can further comprise a J chain, or fragment thereof, or variant thereof.
[0110] An IgM heavy chain constant region can include one or more of a C1 domain, a C2 domain, a C3 domain, and/or a C4 domain, provided that the constant region can serve a desired function in the binding molecule, e.g., associate with second IgM constant region to form a binding domain, or associate with other binding units to form a hexamer or a pentamer. In certain aspects the two IgM heavy chain constant regions or fragments thereof within an individual binding unit each comprise a C3 domain or fragment thereof, a C4 domain or fragment thereof, a tailpiece (TP) or fragment thereof, or any combination of a C3 domain a C domain, and a TP or fragment thereof. In certain aspects the two IgM heavy chain constant regions or fragments thereof within an individual binding unit each further comprise a C2 domain or fragment thereof, a CO domain or fragment thereof, or a C1 domain or fragment thereof and a C2 domain or fragment thereof.
[0111] In certain aspects each of the two IgM heavy chain constant regions in a given binding unit is associated with an antigen-binding domain, for example an Fv portion of an antibody, e.g., a VH and a VL of a human or murine antibody, where the VL can be associated with a light chain constant region. In a binding molecule as provided herein at least three antigen-binding domains of the binding molecule are DR5 binding domains, i.e., binding domains that can specifically bind to DR5, e.g., human DR5.
[0112] IgA Binding Molecules
[0113] IgA plays a critical role in mucosal immunity and comprises about 15% of total immunoglobulin produced. IgA is a monomeric or dimeric molecule. An IgA binding unit includes two light and two heavy chains. IgA contains three heavy chain constant domains (C1, C2 and C3), and includes a C-terminal tailpiece. Human IgA has two subtypes, IgA1 and IgA2. The human IgA1 constant region typically comprises the amino acid sequence SEQ ID NO: 78. The human C1 region ranges from about amino acid 6 to about amino acid 98 of SEQ ID NO: 78; the human C2 region ranges from about amino acid 125 to about amino acid 220 of SEQ ID NO: 78, the human C3 region ranges from about amino acid 228 to about amino acid 330 of SEQ ID NO: 78, and the tailpiece ranges from about amino acid 331 to about amino acid 352 of SEQ ID NO: 78. The human IgA2 constant region typically comprises the amino acid sequence SEQ ID NO: 79. The human Cal region ranges from about amino acid 6 to about amino acid 98 of SEQ ID NO: 79; the human C2 region ranges from about amino acid 112 to about amino acid 207 of SEQ ID NO: 79, the human C3 region ranges from about amino acid 215 to about amino acid 317 of SEQ ID NO: 79, and the tailpiece ranges from about amino acid 318 to about amino acid 340 of SEQ ID NO: 79. SEQ ID NOS: 78 and 79 are presented below:
TABLE-US-00004 SEQIDNO:78 ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVT WSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLA GKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPS PSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGV TFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPW NHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPP SEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREK YLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSC MVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDG TCY SEQIDNO:79 ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSV TWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCP DGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLH RPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKS AVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAA HPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVT LTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEP SQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLA FTQKTIDRMAGKPTHVNVSVVMAEVDGTCY
[0114] Two IgA binding units can form a complex with two additional polypeptide chains, the J chain (SEQ ID NO: 76) and the secretory component (precursor, SEQ ID NO: 80, mature, SEQ ID NO: 81) to form a secretory IgA (sIgA) antibody. While not wishing to be bound by theory, the assembly of IgA binding units into a dimeric sIgA binding molecule is thought to involve the C3 and tailpiece domains. Accordingly, a dimeric sIgA binding molecule provided in this disclosure typically includes IgA constant regions that include at least the C3 and tailpiece domains. SEQ ID NO: 80 and SEQ ID NO: 81 are presented below:
TABLE-US-00005 SEQIDNO:80: MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCY YPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAG RANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGL SFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTEN AQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQG TGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADL QVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQ SSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVI TGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEES TIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWE GAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTV ILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLK VPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTG CQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEG WYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLA KADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTR DQADGSRASVDSGSSEEQGGSSRALVSTLVPLGLVLAV GAVAVGVARARHRKNVDRVSIRSYRTDISMSDFENSRE FGANDNMGASSITQETSLGGKEEFVATTESTTETKEPKK AKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA SEQIDNO:81: KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCR QGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNI AQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLND TKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVL VIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDA GQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSV TFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAP AFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSD GQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAV LCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVK AQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNG DTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFP CKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDE NSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVY VAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENK AIQDPR
[0115] An IgA heavy chain constant region can additionally include a C2 domain or a fragment thereof, a C1 domain or a fragment thereof, and/or other IgA heavy chain domains. In certain aspects, a binding molecule as provided herein can include a complete IgA heavy () chain constant domain (e.g., SEQ ID NO: 78 or SEQ ID NO: 79), or a variant, derivative, or analog thereof.
[0116] Dimeric DR5 Binding Molecules
[0117] This disclosure provides a dimeric binding molecule, e.g., a binding molecule with two IgA binding units or fragments, variants, or derivatives thereof as defined herein, that can specifically bind to DR5. A binding molecule as provided herein can possess improved binding characteristics or biological activity as compared to a binding molecule composed of a single binding unit, e.g., a bivalent IgG antibody. For example, an IgA binding molecule can more efficiently cross-link three or more DR5 monomers on the surface of a cell, e.g., a tumor cell, thereby facilitating apoptosis of the cell. Moreover, an IgA binding molecule can reach mucosal sites providing greater tissue distribution for the binding molecules provided herein. Use of an IgA-based binding molecule can allow, for example, greater tissue distribution for a binding molecule provided herein. Mucosal distribution could be beneficial for certain cancers, e.g., lung cancer, gastric cancer, ovarian cancer, colorectal cancer, or squamous cell carcinoma. Likewise, a dimeric binding molecule as provided herein can possess binding characteristics or biological activity that can be distinguished from a binding molecule comprising five or six binding units, e.g., a hexameric or pentameric IgM antibody. For example, a dimeric binding molecule would be smaller, and could, for example, achieve better tissue penetration in solid tumors.
[0118] In certain aspects, the disclosure provides a dimeric binding molecule comprising two bivalent binding units, where each binding unit includes two IgA heavy chain constant regions or fragments thereof. In certain aspects, the two IgA heavy chain constant regions are human heavy chain constant regions.
[0119] A dimeric IgA binding molecule as provided herein can further comprise a J chain, or fragment thereof, or variant thereof. A dimeric IgA binding molecule as provided herein can further comprise a secretory component, or fragment thereof, or variant thereof.
[0120] An IgA heavy chain constant region can include one or more of a C1 domain, a C2 domain, and/or a C3 domain, provided that the constant region can serve a desired function in the binding molecule, e.g., associate with a light chain constant region to facilitate formation of an antigen binding domain, or associate with another IgA binding unit to form a dimeric binding molecule. In certain aspects the two IgA heavy chain constant regions or fragments thereof within an individual binding unit each comprise a C3 domain or fragment thereof, a tailpiece (TP) or fragment thereof, or any combination of a C3 domain, a TP, or fragment thereof. In certain aspects the two IgA heavy chain constant regions or fragments thereof within an individual binding unit each further comprise a C2 domain or fragment thereof, a Cal domain or fragment thereof, or a Cal domain or fragment thereof and a C2 domain or fragment thereof.
[0121] In certain aspects each of the two IgA heavy chain constant regions in a given binding unit is associated with an antigen binding domain, for example an Fv portion of an antibody, e.g., a VH and a VL of a human or murine antibody, where the VL can be associated with a light chain constant region. In a binding molecule as provided herein at least three antigen-binding domains of the binding molecule are DR5 binding domains, i.e., binding domains that can specifically bind to DR5, e.g., human DR5.
[0122] Modified J Chains
[0123] In certain aspects, the J chain of dimeric or pentameric binding molecules as provided herein can be modified, e.g., by introduction of a heterologous moiety, or two or more heterologous moieties, without interfering with the ability of the IgM or IgA binding molecule to assemble and bind to its binding target(s). See PCT Publication No. WO 2015/153912, PCT Publication No. WO 2017/059387, and PCT Publication No. WO 2017/059380, each of which is incorporated herein by reference in its entirety. Accordingly, dimeric or pentameric binding molecules as provided herein, including multispecific dimeric or pentameric binding molecules as described elsewhere herein, can comprise a modified J chain or functional fragment thereof comprising a heterologous moiety introduced into the J chain or fragment thereof. In certain aspects heterologous moiety can be a peptide or polypeptide sequence fused in frame to the J chain or chemically conjugated to the J chain. In certain aspects the heterologous moiety can be a chemical moiety conjugated to the J chain. Heterologous moieties to be attached to a J chain can include, without limitation, a binding moiety, e.g., an antibody or antigen binding fragment thereof, e.g., a single chain Fv (ScFv) molecule, a stabilizing peptide that can increase the half-life of the dimeric or pentameric binding molecule, or a chemical moiety such as a polymer or a cytotoxin.
[0124] In some embodiments, a modified J chain can comprise an antigen binding domain that can include without limitation a polypeptide (including small peptides) capable of specifically binding to a target antigen. In certain aspects, an antigen binding domain associated with a modified J chain can be an antibody or an antigen-binding fragment thereof, as described elsewhere herein. In certain aspects the antigen binding domain can be a scFv binding domain or a single-chain binding domain derived, e.g., from a camelid or condricthoid antibody. The antigen binding domain can be introduced into the J chain at any location that allows the binding of the antigen binding domain to its binding target without interfering with J chain function or the function of an associated IgM or IgA antibody. Insertion locations include, but are not limited to, at or near the C-terminus, at or near the N-terminus or at an internal location that, based on the three-dimensional structure of the J chain, is accessible. In certain aspects, the antigen binding domain can be introduced into the human J chain of SEQ ID NO: 76 between cysteine residues 92 and 101 of SEQ ID NO: 76. In a further aspect, the antigen binding domain can be introduced into the human J chain of SEQ ID NO: 76 at or near a glycosylation site. In a further aspect, the antigen binding domain can be introduced into the human J chain of SEQ ID NO: 76 within about 10 amino acid residues from the C-terminus.
[0125] DR5 Binding Domains
[0126] A DR5 binding molecule, e.g., an anti-DR5 antibody or fragment, variant, or derivative thereof as provided herein can be dimeric, pentameric, or hexameric, comprising two, five, or six bivalent binding units, respectively. The binding units can be full length or variants or fragments thereof that retain binding function.
[0127] Each binding unit comprises two IgA or IgM heavy chain constant regions or fragments thereof, each associated with an antigen-binding domain. As noted above, an antigen binding domain is a region of a binding molecule that is necessary and sufficient to specifically bind to an epitope. A binding molecule as described herein can include one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve or more antigen binding domains.
[0128] A dimeric, pentameric, or hexameric binding molecule as provided herein can include at least three antigen-binding domains which specifically and agonistically bind to DR5. As noted above DR5, upon activation, can induce apoptosis of the cell expressing the DR5 proteins which were bound. Apoptosis will occur, as presently understood, when multiple receptor proteins are bound together, causing cross-linking of the receptor molecules such that a signal is transmitted across the cell membrane into the cytosol of the cell expressing DR5.
[0129] A dimeric, pentameric, or hexameric binding molecule as provided herein can cross-link at least three DR5 monomers expressed on the surface of a cell. Due to the dimeric, pentameric, or hexameric nature of a DR5 binding molecule as provided herein, the molecule can cross-link as many as three, four, five, six, seven, eight, nine, ten, eleven, or twelve DR5 monomers on a cell. The receptor proteins are then spatially brought into proximity of each other, thereby contributing to their cross-linking and activation. When all five or all six of the bivalent binding units a DR5 binding molecule as provided herein bind to a receptor, binding up to ten or twelve DR5 monomers on a single cell, respectively, cross-linking and activation of the receptors can occur.
[0130] Because each of the binding units is bivalent, each binding molecule can bind to as many as 10 (for pentameric binding molecules) or 12 (for hexameric binding molecules) DR5 monomers.
[0131] Upon activation of the receptors by the binding of a dimeric, pentameric, or hexameric binding molecule as provided herein, the cell can either undergo apoptosis as described above.
[0132] In certain aspects, a dimeric, pentameric, or hexameric binding molecule as presently disclosed can induce DR5-mediated apoptosis in a DR5-expressing cell at a higher potency than an equivalent amount of a bivalent IgG antibody or fragment thereof, which also specifically binds to and agonizes DR5. Not wishing to be bound by theory, because a provided binding molecule is dimeric, pentameric, or hexameric, and because each binding unit is bivalent, such a binding molecule can induce receptor-mediated functions previously characterized for DR5 at a higher potency than any single binding unit alone, such as an equivalent IgG binding unit. IgG binding units are bivalent, containing two binding sites, but as previous clinical studies have shown, binding of two DR5 receptors with a single IgG molecule can be ineffective without addition of other components, such as cross-linkers, etc.
[0133] By potency or improved binding characteristics is meant the least amount of a given binding molecule necessary to achieve a given biological result, e.g., activation of 20%, 50%, or 90% of DR5 monomers in a given assay, e.g., an ELISA or Western blot-based caspase assays, annexin-v staining as seen by FACS analysis, or other assay. Or a reduced tumor growth rate or increased survival in an in vivo tumor assay.
[0134] Because a binding molecule as provided herein is dimeric, pentameric, or hexameric, it can contain as many as 4, 10, or 12, respectively, antigen-binding domains. Each of the antigen-binding domains can specifically bind to and agonize DR5. Further, each antigen-binding domain can be specific for one particular epitope of DR5.
[0135] Thus, a single dimeric, pentameric, or hexameric binding molecule can: a) simultaneously bind a single epitope on DR5, or b) bind many different epitopes on DR5.
[0136] The binding units of a dimeric, pentameric, or hexameric binding molecule as provided herein can be human, humanized, or chimeric immunoglobulin binding units. Methods of humanizing immunoglobulin sequences are well known in the art. Thus, the nucleotide sequences encoding a dimeric, pentameric, or hexameric binding molecule polypeptide can be directly from human sequences, or can be humanized or chimeric, i.e., encoded by sequences from multiple different species.
[0137] The cells which express DR5 can be any animal cell. For instance, in one embodiment, the cell is a human cell. For example, the cell can be any one or more of primate, rodent, canine, equine, etc., cells. Further, the cell expressing DR5 can be a cancer cell. That is, the cell can be a cell in a tumor which is malignant or benign.
[0138] A dimeric, pentameric, or hexameric binding molecule as provided herein can be genetically engineered such that its antigen-binding domains are encoded by sequences known to specifically bind DR5. Many groups have published sequences of variable regions of monoclonal antibodies, most of the IgG isotype that are characterized and are known to specifically bind to DR5. Non-limiting immunoglobulin variable domain sequences that are known to specifically bind to DR5 are provided in Tables 2 and 3. One of skill in the art is capable of engineering these published sequences into immunoglobulin structures, such as an IgG, IgA, IgM structure, or biologically active or functional multimeric fragments variants, or derivatives thereof. Methods for genetically engineering cloned variable regions into immunoglobulin domains, and expressing and purifying such constructs are published and within the capability of one skilled in the art.
[0139] Thus, in certain aspects, a DR5 binding domain as provided herein comprises six immunoglobulin complementarity determining regions HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3, or the six immunoglobulin complementarity determining regions with one, two, three, four, or five single amino acid substitutions in one or more CDR, of an anti-DR5 mAb comprising the VH and VL amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 5 and SEQ ID NO: 6; SEQ ID NO: 7 and SEQ ID NO: 8; SEQ ID NO: 9 and SEQ ID NO: 10; SEQ ID NO: 11 and SEQ ID NO: 12; SEQ ID NO: 13 and SEQ ID NO: 14; SEQ ID NO: 15 and SEQ ID NO: 16; SEQ ID NO: 17 and SEQ ID NO: 18; SEQ ID NO: 19 and SEQ ID NO: 20; SEQ ID NO: 21 and SEQ ID NO: 22; SEQ ID NO: 23 and SEQ ID NO: 24; SEQ ID NO: 25 and SEQ ID NO: 26; SEQ ID NO: 27 and SEQ ID NO: 28; SEQ ID NO: 29 and SEQ ID NO: 30; SEQ ID NO: 31 and SEQ ID NO: 32; SEQ ID NO: 33 and SEQ ID NO: 34; SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 37 and SEQ ID NO: 38; SEQ ID NO: 39 and SEQ ID NO: 40; SEQ ID NO: 41 and SEQ ID NO: 42; SEQ ID NO: 43 and SEQ ID NO: 44; SEQ ID NO: 45 and SEQ ID NO: 46; SEQ ID NO: 47 and SEQ ID NO: 48; SEQ ID NO: 49 and SEQ ID NO: 50; SEQ ID NO: 51 and SEQ ID NO: 52; SEQ ID NO: 53 and SEQ ID NO: 54; SEQ ID NO: 55 and SEQ ID NO: 56; SEQ ID NO: 82 and SEQ ID NO: 83; SEQ ID NO: 84 and SEQ ID NO: 85; SEQ ID NO: 86 and SEQ ID NO: 87; or SEQ ID NO: 88 and SEQ ID NO: 89; respectively, or the ScFv amino acid sequence SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, or SEQ ID NO: 73.
TABLE-US-00006 TABLE2 Anti-DR5AntibodyVH(orHeavyChain)andVL(orLightChain)Sequences SEQ SEQ ID VHorHeavyChain ID VLorLightChain Reference 1 EVQLVQSGGGVERPGGSLRLSCAASGFIFDDYGMS 2 SSELTQDPAVSVALGQTVRITCQGDSLRSYYAS U.S.Pat.App. WVRQAPGKGLEWVSGINWNGGSTGYADSVKGRV WYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSG Pub.No. TISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAG NTASLTITGAQAEDEADYYCNSRDSSGNHVVFG 20060269555A1 RGWYFDLWGKGTTVTVSS GGTKLTVL 3 EVQLVQSGGGVERPGGSLRLSCAASGFIFDDYAMS 4 SELTQDPAVSVALGQTVRITCSGDSLRSYYASW U.S.Pat.No. WVRQAPGKGLEWVSGINWQGGSTGYADSVKGRV YQQKPGQAPVLVIYGANNRPSGIPDRFSGSSSGN 8,029,783 TISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAG TASLTITGAQAEDEADYYCNSADSSGNHVVFGG RGWYFDYWGKGTTVTVSS GTKLTVL 5 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYFW 6 EIVLTQSPGTLSLSPGERATLSCRASQGISRSYLA U.S.Pat.No. SWIRQLPGKGLECIGHIHNSGTTYYNPSLKSRVTISV WYQQKPGQAPSLLIYGASSRATGIPDRFSGSGSG 7,521,048 DTSKKQFSLRLSSVTAADTAVYYCARDRGGDYYY TDFTLTISRLEPEDFAVYYCQQFGSSPWTFGQGT GMDVWGQGTTVTVSS KVEIK 7 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYVMS 8 DIQMTQSPSSLSASVGDRVTITCKASQDVGTAVA U.S.Pat.No. WVRQAPGKGLEWVATISSGGSYTYYPDSVKGRFTI WYQQKPGKAPKLLIYWASTRHTGVPSRFSGSGS 7,790,165 SRDNAKNTLYLQMNSLRAEDTAVYYCARRGDSMI GTDFTLTISSLQPEDFATYYCQQYSSYRTFGQGT TTDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGG KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV NFYPREAKVQWKVDNALQSGNSQESVTEQDSK LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS KVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP SPVTKSFNRGEC KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK 9 QIQLVQSGPELKKPGETVKISCKASGYTFT 10 DVVMTQTPLSLPVSLGDQASISCRSSQSLV U.S.Pat.No. DFSMNWVKQAPGKGLKWMGWINTETGEPTY HSNGNTYLHWYLQKPGQSPKLLIYKVSNRF 7,893,216 ADDFKGRFALSMETSASTAYLQINNLKNED SGVPDRFSGSGSGTDFTLKISRVEAEDLGV TATYFCVRIDYWGQGTTLTVSS YFCFQSTHVPHTFGGGTKLEIKR 11 MDWTWRILFLVAAATSAHSQVQLVQSGAEMKKPG 12 MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLS U.S.Pat.No. ASVKVSCKTSGYTFTNYKINWVRQAPGQGLEWMG PGERATLSCRASQSVSSYLAWYQQKPGQAPRLL 7,115,717 WMNPDTDSTGYPQKFQGRVTMTRNTSISTAYMELS IYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDF SLRSEDTAVYYCARSYGSGSYYRDYYYGMDVWG AVYYCQQRSNWPLTFGGGTKVEIKR QGTTVTVSS 13 MKHLWFFLLLVAAPRWVLSEVQLQQSGPEL 14 MVLQTQVFISLLLWISGAYGDVVMTQTPLS EPPat. VKPGASVKISCKASGYSFIGYFMNWMKQSH LPVSLGDQASISCRSSQSLVHSNGNTYLHW PublicationNo. GKSLEWIGRFNPYNGDTFYNQKFKGKATLT YLQKPGQSPKLLIYKVSNRFSGVPDRFSGS EP2636736A1 VDKSSTTAHMELLSLTSEDSAVYFCGRSAY GSGTDFTLKISRVEAEDLGIYFCSQSTHVP YFDSGGYFDYWGQGTTLTVSSASTKGPSVF WTFGGGTKLEIKRTVAAPSVFIFPPSDEQL PLAPSSKSTSGGTAALGCLVKDYFPEPVTV KSGTASVVCLLNNFYPREAKVQWKVDNALQ SWNSGALTSGVHTFPAVLQSSGLYSLSSVV SGNSQESVTEQDSKDSTYSLSSTLTLSKAD TVPSSSLGTQTYICNVNHKPSNTKVDKRVE YEKHKVYACEVTHQGLSSPVTKSFNRGEC PKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK 15 QVQLVQSGSELKKPGASVKVSCKASGYTFTDFSMN 16 DIVMTQSPLSLPVTPGEPASISCRSSQSLVHSNGN PCTPublication WVRQAPGQGLEWMGWINTETGEPTYADDFKGRFV TYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFS No.WO FSLDTSVSTAYLQISSLKAEDTAVYYCARIDYWGQ GSGSGTDFTLKISRVEAEDVGVYYCFQSTHVPHT 2014/063368Al GTTVTVSS FGQGTKLEIKR 17 MGXLGLSWVFLVVILEGVQCEVHLVESGGGLVRPG 18 MRLPAQLLGLLMLWVSGSSGDIQMTQSSSSFSV U.S.Pat.No. GSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVA SLGDRVTITCKASEDIYNRLAWYQQKPGNAPRL 7,897,730 YISDGGGITYYPDTMKGRFTISRDNAKNTLSLQMSS LISGATSLETGVPSRFSGSGSGKDYTLSITSLQTE LKSEDTAMYYCARHITMVVGPFAYWGQGTLVTVS DVATYYCQQMSTPLTFGAGTKLELKRAVAAP AASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPE SVDIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT PSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC C VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTMDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK 19 MELGLSWVFLVVILEGVQCEVQLQQSGPELVKPGA 20 MRLPAQLLGLLMLWVSGSSGDIVMTQSHKFMS U.S.Pat.No. SVRMSCKASGYTFTSYFIHWVKQRPGQGLEWIGWI TSVGDRVSITCKASQDVSTAVAWYQQKPGQSPR 7,897,730 YPGNVNTKYSEKFKGKATLTADKSSSTAYMQFSSL LLIYWASTRHTGVPDRFTGSGSGTDYTLTISSVQ TSEDSAVYFCARGEAGYFDYWGQGTTLTVSSASTK AEDQALYYCQQHYRTPWTFGGGTKLEIKRAVA GPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVS APSVDIFPPSDEQLKSGTASVVCLLNNFYPREAK WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL VQWKVDNALQSGNSQESVTEQDSKDSTYSLSST GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPP LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD GEC VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTMDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK 21 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDIN 22 DIQMTQSPSSLSASVGDRVTITCRASQSISIYLNW U.S.Pat.No. WVRQATGQGLEWMGWMNPNSDNTGYAQKFQGR YQQKPGKAPKLLIYAASSLQSGVPLRFSGSGSGT 7,521,048 VTMTRNTSISTAYMELSSLRSEDTAVYYCARWNHY DFTLTISSLQPEDIATYYCQQSYKTPLTFGGGTK GSGSHFDYWGQGTLVTVSS VEIK 23 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGHYW 24 DIQMTQSPSSLSASVGDRVTITCRASQGLRNDLG U.S.Pat.No. SWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTIS WFQQKPGKVTKRLIYAASSLQRGVPSRFSGSGS 7,521,048 VDTSKNQFSLKLSSVTAADTAVYYCARDDSSGWGF GTEFTLTISSLQPEDFATYYCLQHYSFPWTFGQG DYWGQGILVTVSS TKVEIK 25 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGHYW 26 DIQMTQSPSSLSASVGDRVTITCRASQGLRNDLG U.S.Pat.No. SWIRQHPGKGLEWIGYIYYSGSAYYNPSLKSRVTIS WFQQKPGKAPKRLIYAASSLQRGVPSRFSGSGS 7,521,048 VDTSKNQFSLKLSSVTAADTAVYYCARDDSSGWGF GTEFTLTISSLQPEDFTTYFCLQHNSFPWTFGQGT DYWGQGILVTVSS KVEIK 27 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGHYW 28 DIQMTQSPSSLSASVGDRVTITCRASQGLRNDLG U.S.Pat.No. SWIRQHPGKGLEWIGYIYYSGSAYYNPSLKSRVTIS WFQQKPGKAPKRLIYAASSLQRGVPSRFSGSGS 7,521,048 VDTSKNQFSLKLSSVTAADTAVYYCARDDSSGWGF GTEFTLTISSLQPEDFTTYFCLQHNSFPWTFGQGT DYWGQGILVTVSS KVEIK 29 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMN 30 DIQMTQSPSSLSASVGDRVTITCRSSQSISNYINW U.S.Pat.No. WIRQAPGKGLEWVSHISSSGSILDYADSVKGRFTISR YQQRPGKAPNLLIHDVSSFQSAVPSRFSRSGSGT 7,521,048 DNAKNSLYLQMNSLRVEDTAVYYCARDGAAAGT VFTLTISSLQPEDFATYFCQQTYITPFTFGPGTKV DAFDLWGQGTMVTVSS DIK 31 QVQLVESGGGVVQPGRSLRLSCAASGFTFSYYGIH 32 DIQMTQSPSSLSASVGDRVTITCRASQGISNYLA U.S.Pat.No. WVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRF WYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGS 7,521,048 TISRDNSKNTLYLQMNSLRAEDTAVYYCARGRYSS GTDFTLTISSLQPEDVATYYCQKYNSAPLTFGGG SSWWYFDLWGRGTLVTVSS TKVEIK 33 QVQAEQSGPGLVKPSETLSLTCTVSGGSISNYYWS 34 DIVMTQSPDSLAVSLGERATINCKSSQSVLYRSN U.S.Pat.No. WIRQPPGKGLEWIGYIYYSGSTKYNPSLKSRVTISV NKIYLAWYQQKPGQPPKLLIYWASTRESGVPDR 7,521,048 DTSKNQFSLKLTSVTTADTAVYYCARDSPRGFSGY FSGSGSGTDFTLTISSLLAEDVAVYYCQQYYSTP EAFDSWGQGTLVTVSS FTFGPGTKVDIK 35 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSDNYYW 36 DIVMTQSPLSLPVTPGEPASISCRSSQSLLRRNGY U.S.Pat.No. SWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTIS NYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFS 7,521,048 VDTSKNQFSLKLSSVTAADTAVYYCARGVNWNFL GSGSGTDFTLKISRVEAEDVGVYYCMQALQTPL FDIWGQGTMVTVSS TFGGGTEVEIK 37 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMS 38 DIVMTQFPDSLAVSLGERATINCKSSQSVLHSSN U.S.Pat.No. WIRQAPGKGLEWVSYISRSGSTIYYADSVKGRFTIS NKNYLTWYQLKPGQPPKLLIYWASTRESGVPDR 7,521,048 RDNAKNSLYLQMNSLRAEDTAVYYCARSLGGMDV FSGSGSGTDFTLTISSLQAEDVAVYYCHQYYSTP WGQGTTVTVSS SSFGQGTKLEIK 39 QVQLVESGGGVVQPGRSLRLSCAASGFTFNNYGM 40 DIQMTQSPSSLSASVGDRVTITCRTSQSISTYLNW U.S.Pat.No. HWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGR YQQKPGKAPKLLISATSSLQSGVPSRFSGSGSGT 7,521,048 FTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRTV DFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTK YSNSSPFYYYYYGMDVWGQGTTVTVSS VEIK 41 QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYGMH 42 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNW U.S.Pat.No. WVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRF YQQKPGKAPKLLISATSSFQSGVPSRFSGSGSGT 7,521,048 TISRDNSKNTLYLQMNSLRAEDTAVYYCARDRTVY DFTLTISSLQPEDFAAYYCQQSYSTPLTFGGGTK SSSSPFYYYYYGMDVWGQGTTVTVSS VEIK 43 QVQLQQWGARLLKPSETLSLTCAVYGGSFSGYYW 44 DIVMTQSPDSLAVSLGERATINCKSSQSVLHSSN U.S.Pat.No. SWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISV NKNYLVWYQQKPGQPPKLLIYWASTRESGVPD 7,521,048 DTSKNQFSLKLRSVTAADTAVYYCARGGSSGYWY RFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST FDLWGRGTLVTVSS PLTFGGGTKVEIK 45 EVQVVESGGGLVKPGGSLRLSCAASGFTFSSYSMN 46 DIQMTQSPSSVSASVGDRVTITCRASQGISSWLV U.S.Pat.No. WVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTIS WYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGS 7,521,048 RDNAKNSLYLQMNSLRAEDTAVYYCARGGSSWYG GTDFTLTISSLQPEDFATYYCQQANSFPFTFGGG DWFDPWGQGTLVTVSS TKVEIK 47 QLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV 48 DIQMTQSPSSLSASVGDRVTITCRASQGISNYLA U.S.Pat.No. RQAPGKGLEWVAVIWYDGRNKYYADSVKGRFTIS WFQQKPGKAPKSLIYAASSLQSGVPSKFSGSGSG 7,521,048 RDNSKNTLYLQMNSLRAEDTAVYYCAREVGYCTN TDFTLTISSLQPEDFATYYCQQYNSYPLTFGGGT GVCSYYYYGMDVWGQGTTVTVSS KVEIK 49 QVQLQESGPGLVKPSQTLSLTCSVSGGSISSGGYYW 50 DIQMTQSPSSVSASVGDRVTITCRASQGISSWLA U.S.Pat.No. SWIRQHPGKGLEWIGYIYYSGSTYCNPSLKSRVTIS WYQQKPGKAPKFLIFVASSFQSGVPSRFSGSGSG 7,521,048 VDTSKNQFSLKLSSVTAADTAVYYCARDNGSGSYD TDFTLTISSLQPEDFATYYCQQANSFPRTFGQGT WFDPWGQGILVTVSS KVEIK 51 QVQMQESGPGLVKPSQTLSLTCTVSGGSISSGDYY 52 DIQMTQSPSSVSASVGDRVTITCRASQGISSWLA U.S.Pat.No. WSWIRQHPGKNLEWIGYIYYSGSTYYNPSLKSRVTI WYQQKPGKAPKFLIFVASSLQSGVPSRFSGSGSG 7,521,048 SVDTSKNQFSLKLSSVTAADTAVYYCARDNGSGSY TDFTLTISSLQPEDFATYYCQQANSFPRTFGQGT DWFDPWGQGTLVTVSS KVEIK 53 KVQLQQSGAELVKPGASVKLSCKASGYTFTDYTIH 54 DIAMTQSHKFMSTLVGDRVSITCKASQDVNTAI U.S.Pat.No. WVKQRSGQGLEWIGWFYPGGGYIKYNEKFKDRAT AWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSG 7,229,617 LTADKSSNTVYMELSRLTSEGSAVYFCARHEEGIYF SGTDYTLTISSMEAEDAATYYCQQWSSNPLTFG DYWGQGTTLTVSS AGTKLELKRA 55 KVQLQQSGAELVKPGASVKLSCKASGYTFTDYTIH 56 DIVMTQSHKFMSTSVGDRVSITCKASQDVNTAI U.S.Pat.No. WVKQRSGQGLEWIGWFYPGGGYIKYNEKFKDRAT AWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSG 7,229,618 LTADKSSNTVYMELSRLTSEDSAVYFCARHEEGIYF SGTDYTLTISSVQAEDLALYYCQQHYTTPFTFGS DYWGQGTTLTVSS GTKL 82 MDLMCKKMKHLWFFLLLVAAPRWVLSQLQLQES 83 MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLS U.S.Pat.No. GPGLVKPSETLSLTCTVSGGSIISKSSYWGWIRQPPG PGERATLSCRASQSVSSFLAWYQQKPGQAPRLLI 7,115,717 KGLEWIGSIYYSGSTFYNPSLKSRVTISVDTSKNQFS YDASNRATGIPARFSGSGSGTDFTLTISSLEPEDF LKLSSVTAADTAVYYCARLTVAEFDYWGQGTLVT AVYYCQQRSNWPLTFGPGTKVDIKRT VSSAS 84 MDLMCKKMKHLWFFLLLVAAPRWVLSQLQLQES 85 MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLS U.S.Pat.No. GPGLVKPSETLSLTCTVSGGSISSRSNYWGWIRQPP PGERATLSCRASQSVSSFLAWYQQKPGQAPRLLI 7,115,717 GKGLEWIGNVYYRGSTYYNSSLKSRVTISVDTSKN YDASNRATGSPARFSGSGSGTDFTLTISSLEPEDF QFSLKLSSVTVADTAVYYCARLSVAEFDYWGQGIL AVYYCQQRSDWPLTFGPGTKVDIKRT VTVSSAS 86 MDLMCKKMKHLWFFLLLVAAPRWVLSQLQLQES 87 METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSP U.S.Pat.No. GPGLVKPSETLSLTCTVSGGSISSSSYYWGWVRQPP GERATLSCRASQSVSSSYLAWYQQKPGQAPRLL 7,115,717 GKGLEWIGSIHYSGSTFYNPSLKSRVTISVDTSKNQF IYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDF SLKLSSVTAADTTVYYCARQGSTVVRGVYYYGMD AVYYCQQYGSSPLYTFGQGTKLEIKRT VWGQGTTVTVSSAS 88 MEFGLSWLFLVAILKGVQCEVQLLESGGGLVQPGR 89 MSPSQLIGFLLLWVPASRGEIVLTQSPDFQSVTPK U.S.Pat.No. SLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAI EKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKY 7,115,717 SGSGGSRYYADSVKGRFTISRDNSKNTLYLQMNSL ASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAAA RAEDTAVYYCAKESSGWFGAFDYWGQGTLVTVSS YYCHQSSSLPITFGQGTRLEIKR
TABLE-US-00007 TABLE3 AntiDR5ScFvSequences SEQ ID SEQUENCE Reference 57 EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWV U.S.Pat. SGINWNGGSTGYADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCA Application KILGAGRGWYFDLWGKGTTVTVSSGGGGSGGGGSGGGGSSELTQDPAVS Publication VALGQTVRITCQGSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRF No. SGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLG 2006/0269555 58 EVQLVETGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS U.S.Pat. AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCARG Application GYSSSRSAAYDIWGQGTLVTVSSGGGGSGGGGSGGGGSSELTQDPAVSV Publication ALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS No. GSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLG 2006/0269556 59 QVQLVQSGAEVKKPGASVKISCEGSGYTFNSYTLHWLRQAPGQRLEWM U.S.Pat. GRINAGNGNTKYSQNFQGRLSITRDTSATTAYMELSSLRSEDTGVYYCAR Application VFTYSFGMDVWGRGTLVTVSSGGGGSGGGGSGGGGSAQSVLTQPPSASG Publication TPGQRVTISCSGGGSNIGRNSVSWYQQLPGTAPKLILYSNNQRPSGVPDRF No. SGSKSGTSASLAISGLRSEDEALYYCAAWDDSLSGGVFGGGTKLTVLG 2006/0269557 60 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS U.S.Pat. AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK Application VHRPGRSGYFDYWGRGTLVTVSSGGGGSGGGGSGGGGSSELTQDPAVSV Publication ALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS No. GSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLG 2006/0269558 61 QVQLQQSGAEVKKPGASVRVSCQASGYSLSEYYIHWVRQAPGQGLEWM U.S.Pat. GWLNPNSGVTDYAQKFQGRVSMTRDTSISTAYMELSSLTFNDTAVYFCA Application RGNGDYWGKGTLVTVSPGGGGSGGGGSGGGGSSELTQDPAVSVALGQT Publication VRITCQGDSLRSYYTNWFQQKPGQAPLLVVYAKNKRPSGIPDRFSGSSSG No. NTASLTITGAQAEDEADYYCHSRDSSGWVFGGGTKLTVLG 2006/0269559 62 QVQLVQSGGGVVQPGRSLRLSCAASGFTFSPDAMHWVRQAPGKGLEWM U.S.Pat. GVISFDGSQTFYADSVKGRFTISRDNSQNTLYLQMNSLRSDDTAVYYCAR Application APARFFPLHFDIWGRGTMVTVSSGGGGSGGGGSGGGGSALSSELTQDPA Publication VSVALGQTVRITCQGDSLRTHYASWYHQRPGRAPVLVNYPKDSRPSGIPD No. RFSGSSSGNTASLTITGAQAADEGDYYCQSRDSSGVLFGGGTKVTVLG 2006/0269560 63 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWV U.S.Pat. ANIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA Application RDFSGYGDYLDYWGKGTLVTVSSGGGGSGGGGSGGGGSAQSALTQPPS Publication ASGSPGQSVTISCTGTSSDIGNYNYVSWYQQHPGKAPKLMIYEVNERPSG No. VPDRFSGSKSGNTASLTVSGLRPEDEADYYCSSYAGNNAVIFGGGTQLTV 2006/0269561 LG 64 QVQLVQSGAEVKKPGASVKVSCKASGYTFTTHAMHWVRQAPGQSLEW U.S.Pat. MGWINTGNGNTKYSQSFQGRVSITRDTSANTAYMELSSLKSEDTAMYYC Application ARASRDSSGYYYVPPGDFFDIWGQGTLVTVSSGGGGSGGGGSGGGGSAQ Publication SALTQPASVSGSPGQSITISCTGSRSDIGGYNFVSWYQQHPGKAPKLLIYD No. VYNRPSGISDHFSGSKSDNTASLTISGLQSEDDADYYCSSYAGYHTWIFGG 2006/0269562 GTKVTVLG 65 EVQLVQSGAEVKKPGASVKLSCKASGYTLVNYFMHWVRQAPGQGPEW U.S.Pat. MGMINPSGGTTKNRQKFQDRVTMTRDTSTRTVYMELSGLTSEDTAVYYC Application ATDFKGTDILFRDWGRGTLVTVSSGGGGSGGGGSGGGGSAQSVLTQPPS Publication ASGTPGQRVSISCSGSSSNIGSNTVIWYQQLPGTAPKLLMYSNDRRPSGVP No. DRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSLNGHYVFGTGTKLTV 2006/0269563 LG 66 QMQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVS U.S.Pat. AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARG Application GSTFDIWGRGTMVTVSSGGGGSGGGGSGGGGSAQPVLTQPPSASGTPGQ Publication RVTISCSGSNSNIGSRPVNWYQQLPGTAPKLLIQGNNQRPSGVPDRFSGSK No. SGTSASLAISGLQSEDEADYYCAAWDDSLTGYVFGPGTKLTVLG 2006/0269564 67 QMQLVQSGGAVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWV U.S.Pat. AVISYDGSIKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR Application ERLRGLDPWGQGTMVTVSSGGGGSGGGGSGGGGSSELTQDPAVSVALG Publication QTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSS No. GNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLG 2006/0269565 68 EVQLVETGGGLVQPGGSLRLSCAASGFTFSPYYMSWVRQAPGKGLEWVS U.S.Pat. AISGSGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCARG Application ASGPDYWGRGTMVTVSSGGGGSGGGGSGGGGSAQSVLTQPPSVSAAPG Publication QKVTISCSGSTSNIGNNYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGS No. KSGTSATLGITGLQTGDEADYYCGTWDSSLSALVFGGGTKVTVLG 2006/0269566 69 QVQLQQSGAEVKTPGSSVKVSCKASGGTFRNNAISWVRQAPGQGLEWM U.S.Pat. GGFIPKFGTTNHAQKFQGRVTMTADDSTNTVYMELSSLRSEDTAVYYCA Application RGGAYCGGGRCYLYGMDVWGQGTLVTVSSGGGGSGGGGSGGGGSAQA Publication VVIQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDT No. SNKRSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCLVSYSGSLVVFGG 2006/0269567 GTKLTVLG 70 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS U.S.Pat. AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCVK Application GAWLDYWGRGTMVTVSSGGGGSGGGGSGGGGSALNFMLTQPHSVSESP Publication GKTVTISCTGSSGSVARNYVQWYQQRPGSAPTIVIYEDNRRPSGVPGRFSG No. SIDRSSNSASLTISGLQTEDEADYYCQSYNYNTWVFGGGTKLTVLG 2006/0269568 71 EVQLVQSGAEVKKPGASVKVSCRASGYTFTSYGITWVRQAPGQGLEWM U.S.Pat. GWISAYNGKTNYVQELQGRVTMTTDTSTSTVYMELTSLRSDDTAVYYCA Application RRGNNYRFGYFDFWGQGTLVTVSSGGGGSGGGGSGGGGSALETTLTQSP Publication GTLSLSPGERATLSCRASQSISSSNLAWYQQKPGRAPRLLIYGASSRAIGIP No. DRFSGSGSGTDFTLTISRLEAEDFAVYYCQQYGSSPITFGQGTRLEIKR 2006/0269569 72 QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSTTVAWDWIR U.S.Pat. QSPSRGLEWLGRTYYRSKWYNEYAVSVKSRITINVDTSKN No.8,097,704 QISLQLNSVTPEDTAVYYCAREPDAGRGAFDIWGQGTTVT SPLRWGRFGWRGLGRGWLRSPVTQSPGTLSLSPGERATLS CRASQSVSSSHLAWYQQKPGQAPRLLIYGASSRATGIPDR FSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPRAVFGQGTRLEIK 73 QVQLQQSGPGRVQPSQTLSLTCAISGDSVSNNNAAWYWIR U.S.Pat. QSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITISPDTSKN No.8,097,705 QFSLQLNSVTPEDTAVYYCARRGDGNSYFDYWGQGTLVTV SSGILRWGRFGWRGLGRGWLEIVLTQSPGTLSLSPGERAT LSCRASQSVSSGYVSWYRQKPGQAPRLLIYGASTRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCHQYGSSPNTYGQGTKVGIK
[0140] In certain aspects the DR5 binding domain comprises a VH and a VL, wherein the VH and VL comprise amino acid sequences at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or 100% identical to SEQ ID NO: 1 and SEQ ID NO: 2; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 5 and SEQ ID NO: 6; SEQ ID NO: 7 and SEQ ID NO: 8; SEQ ID NO: 9 and SEQ ID NO: 10; SEQ ID NO: 11 and SEQ ID NO: 12; SEQ ID NO: 13 and SEQ ID NO: 14; SEQ ID NO: 15 and SEQ ID NO: 16; SEQ ID NO: 17 and SEQ ID NO: 18; SEQ ID NO: 19 and SEQ ID NO: 20; SEQ ID NO: 21 and SEQ ID NO: 22; SEQ ID NO: 23 and SEQ ID NO: 24; SEQ ID NO: 25 and SEQ ID NO: 26; SEQ ID NO: 27 and SEQ ID NO: 28; SEQ ID NO: 29 and SEQ ID NO: 30; SEQ ID NO: 31 and SEQ ID NO: 32; SEQ ID NO: 33 and SEQ ID NO: 34; SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 37 and SEQ ID NO: 38; SEQ ID NO: 39 and SEQ ID NO: 40; SEQ ID NO: 41 and SEQ ID NO: 42; SEQ ID NO: 43 and SEQ ID NO: 44; SEQ ID NO: 45 and SEQ ID NO: 46; SEQ ID NO: 47 and SEQ ID NO: 48; SEQ ID NO: 49 and SEQ ID NO: 50; SEQ ID NO: 51 and SEQ ID NO: 52; SEQ ID NO: 53 and SEQ ID NO: 54; SEQ ID NO: 55 and SEQ ID NO: 56; SEQ ID NO: 82 and SEQ ID NO: 83; SEQ ID NO: 84 and SEQ ID NO: 85; SEQ ID NO: 86 and SEQ ID NO: 87; or SEQ ID NO: 88 and SEQ ID NO: 89; respectively, or where the VH and VL are situated in an ScFv comprising an amino acid sequence at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or 100% identical to SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, or SEQ ID NO: 73.
[0141] While a variety of different dimeric, pentameric, and hexameric binding molecules can be contemplated by a person of ordinary skill in the art based on this disclosure, and as such are included in this disclosure, in certain aspects, a binding molecule as described above is provided in which each binding unit comprises two IgA or IgM heavy chains each comprising a VH situated amino terminal to the IgA or IgM constant region or fragment thereof, and two immunoglobulin light chains each comprising a VL situated amino terminal to an immunoglobulin light chain constant region.
[0142] Moreover, in certain aspects, at least one binding unit of the binding molecule, or at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule, comprises or comprise two of the DR5 binding domains as described above. In certain aspects the two DR5 binding domains in the at least one binding unit of the binding molecule, or at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule, can be different from each other, or they can be identical.
[0143] In certain aspects, the two IgA or IgM heavy chains within the at least one binding unit of the binding molecule, or at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule, are identical. In certain aspects, two identical IgA or IgM heavy chains within at least one binding unit, or within at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule comprise the heavy chain variable domain amino acid sequences as disclosed in Tables 2 and 3.
[0144] In certain aspects, the two light chains within the at least one binding unit of the binding molecule, or at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule, are identical. In certain aspects, two identical light chains within at least one binding unit, or within at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule are kappa light chains, e.g., human kappa light chains, or lambda light chains, e.g., human lambda light chains. In certain aspects, two identical light chains within at least one binding unit, or within at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule each comprise the light chain variable domain amino acid sequences as disclosed in Tables 2 and 3.
[0145] In certain aspects at least one, at least two, at least three, at least four, at least five, or at least six binding units of a dimeric, pentameric, or hexameric binding molecule provided by this disclosure comprises or each comprise two identical IgA or IgM heavy chain constant regions each comprising identical heavy chain variable domain amino acid sequences as disclosed in Tables 2 and 3, and two identical light chains each comprising identical heavy chain variable domain amino acid sequences as disclosed in Tables 2 and 3. According to this aspect, the DR5 binding domains in the at least one binding unit of the binding molecule, or at least two, at least three, at least four, at least five, or at least six binding units of the binding molecule, can be identical. Further according to this aspect, a dimeric, pentameric, or hexameric binding molecule as provided herein can comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or at least twelve copies of an DR5 binding domain as described above. In certain aspects at least two, at least three, at least four, at least five, or at least six of the binding units can be identical and, in certain aspects the binding units can comprise identical binding domains, e.g., at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or at least twelve DR5 binding domains can be identical.
[0146] In certain aspects, a dimeric, pentameric, or hexameric DR5 binding molecule as provided herein can possess advantageous structural or functional properties compared to other binding molecules. For example, the dimeric, pentameric, or hexameric DR5 binding relative to a corresponding bivalent binding molecule having the same antigen binding domains. Biological assays include, but are not limited to ELISA and Western blot caspase assays, and FACS analyses using stains indicative of apoptotic cell death such as annexin-v. In certain aspects a dimeric, pentameric, or hexameric binding molecule as provided herein can trigger apoptosis of a DR5-expressing cell at higher potency than an equivalent amount of a monospecific, bivalent IgG1 antibody or fragment thereof that specifically binds to the same DR5 epitope as the DR5 binding domain. In certain aspects a dimeric, pentameric, or hexameric binding molecule as provided herein can trigger apoptosis of a DR5-expressing cell at higher potency than an equivalent amount of monospecific, bivalent anti-DR5 monoclonal antibody or fragment thereof, where the antibody is, or comprises the same VH and VL regions as, the antibodies provided in Tables 2 and 3.
[0147] Polynucleotides, Vectors, and Host Cells
[0148] The disclosure further provides a polynucleotide, e.g., an isolated, recombinant, and/or non-naturally-occurring polynucleotide, comprising a nucleic acid sequence that encodes a polypeptide subunit of a dimeric, pentameric, or hexameric binding molecule as provided herein. By polypeptide subunit is meant a portion of a binding molecule, binding unit, or binding domain that can be independently translated. Examples include, without limitation, an antibody VH, an antibody VL, a single chain Fv, an antibody heavy chain, an antibody light chain, an antibody heavy chain constant region, an antibody light chain constant region, and/or any fragment thereof.
[0149] The disclosure further provides a composition comprising two or more polynucleotides, where the two or more polynucleotides collectively can encode a dimeric, pentameric, or hexameric binding molecule as described above. In certain aspects the composition can include a polynucleotide encoding an IgA or IgM heavy chain or fragment thereof, e.g., a human IgA or IgM heavy chain as described above where the IgA or IgM heavy chain comprises at least the VH of a DR5 binding domain, and a polynucleotide encoding a light chain or fragment thereof, e.g., a human kappa or lambda light chain that comprises at least the VL of a DR5 binding domain. A polynucleotide composition as provided can further include a polynucleotide encoding a J chain, e.g., a human J chain, or a fragment thereof or a variant thereof. In certain aspects the polynucleotides making up a composition as provided herein can be situated on two or three separate vectors, e.g., expression vectors. Such vectors are provided by the disclosure. In certain aspects two or more of the polynucleotides making up a composition as provided herein can be situated on a single vector, e.g., an expression vector. Such a vector is provided by the disclosure.
[0150] The disclosure further provides a host cell, e.g., a prokaryotic or eukaryotic host cell, comprising a polynucleotide or two or more polynucleotides encoding a dimeric, pentameric, or hexameric DR5 binding molecule as provided herein, or any subunit thereof, a polynucleotide composition as provided herein, or a vector or two, three, or more vectors that collectively encode a dimeric, pentameric, or hexameric DR5 binding molecule as provided herein, or any subunit thereof. In certain aspects a host cell provided by the disclosure can express a dimeric, pentameric, or hexameric DR5 binding molecule as provided by this disclosure, or a subunit thereof.
[0151] In a related aspect, the disclosure provides a method of producing a dimeric, pentameric, or hexameric DR5 binding molecule as provided by this disclosure, where the method comprises culturing a host cell as described above and recovering the binding molecule.
[0152] Methods of Use
[0153] This disclosure provides a method for inhibiting, delaying, or reducing malignant cell growth in a subject with cancer by administering to the subject a combination therapy comprising an effective amount of a dimeric IgA antibody or a hexameric or pentameric IgM antibody, or a multimerized, antigen-binding fragment thereof that specifically and agonistically binds to DR5, wherein at least three antigen binding domains of the IgA or IgM antibody or fragment thereof are DR5-specific and agonistic, in combination with an effective amount of a chemotherapeutic agent, e.g., a DNA topoisomerase I inhibitor, e.g., irinotecan or topotecan, and/or a combination thereof, a nucleoside analog, e.g., Gemcitabine, cytosine arabinoside (ara-C), or fluorouracil (5-FU)). Exemplary anti-DR5 IgA and IgM antibodies and exemplary chemotherapeutic agents are described in detail elsewhere herein. In certain aspects, administration of the combination therapy provided herein can inhibit tumor or malignant cell growth partially or completely, can delay the progression of tumor and malignant cell growth in the subject, can prevent metastatic spread in the subject, can reduce the subject's tumor size, e.g., to allow more successful surgical removal, or can result in any combination of positive therapeutic responses in the subject. Exemplary therapeutic responses that can be achieved are described herein.
[0154] In certain aspects, administration of the combination therapy can result in enhanced therapeutic efficacy relative to administration of the anti-DR5 IgA and IgM antibody or the chemotherapeutic agent, e.g., the DNA topoisomerase I inhibitor, the nucleoside analog, or the pro-apoptotic agent, e.g., the BCL-2 inhibitor, alone. In certain aspects the improved treatment efficacy can be greater than the additive efficacy of each individual agent. In certain aspects the improved treatment efficacy over either agent administered alone, measured, e.g., in increased tumor growth delay (TGD), increased frequency of tumor regression, e.g., complete tumor regression, or increased survival is at least 5%, at least 10%, at least 20%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 150%, at least 200%, at least 250%, at least 300%, at least 350%, at least 400%, at least 450%, at least 500%, at least 550%, at least 600%, at least 650%, at least 700%, at least 750%, at least 800%, at least 850%, at least 900%, at least 950%, or at least 1000%. In certain aspects the improved treatment efficacy over the additive efficacy of both agents administered individually, measured, e.g., in increased tumor growth delay (TGD), increased frequency of tumor regression, e.g., complete tumor regression, or increased survival is at least 5%, at least 10%, at least 20%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 150%, at least 200%, at least 250%, at least 300%, at least 350%, at least 400%, at least 450%, at least 500%, at least 550%, at least 600%, at least 650%, at least 700%, at least 750%, at least 800%, at least 850%, at least 900%, at least 950%, or at least 1000%. In certain aspects the improvement can be complete tumor regression and full survival. The improved activity can, for example, allow a reduced dose to be used, or can result in more effective killing of cells that are resistant to killing by standard treatments. By resistant is meant any degree of reduced activity of standard of care for a given tumor or cancer type.
[0155] In certain aspects the combination treatment methods provided herein can facilitate cancer treatment, e.g., by slowing tumor growth, stalling tumor growth, or reducing the size of existing tumors, when administrated as an effective dose to a subject in need of cancer treatment.
[0156] In certain aspects the DR5-expressing cell is an immortalized cell line, e.g., a cancer cell. The terms cancer, tumor, cancerous, and malignant refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancers include but are not limited to, carcinoma including adenocarcinomas, lymphomas, blastomas, melanomas, sarcomas, and leukemias. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastrointestinal cancer, Hodgkin's and non-Hodgkin's lymphoma, pancreatic cancer, glioblastoma, glioma, cervical cancer, ovarian cancer, liver cancer such as hepatic carcinoma and hepatoma, bladder cancer, breast cancer (including hormonally mediated breast cancer, see, e.g., Innes et al. (2006) Br. J. Cancer 94:1057-1065), colon cancer, colorectal cancer, endometrial carcinoma, myeloma (such as multiple myeloma), salivary gland carcinoma, kidney cancer such as renal cell carcinoma and Wilms' tumors, basal cell carcinoma, melanoma, prostate cancer, vulval cancer, thyroid cancer, testicular cancer, esophageal cancer, various types of head and neck cancer including, but not limited to, squamous cell cancers, and cancers of mucinous origins, such as, mucinous ovarian cancer, cholangiocarcinoma (liver) and renal papillary carcinoma. Mucosal distribution, for example as provided by an IgA-based binding molecule as provided herein, could be beneficial for certain cancers, e.g., lung cancer, ovarian cancer, colorectal cancer, or squamous cell carcinoma.
[0157] Effective doses of compositions for treatment of cancer vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. In certain aspects the treatment methods provided herein can provide increased safety, in that the composition exhibits greater cytotoxicity (e.g., induces apoptosis to a greater extent) on cancer cells than on non-cancer cells, e.g., normal human hepatocytes. Usually, the patient is a human, but non-human mammals including transgenic mammals can also be treated. Treatment dosages can be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
[0158] The compositions of the disclosure can be administered by any suitable method, e.g., parenterally, intraventricularly, orally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term parenteral as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrastemal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques.
[0159] The subject to be treated can be any animal, e.g., mammal, in need of treatment, in certain aspects, subject is a human subject.
[0160] In its simplest form, a preparation to be administered to a subject is a dimeric, pentameric, or hexameric binding anti-DR5 antibody as provided herein, or an antigen-binding, multimerizing fragment, variant, or derivative thereof, administered in conventional dosage form in combination with a chemotherapeutic agent, e.g., Irinotecan, where the agents can be combined with a pharmaceutical excipient, carrier or diluent as described elsewhere herein.
[0161] A DR5 binding molecule as provided herein or an antigen-binding, multimerizing fragment, variant, or derivative thereof can be administered by any suitable method as described elsewhere herein, e.g., via IV infusion. In certain aspects, a DR5 binding molecule as provided herein or an antigen-binding, multimerizing fragment, variant, or derivative thereof can be introduced into a tumor, or in the vicinity of a tumor cell.
[0162] All types of tumors are potentially amenable to treatment by this approach including, without limitation, carcinoma of the breast, lung, pancreas, ovary, kidney, colon and bladder, as well as melanomas, sarcomas and lymphomas. Mucosal distribution could be beneficial for certain cancers, e.g., lung cancer, ovarian cancer, colorectal cancer, or squamous cell carcinoma.
[0163] Topoisomerase I Inhibitors
[0164] Topoisomerases are popular targets for cancer chemotherapy, and a variety of inhibitors have been or are currently being developed. Compounds that inhibit type I topoisomerase are currently in use or are being developed as cancer chemotherapeutic agents. In particular, two derivatives of the natural type I topoisomerase inhibitor camptothecin, irinotecan (7-ethyl-10-[4-(1-piperidino)-1-piperidino]carbonyloxy-camptothecin, also called CPT-11), and topotecan (9-[(dimethylamino)Methyl]-10-hydroxy-(4S)-camptothecin, are currently marketed for the treatment of various cancers. Irinotecan is part of the FOLFIRI regimen of leucovorin calcium (calcium folinate), 5-fluorouracil, and Irinotecan widely used in the treatment of advanced-stage and metastatic colorectal cancer.
[0165] Irinotecan has the following formula:
##STR00001##
[0166] Topotecan has the following formula:
##STR00002##
[0167] Chemotherapeutic Nucleoside Analogs
[0168] Gemcitabine (2,2-difluoro 2deoxycytidine, or dFdC) is a nucleoside analog used as chemotherapy. It is FDA approved for treatment of, e.g., breast, pancreatic, lung, and ovarian cancers. It has the following formula:
##STR00003##
As a pyrimidine analog, the drug replaces one of the building blocks of nucleic acids in rapidly growing tumor cells, in this case cytidine, during DNA replication. The process arrests tumor growth, as new nucleosides cannot be attached to the faulty nucleoside, resulting in apoptosis (cellular suicide). Gemcitabine is used in various carcinomas: non-small cell lung cancer, pancreatic cancer, bladder cancer and breast cancer. Gemcitabine is the standard of care for many pancreatic cancers.
[0169] Other FDA-approved nucleoside analogs for cancer treatments include cytosine arabinoside (ara-C or Cytarabine) for treatment of acute myeloid leukemia (AML), acute lymphocytic leukemia (ALL), chronic myelogenous leukemia (CML) and non-Hodgkin's lymphoma (www_dot_drugs_dot_com/monograph/cytarabine.html (visited Nov. 14, 2018)), and fluorouracil (5-FU) for the treatment of colon cancer, esophageal cancer, stomach cancer, pancreatic cancer, breast cancer, basal cell carcinoma, and cervical cancer (www_dot_drugs_dot_com/monograph/fluorouracil.html (visited Nov. 14, 2018)). Ara-C has the following formula:
##STR00004##
5-FU has the following formula:
##STR00005##
[0170] B-cell lymphoma-2 (BCL-2) Inhibitors
[0171] The BCL-2 family of proteins are associated with the regulation of cellular apoptosis. Proteins in this family associated with increased cell survival include BCL-2, BCL-X.sub.L, BCL-2-like 2 (BCL-w), myeloid cell leukemia sequence 1 (MCL-1), and BCL-2-related protein A1 (BFL-1). Many small molecule inhibitors of these anti-apoptotic proteins have been studied as potential treatments for hematologic cancers such as relapsed or refractory chronic lymphoid leukemia (CLL) and acute myeloblastic leukemia (AML). See, e.g., Cang, S. et al., J. Hematol. Oncol. 8:129-136 (2015). Some of the first small molecule BCL-2 inhibitors developed were broad-spectrum. Id. For example, ABT-737 and ABT-263 (Navitoclax) inhibit the activity of BCL-2, BCL-X.sub.L, and BCL-w. These drugs did not progress in clinical development because of low solubility and bioavailability of the former, and dose-limiting side effects of the latter. ABT-737 (4-{4-[(4-Chloro-2-biphenylyl)methyl]-1-piperazinyl}-N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)-2-butanyl]amino}-3-nitrophenyl)sulfonyl]benzamide) has the following structure:
##STR00006##
ABT-263 (Navitoclax; 4-(4-{[2-(4-Chlorophenyl)-5,5-dimethyl-1-cyclohexen-1-yl]methyl}-1-piperazinyl)-N-[(4-{[(2R)-4-(4-morpholinyl)-1-(phenylsulfany)-2-butanyl]amino}-3-[(trifluoromethyl)sulfonyl]phenyl)sulfonyl]benzamide) has the following structure:
##STR00007##
[0172] Venetoclax (ABT-199; 4-{4-[(4-chloro-5,5-dimethyl[3,4,5,6-tetrahydro[1,1-biphenyl]]-2-yl)methyl]piperazin-1-yl}-N-(3-nitro-4-{[(oxan-4-yl)methyl]amino}benzene-1-sulfonyl)-2-[(1H-pyrrolo[2,3-b]pyridin-5-yl)oxy]benzamide), on the other hand, selectively inhibits only the BCL-2 protein, and is currently indicated for treatment of CLL. Venetoclax has the following structure:
##STR00008##
These drugs act to promote apoptosis of cancer cells, e.g., hematologic malignancies. Id.
[0173] Pharmaceutical Compositions and Administration Methods
[0174] Methods of preparing and administering a dimeric, pentameric, or hexameric TNF receptor binding molecule as provided herein to a subject in need thereof are well known to or are readily determined by those skilled in the art in view of this disclosure. The route of administration of a TNF receptor binding molecule can be, for example, oral, parenteral, by inhalation or topical. The term parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, or vaginal administration. While these forms of administration are contemplated as suitable forms, another example of a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip. A suitable pharmaceutical composition can comprise a buffer (e.g. acetate, phosphate or citrate buffer), a surfactant (e.g. polysorbate), optionally a stabilizer agent (e.g. human albumin), etc.
[0175] As discussed herein, a dimeric, pentameric, or hexameric DR5 binding molecule as provided herein can be administered in a pharmaceutically effective amount for the in vivo treatment of cancers expressing DR5. In this regard, it will be appreciated that the disclosed binding molecules can be formulated so as to facilitate administration and promote stability of the active agent. Pharmaceutical compositions accordingly can comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like. A pharmaceutically effective amount of a dimeric, pentameric, or hexameric TNF receptor binding molecule as provided herein means an amount sufficient to achieve effective binding to a target and to achieve a therapeutic benefit. Suitable formulations are described in Remington's Pharmaceutical Sciences (Mack Publishing Co.) 16th ed. (1980).
[0176] Certain pharmaceutical compositions provided herein can be orally administered in an acceptable dosage form including, e.g., capsules, tablets, aqueous suspensions or solutions. Certain pharmaceutical compositions also can be administered by nasal aerosol or inhalation. Such compositions can be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
[0177] The amount of a dimeric, pentameric, or hexameric DR5 binding molecule that can be combined with carrier materials to produce a single dosage form will vary depending, e.g., upon the subject treated and the particular mode of administration. The composition can be administered as a single dose, multiple doses or over an established period of time in an infusion. Dosage regimens also can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
[0178] In keeping with the scope of the present disclosure, a dimeric, pentameric, or hexameric DR5 binding molecule as provided herein can be administered to a subject in need of therapy in an amount sufficient to produce a therapeutic effect. A dimeric, pentameric, or hexameric DR5 binding molecule as provided herein can be administered to the subject in a conventional dosage form prepared by combining the antibody or antigen-binding fragment, variant, or derivative thereof of the disclosure with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. The form and character of the pharmaceutically acceptable carrier or diluent can be dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables.
[0179] By therapeutically effective dose or amount or effective amount is intended an amount of a dimeric, pentameric, or hexameric DR5 binding molecule, that when administered brings about a positive therapeutic response with respect to treatment of a patient with cancer expressing DR5.
[0180] Therapeutically effective doses of the compositions disclosed herein for treatment of cancer can vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. In certain aspects, the subject or patient is a human, but non-human mammals including transgenic mammals can also be treated. Treatment dosages can be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
[0181] The amount of a dimeric, pentameric, or hexameric DR5 binding molecule to be administered is readily determined by one of ordinary skill in the art without undue experimentation given this disclosure. Factors influencing the mode of administration and the respective amount of a dimeric, pentameric, or hexameric DR5 binding molecule include, but are not limited to, the severity of the disease, the history of the disease, and the age, height, weight, health, and physical condition of the individual undergoing therapy. Similarly, the amount of a dimeric, pentameric, or hexameric TNF receptor binding molecule to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this agent.
[0182] This disclosure also provides for the use of a dimeric, pentameric, or hexameric DR5 binding molecule in the manufacture of a medicament for treating, preventing, or managing cancer where the cancer expresses DR5.
[0183] This disclosure employs, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Green and Sambrook, ed. (2012) Molecular Cloning A Laboratory Manual (4th ed.; Cold Spring Harbor Laboratory Press); Sambrook et al., ed. (1992) Molecular Cloning: A Laboratory Manual, (Cold Springs Harbor Laboratory, NY); D. N. Glover and B. D. Hames, eds., (1995) DNA Cloning 2d Edition (IRL Press), Volumes 1-4; Gait, ed. (1990) Oligonucleotide Synthesis (IRL Press); Mullis et al. U.S. Pat. No. 4,683,195; Hames and Higgins, eds. (1985) Nucleic Acid Hybridization (IRL Press); Hames and Higgins, eds. (1984) Transcription And Translation (IRL Press); Freshney (2016) Culture Of Animal Cells, 7th Edition (Wiley-Blackwell); Woodward, J., Immobilized Cells And Enzymes (IRL Press) (1985); Perbal (1988) A Practical Guide To Molecular Cloning; 2d Edition (Wiley-Interscience); Miller and Calos eds. (1987) Gene Transfer Vectors For Mammalian Cells, (Cold Spring Harbor Laboratory); S. C. Makrides (2003) Gene Transfer and Expression in Mammalian Cells (Elsevier Science); Methods in Enzymology, Vols. 151-155 (Academic Press, Inc., N.Y.); Mayer and Walker, eds. (1987) Immunochemical Methods in Cell and Molecular Biology (Academic Press, London); Weir and Blackwell, eds.; and in Ausubel et al. (1995) Current Protocols in Molecular Biology (John Wiley and Sons).
[0184] General principles of antibody engineering are set forth, e.g., in Strohl, W. R., and L. M. Strohl (2012), Therapeutic Antibody Engineering (Woodhead Publishing). General principles of protein engineering are set forth, e.g., in Park and Cochran, eds. (2009), Protein Engineering and Design (CDC Press). General principles of immunology are set forth, e.g., in: Abbas and Lichtman (2017) Cellular and Molecular Immunology 9th Edition (Elsevier). Additionally, standard methods in immunology known in the art can be followed, e.g., in Current Protocols in Immunology (Wiley Online Library); Wild, D. (2013), The Immunoassay Handbook 4th Edition (Elsevier Science); Greenfield, ed. (2013), Antibodies, a Laboratory Manual, 2d Edition (Cold Spring Harbor Press); and Ossipow and Fischer, eds., (2014), Monoclonal Antibodies: Methods and Protocols (Humana Press).
[0185] All of the references cited above, as well as all references cited herein, are incorporated herein by reference in their entireties.
[0186] The following examples are offered by way of illustration and not by way of limitation.
EXAMPLES
[0187] In the examples that follow, anti-DR5 IgM Mab #2, constructed as described in US Patent Application Publication No. 2018-0009897, and comprising the VH and VL amino acid SEQ ID NO: 5 and SEQ ID NO: 6 as provided in Table 2, and anti-DR5 IgM Mab #5, constructed as described in US Patent Application Publication No. 2018-0009897, and comprising the VH and VL amino acid SEQ ID NO: 7 and SEQ ID NO: 8 as provided in Table 2, were used. The anti-DR5 IgG used in the examples that follow likewise comprises the VH and VL amino acid sequences of SEQ ID NO: 5 and SEQ ID NO: 6 as provided in Table 2.
Example 1: Anti-DR5 IgM and Irinotecan Combination Induces More Complete Tumor Cytotoxicity In Vitro
[0188] The in vitro efficacy of anti-DR5 IgM and Irinotecan combination therapy was assessed as follows. HCT15 tumor cells (210.sup.3 cells) were seeded and allowed to attach overnight. In the first experiment, cells were treated with Anti-DR5 IgM Mab #2 or Anti-DR5 IgM Mab #2 plus 0.4 M of Irinotecan (Sigma 11406) for 72 hours at 37 C. Cell Titer Glo reagent (Promega G7572) was added and cell viability was read on a luminometer. The results are shown in
Example 2: Anti-DR5 IgM and Irinotecan Combination Provides Significantly Enhanced Efficacy In Vivo
[0189] Combination therapy with an anti-DR5 IgM antibody and standard of care Irinotecan was assessed in an HCT15 tumor model as follows.
[0190] In the first experiment, anti-DR5 IgG, anti-DR5 IgM, and Irinotecan monotherapies were compared. Athymic nude mice were subcutaneously implanted with 110.sup.7 HCT15 tumor cells. When the tumors reached 150-200 mm.sup.3, the animals were dosed intravenously with either vehicle 5 times daily, 3 mg/kg of anti-DR5 IgG 3 times weekly, 3 mg/kg of anti-DR5 IgM Mab #2 5 times daily, or 80 mg/kg of Irinotecan (Sigma 11406) 3 times within the first week. Tumor volume (n=10 animals/group) is shown in
[0191] The second experiment demonstrates that combination therapy with an anti-DR5 IgG and Irinotecan provided little enhanced efficacy. Athymic nude mice were subcutaneously implanted with 110.sup.7 HCT15 tumor cells. When the tumors reached 150-200 mm.sup.3, the animals were dosed intravenously with either vehicle 5 times daily, 3 mg/kg of anti-DR5 IgG 3 times weekly, 80 mg/kg of Irinotecan (Sigma 11406) 3 times within the first week, or the combined anti-DR5 IgG and Irinotecan dosing regimens. Tumor volume (n=10 animals/group) is shown in
[0192] The third experiment demonstrates that combination therapy with an anti-DR5 IgM and Irinotecan can provide significant enhancement over standard of care. Athymic nude mice were subcutaneously implanted with 110.sup.7 HCT15 tumor cells. When the tumors reached 150-200 mm.sup.3, the animals were dosed intravenously with either vehicle 5 times daily, 3 mg/kg of anti-DR5 IgM 5 times daily, 80 mg/kg of Irinotecan (Sigma I1406) 3 times within the first week, or the combined anti-DR5 IgM and Irinotecan dosing regimens. Tumor volume (n=10 animals/group) is shown in
Example 3: Anti-DR5 IgM and Gemcitabine Combination Induces More Complete Pancreatic Tumor Cell Cytotoxicity In Vitro than Gemcitabine Alone
[0193] The in vitro potency of anti-DR5 IgM and Gemcitabine combination therapy in pancreatic tumor cell lines was assessed as follows. In the first experiment, 610.sup.3 BxPC3 tumor cells (ATCC CRL-1687) were seeded and allowed to attach overnight. Cells were treated with 4 ng/mL of anti-DR5 IgM Mab #5 (VH: SEQ ID NO: 7, VL SEQ ID NO: 8), 0.56 M of Gemcitabine, or a combination of the two agents for 72 hours at 37 C. Cell Titer Glo reagent (Promega G7572) was added and cell viability was read on a luminometer. The results are shown in
Example 4: Anti-DR5 IgM and Gemcitabine Combination Provides Enhanced Efficacy in an In Vivo Pancreatic Tumor Xenograft Model than Either Agent Alone or Combination Therapy with Anti-DR5 IgG
[0194] Combination therapy with an anti-DR5 IgM antibody and standard of care Gemcitabine was assessed in a BxPC3 pancreatic tumor model as follows.
[0195] In the first experiment, nude mice were implanted subcutaneously with BxPC3 pancreatic tumor fragments. When the tumors reached 100-150 mm3, animals were dosed with either vehicle 7 times daily i.v., a single 3 mg/kg dose of anti-DR5 IgG Mab #2 i.v., 120 mg/kg of Gemcitabine every 3 days for a total of 4 doses i.p., or a combination of the anti-DR5 IgG and Gemcitabine dosing regimens. Tumor volume (n=9-10 animals/group) is shown in
Example 5: Anti-DR5 IgM and Venetoclax (ABT-199) Combination Treatment Induces More Complete Cell Cytotoxicity In Vitro than Venetoclax Alone
[0196] The in vitro potency of anti-DR5 IgM and Venetoclax combination treatment of AML cell lines was assessed as follows. In the first experiment, 310.sup.3 Molm-13 tumor cells (DSMZ ACC 554) were seeded and the next day cells were treated with 1.2 ng/mL of anti-DR5 IgM Mab #5, 3.7 nM of Venetoclax, or a combination of the two agents. After 72 hours at 37 C., Cell Titer Glo reagent (Promega G7572) was added and cell viability was read on a luminometer. The results are shown in