CELL/TISSUE-SPECIFIC CELL-PENETRATING ANTIBODIES
20200385428 ยท 2020-12-10
Assignee
Inventors
- Yong Sung Kim (Suwon, KR)
- Ji Sun KIM (Go-yang, KR)
- Jae Yeong PARK (Suwon, KR)
- Seong Wook PARK (Suwon, KR)
- Sei Yong JUN (Paju, KR)
- Dong-Ki CHOI (Daejeon, KR)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C07K2319/035
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K7/64
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
Presented herein are cyclic peptides that specifically bind to a cell surface molecule, thereby allowing cell/tissue-specific targeting. The cyclic peptides can be attached to an agent, for example, a polypeptide such as an antibody, e.g., a cell-penetrating antibody. Cyclic peptide-containing cell/tissue-specific cell-penetrating antibodies described herein are capable of targeted delivery in a cell type-specific or tissue-specific (i.e., cell/tissue-specific) manner. The cell/tissue-specific cell-penetrating antibodies described herein can be used as an effective anticancer agent for cancer that overexpresses a cell membrane protein that specifically binds to the fused cyclic peptides.
Claims
1. A cell/tissue-specific cell-penetrating antibody comprising a light chain comprising a light chain variable region (VL), a heavy chain comprising a heavy chain variable region (VH), and a cyclic peptide that specifically binds to a cell surface molecule.
2. The antibody of claim 1, wherein the cell surface molecule is selected from the group consisting of cell membrane protein epithelial cell adhesion molecule (EpCAM), integrin v5, integrin v3, integrin v6, and epidermal growth factor receptor (EGFR).
3. The antibody of claim 1, wherein the amino acid sequence of the cyclic peptide comprises: TABLE-US-00023 (SEQIDNO:110) X1-X2-Leu-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser.
4. The antibody of claim 3, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 14 to 20 and 29 to 37.
5. The antibody of claim 4, wherein the cyclic peptide is fused to the light chain and comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 22 to 28 and 38 to 48.
6. The antibody of claim 1, wherein the amino acid sequence of the cyclic peptide comprises: TABLE-US-00024 (SEQIDNO:100) Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11- X12-X13-X14-X15 wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser.
7. The antibody of claim 6, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57.
8. The antibody of claim 7, wherein the cyclic peptide fused to the light chain comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 59 to 66.
9. The antibody of claim 1, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 73 to 76 and 78 to 85.
10. The antibody of claim 9, wherein the cyclic peptide fused to the light chain comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 86 to 89 and 91 to 98.
11. The antibody of claim 1, wherein the antibody is of full-length immunoglobulin format.
12. The antibody of claim 11 comprising an endosomal escape motif in the light chain variable region (VL) and/or the heavy chain variable region (VH) of the antibody, wherein the endosomal escape motif induces penetration of the antibody into the cytosol of the cell.
13. The antibody of claim 12, wherein the VL comprises a complementarity determining region (CDR) 1, CDR2, and CDR3, and the VH comprises a CDR1, CDR2, and CDR3, and wherein acid sequence of the endosomal escape motif comprises: 1) Trp-Tyr-Trp-X (SEQ ID NO: 69) CDR3 of VL and/or VH, wherein X is selected from the group consisting of methionine (Met), isoleucine (Ile), and leucine (Leu); and 2) aspartic acid (Asp) or glutamic acid (Glu) as the first amino acid VL and/or VH.
14. The antibody of claim 13, wherein affinity of the antibody for heparan sulfate proteoglycan (HSPG) is reduced or abolished.
15. The antibody of claim 13, wherein the light chain variable region (VL) comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 8.
16. The antibody of claim 13, wherein the heavy chain variable region (VH) of the antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 11 and 12.
17. The antibody of claim 13, wherein the light chain variable region (VL) of the antibody comprises an amino acid sequence represented by SEQ ID NO: 8, and the heavy chain variable region (VH) of the antibody comprises an amino acid sequence represented by SEQ ID NO: 12.
18. A cyclic peptide comprising: TABLE-US-00025 (SEQIDNO:110) X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser, wherein the cyclic peptide specifically binds to EpCAM.
19. The cyclic peptide of claim 18, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 14 to 20 and 29 to 37.
20. A cyclic peptide comprising: TABLE-US-00026 (SEQIDNO:100) Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11- X12-X13-X14-X15 wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser, wherein the cyclic peptide specifically binds v5 or v3 integrin.
21. The cyclic peptide of claim 20, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57.
22. A cyclic peptide of the amino acid sequence selected from the group consisting of SEQ ID NOs: 73 to 76 and 78 to 85.
23. A polypeptide comprising the cyclic peptide of claim 18.
24. A polypeptide comprising the cyclic peptide of claim 20.
25. A polypeptide comprising the cyclic peptide of claim 22.
26. A polynucleotide encoding the cell/tissue-specific cell-penetrating antibody of claim 1.
27. A method of making a cell/tissue-specific cell-penetrating antibody comprising: introducing a vector comprising the polynucleotide of claim 26 into a host cell; expressing the vector in the host cell; and recovering the expressed antibody.
28. A pharmaceutical composition comprising the cell/tissue-specific cell-penetrating antibody of claim 1 as an active ingredient and a pharmaceutically acceptable carrier.
29. A method of preventing or treating a disease or condition in a subject comprising administering a therapeutically effective amount of the cell/tissue-specific cell-penetrating antibody of claim 1 to the subject.
30. The method of claim 29, wherein a disease or condition is a cancer.
Description
4. BRIEF DESCRIPTION OF THE DRAWINGS
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
5. DETAILED DESCRIPTION
5.1 Terminology and Abbreviations
[0095] It is noted that technical terms used in the present invention are used to describe a specific embodiment and do not intend to limit the present invention. Further, if the technical terms used in the present invention are not particularly defined as other meanings in the present invention, the technical terms should be appreciated as meanings generally appreciated by those skilled in the art and should not be appreciated as excessively comprehensive meanings or excessively reduced meanings. In addition, a general term used in the present invention should be interpreted as defined in a dictionary or contextually and should not be interpreted as an excessively reduced meaning.
[0096] In addition, singular expressions used in the present invention include plurals expressions unless they have definitely opposite meanings. Terms including ordinal numbers, such as first and second, used in the present invention can be used to describe various components, but the components should not be limited by the terms. The above terms are used only to discriminate one component from the other components. For example, a first component may be named a second component and similarly, the second component may also be named the first component, without departing from the scope of the present invention.
[0097] Further, in the following description, a detailed explanation of known related technologies may be omitted to avoid unnecessarily obscuring the subject matter of the present invention. It is noted that the accompanying drawings are only for easily understanding the spirit of the present invention and it should not be interpreted that the spirit of the present invention is limited by the accompanying drawings. Hereinafter, the present invention is described in detail with accompanying Examples. However, these Examples are only for illustrative purposes and the scope of the present invention is not limited by these Examples.
[0098] Terms such as cell/tissue specific or cell/tissue-specific as used herein in the context of binding to, or targeting, refer to a selective or preferential binding to, or targeting by, an agent, for example, a polypeptide, to a cell/tissue at a higher level than to non-targeted cells/tissues. In some embodiments, an agent, for example, a polypeptide, exhibits an increased interaction with proteins or polypeptides on specific cells/tissues and/or localization to specific cells/tissues. In certain embodiments, the preferential binding or targeting is to an abnormal or diseased cell or tissue, e.g., a cell or tissue of cancer, immunological disease, or neurological disease, relative to the binding or targeting to the normal or non-diseased counterpart of the cell or tissue.
[0099] The term interact as used herein is meant to include interactions between molecules, such as can be detected using, for example, a yeast two hybrid assay. The term interact is also meant to include binding interactions between molecules (e.g., proteins, nucleic acids, protein fusions, peptides, glycoproteins, etc.).
[0100] The term fusion protein or fusion polypeptide as used herein refers to two or more separate amino acid sequences linked via a peptide bond or via a linker.
[0101] The term linker or linker region as used herein refers to a linker inserted between a first amino acid sequence and a second amino acid sequence. In some embodiments, the linker is a peptide linker. In one embodiment, linkers are not antigenic and do not elicit an immune response.
[0102] The term antibody is a well-known term of art, and, as used herein refers to an immunoglobulin molecule that recognizes and specifically binds to an antigen, such as, for example, a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or a combination of any of the foregoing, through at least one antigen-binding site wherein the antigen-binding site is usually within the variable region of the immunoglobulin molecule. As used herein, the term antibody encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab, F(ab)2, and Fv fragments), single-chain Fv (scFv) antibodies, multispecific antibodies, bispecific antibodies, monospecific antibodies, monovalent antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen-binding site of an antibody, and any other modified immunoglobulin molecule comprising an antigen-binding site (e.g., dual variable domain immunoglobulin molecules). In certain embodiments, an antibody can comprise a constant domain. In particular embodiments, such an antibody can belong to any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. In particular embodiments, such an antibody can belong to any of the two major classes of light chain immunoglobulins and . Antibodies can be naked or conjugated to other molecules, including but not limited to, toxins and radioisotopes.
[0103] The term intact immunoglobulin format or full-length immunoglobulin format as used herein means an antibody that has a structure with two full-length light chains and two full-length heavy chains, with each light chain linked to each heavy chain by a disulfide bond (SS-bond). In certain embodiments, a constant region of the antibody is divided into a heavy-chain constant region and a light-chain constant region, and the heavy-chain constant region has , , , , and types, and 1, 2, 3, 4, 1 and 2 subclasses while the light-chain constant region has and types.
[0104] The term antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab, F(ab)2, and Fv fragments, linear antibodies, single-chain antibodies, and multispecific antibodies formed from antibody fragments. Antibody fragment as used herein comprises an antigen-binding site or epitope-binding site.
[0105] The term variable region of an antibody refers to the variable region of an antibody light chain, or the variable region of an antibody heavy chain, either alone or in combination. Generally, the variable region of heavy and light chains each consist of four framework regions (FR) and three complementarity determining regions (CDRs), also known as hypervariable regions. The CDRs in each chain are held together in close proximity by the framework regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding sites of the antibody. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability, (Kabat, Wu, Foeller, Perry, & Gottesman, 1991)), and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-Lazikani, Lesk, & Chothia, 1997). In addition, combinations of these two approaches are sometimes used in the art to determine CDRs.
[0106] The term monoclonal antibody as used herein refers to a homogenous antibody population involved in the highly specific recognition and binding of a single antigenic determinant or epitope. This is in contrast to polyclonal antibodies that typically include a mixture of different antibodies directed against different antigenic determinants. The term monoclonal antibody encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (e.g., Fab, Fab, F(ab)2, Fv), single-chain (scFv) antibodies, fusion proteins comprising an antibody fragment, and any other modified immunoglobulin molecule comprising an antigen-binding site. Furthermore, monoclonal antibody refers to such antibodies made by any number of techniques, including but not limited to, hybridoma production, phage selection, recombinant expression, and transgenic animals.
[0107] The terms selectively binds or specifically binds mean that a polypeptide or molecule interacts more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including related and unrelated proteins. In certain embodiments specifically binds means, for instance, that a polypeptide or molecule binds a protein or target with a KD of about 0.1 mM or less, but more usually less than about 1 M. In certain embodiments, specifically binds means that a polypeptide or molecule binds a target with a KD of at least about 0.1 M or less, at least about 0.01 M or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include a polypeptide or molecule that recognizes a protein or target in more than one species. Likewise, because of homology within certain regions of polypeptide sequences of different proteins, specific binding can include a polypeptide or molecule that recognizes more than one protein or target. It is understood that, in certain embodiments, a polypeptide or molecule that specifically binds a first target may or may not specifically bind a second target. As such, specific binding does not necessarily require (although it can include) exclusive binding, i.e., binding to a single target. Thus, a polypeptide or molecule may, in certain embodiments, specifically bind more than one target. In certain embodiments, multiple targets may be bound by the same antigen-binding site on the polypeptide or molecule. For example, an antibody may, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins. In certain alternative embodiments, an antibody may be bispecific and comprise at least two antigen-binding sites with differing specificities. Generally, but not necessarily, reference to binding means specific binding.
[0108] The terms identical or percent identity in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity may be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that may be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variants thereof. In some embodiments, two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection. In some embodiments, identity exists over a region of the amino acid sequences that is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues in length or any integral value there between. In some embodiments, identity exists over a longer region than 60-80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a target protein or an antibody. In some embodiments, identity exists over a region of the nucleotide sequences that is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases in length or any integral value there between. In some embodiments, identity exists over a longer region than 60-80 bases, such as at least about 80-1000 bases or more, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as a nucleotide sequence encoding a protein of interest.
[0109] A conservative amino acid substitution is one in which one amino acid residue is replaced with another amino acid residue having a side chain with similar chemical characteristics. Families of amino acid residues having similar side chains have been generally defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). For example, substitution of a phenylalanine for a tyrosine is a conservative substitution. Generally, conservative substitutions in the sequences of the polypeptides, soluble proteins, and/or antibodies of the invention do not abrogate the binding of the polypeptide, soluble protein, or antibody containing the amino acid sequence, to the target binding site. Methods of identifying amino acid conservative substitutions which do not eliminate binding are well-known in the art.
[0110] The term heavy chain as used herein can include a full-length heavy chain including variable region domain VH including an amino acid sequence having a variable region sequence sufficient to confer antigen-specificity and three constant region domains CH1, CH2 and CH3, and a fragment thereof. Also, the term light chain as used herein can include a full-length light chain including a variable region domain VL including an amino acid sequence having a variable region sequence sufficient to confer antigen-specificity and a constant region domain CL, and a fragment thereof.
[0111] A polypeptide, soluble protein, antibody, polynucleotide, vector, cell, or composition which is isolated is a polypeptide, soluble protein, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, soluble proteins, antibodies, polynucleotides, vectors, cells, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some embodiments, a polypeptide, soluble protein, antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
[0112] The term subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, rodents, and the like, which is to be the recipient of a particular treatment. Typically, the terms subject and patient are used interchangeably herein in reference to a human subject.
[0113] The term pharmaceutically acceptable refers to a substance approved or approvable by a regulatory agency of the Federal government or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
[0114] The terms pharmaceutically acceptable excipient, carrier or adjuvant or acceptable pharmaceutical carrier refer to an excipient, carrier or adjuvant that can be administered to a subject, together with at least one agent of the present disclosure, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic effect. In general, those of skill in the art and the U.S. FDA consider a pharmaceutically acceptable excipient, carrier, or adjuvant to be an inactive ingredient of any formulation.
[0115] The terms effective amount or therapeutically effective amount or therapeutic effect refer to an amount of a polypeptide or molecule described herein (e.g., a fusion protein, a soluble ligand, an antibody, a polypeptide, a polynucleotide, a small organic molecule, or other drug) effective to treat a disease or disorder in a subject such as, a mammal. In the case of cancer or a tumor, the therapeutically effective amount of a polypeptide or molecule (e.g., polypeptide, soluble protein, or antibody) has a therapeutic effect and as such can boost the immune response, boost the anti-tumor response, increase cytolytic activity of immune cells, increase killing of tumor cells by immune cells, reduce the number of tumor cells; decrease tumorigenicity, tumorigenic frequency or tumorigenic capacity; reduce the number or frequency of cancer stem cells; reduce the tumor size; reduce the cancer cell population; inhibit or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor or cancer cell metastasis; inhibit and stop tumor or cancer cell growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; or a combination of such effects.
[0116] The terms treating or to treat refer to suppressing, eliminating, reducing, and/or ameliorating a symptom, the severity of the symptom, and/or the frequency of the symptom of the disease being treated.
5.2 Cyclic Peptides
[0117] The present disclosure is based at least in part on the recognition that cyclic peptides are capable of selectively targeting specific proteins. When attached to an agent, for example, a small molecule or a polypeptide, e.g., an antibody, such cyclic peptides are able to more selectively target the agent, for example, polypeptide, e.g. antibody, to certain cells/tissues. The present disclosure is based in part on the generation of cyclic peptides able to selectively target cell membrane proteins in a cell-specific and tissue-specific manner. In some embodiments, a cyclic peptide disclosed herein targets a cell membrane protein (e.g., EpCAM, integrin v5, etc.), thereby selectively targeting cells/tissues exhibiting, e.g., expressing or overexpressing, the cell membrane protein. In some embodiments, a cyclic peptide disclosed herein targets a cell membrane protein (e.g., EpCAM) on cells exhibiting, (e.g., expressing or overexpressing) the cell membrane protein and does not target cells that do not exhibit (e.g., express or overexpress) the membrane protein, or exhibit or express the membrane protein at lower levels, thereby selectively targeting specific cells/tissues. In some embodiments, a cyclic peptide disclosed herein does not selectively target (e.g., has a low affinity for) a cell membrane protein that is not specific to a cell-type or tissue type (e.g., a cell or tissue of cancer, immunological disease, or neurological disease). As a non-limiting example, a cyclic peptide disclosed herein can have a lower affinity for a non-specific, broadly expressed protein (e.g., HSPG).
[0118] The present disclosure is based at least in part on the recognition that the cyclic peptide ep133 exhibits reduced in vivo affinity for EpCAM expressed on the surface of cells compared to its in vitro affinity towards purified EpCAM (see Example 17). In some embodiments, provided herein are methods of screening (e.g., mutagenically screening) cyclic peptides in order to identify cyclic peptides with one or more desirable properties, e.g., higher in vivo affinity. In some embodiments, an agent disclosed herein (e.g., a cyclic peptide) can selectively target cells/tissues (e.g., efficient tumor tissue-specificity for enhancing the EpCAM-targeting affinity). In some embodiments, cyclic peptides provided herein are identified in a mutagenesis screen and exhibit enhanced and/or improved binding affinity for a target (e.g., a protein or an extracellular domain of a protein).
[0119] In certain embodiments, a cyclic peptide described herein is attached to an agent, for example, a polypeptide (e.g., an antibody), and is fused to the agent. In a particular embodiment, the cyclic peptide is directed fused to the agent via a peptide bond. In another particular embodiment, the cyclic peptide is fused to the agent via a linker, for example, a peptide linker, e.g., a MGSSSN linker (SEQ ID NO: 102), a (G.sub.4S).sub.2 linker (SEQ ID NO: 101). In certain embodiments, a cyclic peptide described herein that is attached to an agent, for example, a polypeptide, e.g., an antibody, is conjugated to the agent. In a particular embodiment, the cyclic peptide is directed conjugated to the agent directly. In another particular embodiment, the cyclic peptide is conjugated to the agent via a linker.
[0120] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-Ser (SEQ ID NO: 99); wherein X1 is any one of Glu, His, Asp and Lys; X2 is any one of His and Asn; X4 is any one of His, Leu, Gln, and Arg; X6 is any one of Leu and Ile; X8 is any one of Ser and Asn; and X9 is any one of Leu and Ile.
[0121] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 (SEQ ID NO: 110); wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser.
[0122] In certain embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-Ser (SEQ ID NO: 99); wherein X1 is any one of Glu, His, Asp and Lys; X2 is any one of His and Asn; X4 is any one of His, Leu, Gln, and Arg; X6 is any one of Leu and Ile; X8 is any one of Ser and Asn; and X9 is any one of Leu and Ile; and wherein cyclic peptide comprises a disulfide bond between Cys5 and Cys10.
[0123] In certain embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 (SEQ ID NO: 110); wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser, and wherein cyclic peptide comprises a disulfide bond between Cys5 and Cys10.
[0124] Further, in some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-Ser (SEQ ID NO: 99); wherein X1 is any one of Glu, His, Asp and Lys; X2 is any one of His and Asn; X4 is any one of His, Leu, Gln and Arg; X6 is any one of Leu and Ile; X8 is any one of Ser and Asn; and X9 is any one of Leu and Ile; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 29 to 37.
[0125] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 (SEQ ID NO: 110); wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 29 to 37.
[0126] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-Ser (SEQ ID NO: 99); wherein X1 is any one of Glu, His, Asp and Lys; X2 is any one of His and Asn; X4 is any one of His, Leu, Gln, and Arg; X6 is any one of Leu and Ile; X8 is any one of Ser and Asn; and X9 is any one of Leu and Ile; and wherein cyclic peptide comprises a disulfide bond between Cys5 and Cys10; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 29 to 37.
[0127] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 (SEQ ID NO: 110); wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser; and wherein cyclic peptide comprises a disulfide bond between Cys5 and Cys10; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 29 to 37.
[0128] In certain embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-Ser (SEQ ID NO: 99); wherein X1 is any one of Glu, His, Asp and Lys; X2 is any one of His and Asn; X4 is any one of His, Leu, Gln, and Arg; X6 is any one of Leu and Ile; X8 is any one of Ser and Asn; and X9 is any one of Leu and Ile; and wherein cyclic peptide comprises a disulfide bond between Cys5 and Cys10; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 29 to 37; and wherein the amino acid sequence of the cyclic peptide fused or conjugated to the light chain is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48.
[0129] In certain embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 (SEQ ID NO: 110); wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser; and wherein cyclic peptide comprises a disulfide bond between Cys5 and Cys10; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 29 to 37; and wherein the amino acid sequence of the cyclic peptide fused or conjugated to the light chain is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48.
[0130] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100); wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser.
[0131] In some embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100); wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser; and wherein the cyclic peptide comprises a disulfide bond between Cys6 and Cys10.
[0132] Further, in certain embodiments, provided herein is a cyclic peptide wherein the amino acid sequence of the cyclic peptide comprises: Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100); wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser; and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57.
[0133] In some embodiments, a cyclic peptide described herein comprises SEQ ID NO: 13, 14, 15, 16, 17, 18, 219, or 20.
[0134] In some embodiments, a cyclic peptide disclosed herein comprises a disulfide bond. In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's affinity for one or more proteins (e.g., to increase or decrease affinity). In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's targeting of one or more proteins. In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's aggregation in certain environments (e.g., inside a cell). In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's hydrophobicity in certain environments (e.g., inside a cell). In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's conformation in certain environments (e.g., inside a cell, inside an endosome, and/or inside the cytosol, etc.). In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's resistance to one or more proteolytic enzymes in certain environments (e.g., inside a cell, inside an endosome, and/or inside the cytosol, etc.). In some embodiments, a cyclic peptide disclosed herein has been modified to change the cyclic peptide's structural stability in certain environments (e.g., inside a cell, inside an endosome, and/or inside the cytosol, etc.).
[0135] In some embodiments, a cyclic peptide disclosed herein is modified such that it exhibits a desired change in its affinity for more than one protein (e.g., a decrease in binding to HSPG and an increase in binding to EpCAM).
[0136] In certain aspects, provided herein are methods of targeting specific cells and/or tissues with a cyclic peptide disclosed herein in order to treat a disease, such as cancer, immunological disease, or neurological disease. In some embodiments, a cyclic peptide disclosed herein targets a cell surface protein on a cell or tissue of cancer, immunological disease, or neurological disease.
5.3 Cell/Tissue Specificity
5.3.1 Cell Specificity
[0137] In some embodiments, a cyclic peptide disclosed herein targets one or more specific molecules, for example, receptors (e.g., proteins, peptides, molecules, and/or glycoproteins) on a cell surface. In some embodiments, a cyclic peptide disclosed herein does not interact with and/or target cells that do not exhibit, e.g., express or overexpress, the one or more specific molecules, for example, receptors (e.g., proteins, peptides, molecules, and/or glycoproteins) on a cell surface. In certain embodiments, the molecule, e.g., receptor, is a cell membrane protein, for example, an integral membrane protein (IMP), lipid-anchored protein (LAP), or peripheral membrane protein (PMP), depending on how the protein is distributed in the membrane. Cell-specific molecules, for example, receptors, within target cells and/or target tissues can readily be identified using methods known in the art such as, for example, immunohistochemical analyses, e.g., immunohistochemical analyses of tumor biopsies.
[0138] As a non-limiting example, in some embodiments, a cyclic peptide disclosed herein can preferentially or selectively target cells within a tumor (e.g., cells expressing or overexpressing a tumor-associated antigen on the cell surface) by interacting with a tumor-associated cell surface antigen (TAA), relative to non-tumor cells not exhibiting, or exhibiting or expressing lower amounts of, a tumor-associated antigen on the cell surface. In certain embodiments, a specific receptor is selectively expressed or overexpressed in the target cells compared to the non-target cells. In certain embodiments, the specific receptor is not expressed or expressed at lower levels in the non-target cells compared to the target cells.
[0139] As another non-limiting example, a cyclic peptide disclosed herein can specifically target an immune cell by interacting with a cell surface molecule present on the immune cell. As a non-limiting example, such an immune cell can, for example, be a dendritic cell and can, for example, exhibit, e.g., express or overexpress, such cell surface molecules as, for example, DEC-205 (Lymphocyte antigen 75, CD205), DC-SIGN (dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin, CD209), BDCA-2 (CLEC4C DC-specific type II C-type lectin), Langerin (CD207), CLEC9A (group V C-type lectin-like receptor).
[0140] In another non-limiting example, a cyclic peptide disclosed herein can selectively target an immune cell by interacting with a cell surface molecule present on the immune cell, wherein the immune cell is a T cell that, for example, exhibits, e.g., expresses or overexpresses, such cell surface molecules as, for example, a checkpoint inhibitor molecule, including for example, programmed cell death protein 1 (PD1), TIM3, LAG3, VISTA, or PDL1, CD3, or a T cell receptor (TCR). In yet another non-limiting example, a cyclic peptide disclosed herein can specifically target an immune cell by interacting with a cell surface molecule present on the immune cell, wherein the immune cell is a B cell that, for example, exhibits, e.g., expresses or overexpresses, such cell surface molecules as, for example, CD19 or CD20.
[0141] In still another non-limiting example, a cyclic peptide disclosed herein can specifically target an immune cell by interacting with a cell surface molecule present on the immune cell, wherein the immune cell is an innate immune cell that, for example, exhibits, e.g., expresses or overexpresses, such cell surface molecules as, for example, a pathogen recognition receptor (PRR) such as a Toll-like receptor (TLR), or a C-type lectin receptor (CLR).
[0142] In certain embodiments, as a non-limiting example, a cyclic peptide described herein binds to epithelial cell adhesion molecule (EpCAM), which is known to be a targeted marker expressed on the surface of cancer cells. In another specific non-limiting example, a cyclic peptide described herein binds to an integrin comprising a heterodimer of subunit and subunit, which is present on the surface of a cell, and which plays a role in mediating cell-to-cell and/or cell-to-extracellular matrix interactions. In a non-limiting example, such an integrin can be integrin v5 or integrin v3. In certain embodiments, a cyclic peptide described herein binds to epidermal growth factor receptor (EGFR). In certain embodiments, as a further non-limiting example, a cyclic peptide described herein that binds to any such cell surface molecule is fused to an antibody, for example, a cell/tissue specific or cell-penetrating antibody, as described herein.
5.3.2 Cell-Type Specificity and Microenvironment Specificity
[0143] In certain embodiments, a cyclic peptide disclosed herein can target specific types of cells (e.g., cardiac cells, endothelial cells, dendritic cells, etc.). In some embodiments, a cyclic peptide disclosed herein can target specific receptors on cells within a target microenvironment. In certain embodiments, the target microenvironment can be a tumor microenvironment (TME). For example, cancer tissues are composed of cancer cells and the surrounding stromal cells (e.g., fibroblasts, vascular endothelial cells, and immune cells), in addition to the extracellular matrix. In some embodiments, a cyclic peptide disclosed herein target specific receptors on cells within a tumor microenvironment. Non-limiting examples of target microenvironment components that can be specifically targeted by a cyclic peptide disclosed herein is tumor vasculature (e.g., the extra domain B of fibronectin) or cancer-associated fibroblasts (CAFs). In some embodiments, a cyclic peptide disclosed herein can target specific receptors within a target microenvironment that are not cancer-associated fibroblasts (CAFs).
5.3.3 Tissue Specificity
[0144] Further provided herein are cyclic peptides that exhibit tissue specificity. In some embodiments, a cyclic peptide disclosed herein targets one or more specific receptors (e.g., proteins, peptides, molecules, and/or glycoproteins) on the surface of cells within a targeted tissue. In some embodiments, a cyclic peptide disclosed herein does not interact with and/or target one or more specific receptors (e.g., proteins, peptides, molecules, and/or glycoproteins) on a the surface of cells within a non-targeted tissue. As a non-limiting example, in some embodiments, a cyclic peptide disclosed herein can preferentially or selectively target cells within a tumor tissue (e.g., cells expressing a tumor-associated antigen on the cell surface) by interacting with the tumor-associated antigen relative to non-tumor cells not exhibiting, or exhibiting or expressing lower amounts of, a tumor-associated antigen on the cell surface. In another non-limiting example, in some embodiments, a cyclic peptide disclosed herein can specifically target cells within a tumor (e.g., cells expressing a tumor-associated antigen on the cell surface) by interacting with the tumor-associated antigen, while the cyclic peptide does not target non-tumor cells. In certain embodiments, the specific receptor is selectively expressed or overexpressed in the target cells compared to the non-target cells. In certain embodiments, the specific receptor is not expressed or expressed at lower levels in the non-target cells compared to the target cells.
5.3.4 Tumor Tissue-Specific Membrane Proteins
[0145] Tumor tissue-specific membrane proteins refer to membrane proteins that are preferentially present on tumor cells or tissues. In one example, such proteins may not be expressed in normal (e.g. non-tumor) tissues or cells. In another example, such proteins can be overexpressed in tumor tissue or tumor cells relative to normal tissue or cells. In certain embodiments, for example, such proteins can be expressed at 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or higher levels relative to non-tumor tissues or cells. Thus, when antibodies or drugs are delivered by targeting them, the adverse effect induced by the drug delivery to normal tissues may be significantly reduced. Non-limiting examples of tumor cells or tissues include cells or tissues of solid cancers such as, for example, stomach cancer, colon cancer and pancreatic cancer, or cells of blood cancers such as, for example, lymphomas or myelomas.
[0146] In certain embodiments, non-limiting examples of proteins which are overexpressed or expressed on the surface of solid tumor cells and/or tissues and can be targeted by a cyclic peptide disclosed herein include epithelial cell adhesion protein (EpCAM), integrin v5, integrin v6, integrin v3, an epidermal growth factor receptor (EGFR), human epidermal growth factor receptor 2 (Her2), vascular endothelial growth factor receptor 2 (VEGFR2), fibroblast growth factor receptor (FGFR), hepatocyte growth factor receptor (c-Met), neuropilin (NRP) (HGFR), Mesothelin, insulin-like growth factor I receptor (IGF1R), programmed cell death protein ligand 1 (PD-L1), cytotoxic T lymphocyte protein 4 (CTLA4), disialoganglioside (GD2), platelet-derived growth factor receptor- (PDGFRa), cancer testes antigen family, carcinoembryonic antigen (CEA), or NY-ESO-1.
[0147] In some embodiments, a non-limiting list of membrane proteins which are overexpressed on the cell surface of blood tumors such as leukemia and lymphoma and can be targeting by a cyclic peptide disclosed herein include cluster of differentiation 19 (CD19), CD20, CD22, CD30, CD33, CD38, or CC-chemokine receptor 4 (CCR4).
5.4 Cyclic Peptide-Fused Antibodies
[0148] In certain embodiments, provided herein is a cell/tissue-specific cell-penetrating antibody comprising a light chain comprising a light chain variable region (VL), a heavy chain comprising a heavy chain variable region (VH), and a cyclic peptide that specifically binds to a cell surface molecule.
[0149] In some embodiments, an agent described herein, e.g., a cell/tissue-specific cell-penetrating antibody, comprises one or more endosome escape motifs. In some embodiments, upon binding of the cyclic peptide fused with an antibody of intact full-length immunoglobulin format to targeted cell membrane protein receptors, the cyclic peptide-fused antibody is internalized into cells via endosomes through an endocytic pathway, and once inside the cell, the cyclic peptide-fused antibody exploits one or more endosome escape motifs to reach the cytosol.
[0150] In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a light chain comprising a light chain variable region (VL) and a heavy chain comprising a heavy chain variable region (VH). In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein specifically binds to a cell surface molecule. In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a light chain and a heavy chain wherein the light chain and the heavy chain are separate molecules. In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a light chain and a heavy chain wherein the light chain and the heavy chain are part of the same molecule.
[0151] In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a cyclic peptide fused to an antibody. In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a cyclic peptide is directed fused to an antibody. In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a cyclic peptide is fused to an antibody via a peptide linker. In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a cyclic peptide is directed conjugated to the antibody. In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein comprises a cyclic peptide is conjugated to the antibody via a linker.
[0152] In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the light chain or heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the N-terminus or the C-terminus of the light chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the light chain or heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the N-terminus or the C-terminus of the heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the light chain and a cyclic peptide fused to the heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the N terminus of the light chain and the heavy chain of the antibody.
[0153] In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the C-terminus of the light chain and the heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the C-terminus of the light chain or the heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the N-terminus of the light chain or the heavy chain of the antibody. In some embodiments, an antibody disclosed herein comprises a cyclic peptide fused to the C-terminus of the light chain or the heavy chain of the antibody.
[0154] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein specifically binds to a cell surface molecule, wherein the cell surface molecule is a membrane protein selectively expressed on the surface of a cell or tissue. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein specifically binds to a cell surface molecule, wherein the cell surface molecule is a membrane protein selectively expressed on the surface of a cell. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein specifically binds to a cell surface molecule, wherein the cell surface molecule is a membrane protein selectively expressed on the surface of a tissue.
[0155] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein specifically binds to a cell surface molecule, wherein the cell surface molecule is selected from the group consisting of cell membrane protein epithelial cell adhesion molecule (EpCAM), integrin v5, integrin v3, and epidermal growth factor receptor (EGFR).
[0156] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a cyclic peptide that comprises a disulfide bond.
[0157] In some embodiments, a cyclic peptide disclosed herein comprises an amino acid sequence X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-Ser (SEQ ID NO: 99), wherein X1 is any one of Glu, His, Asp and Lys; X2 is any one of His and Asn; X4 is any one of His, Leu, Gln, and Arg; X6 is any one of Leu and Ile; X8 is any one of Ser and Asn; and X9 is any one of Leu and Ile.
[0158] In some embodiments, a cyclic peptide disclosed herein comprises an amino acid sequence X1-X2-Leu3-X4-Cys5-X6-Gly-X8-X9-Cys10-Trp-X12 (SEQ ID NO: 110), wherein X1 is any one of Glu, His, Asp, Lys, Asn, and Arg; X2 is any one of His, Asn, and Gly; X4 is any one of His, Leu, Gln, Arg, and Trp; X6 is any one of Leu and Ile; X8 is any one of Ser, Asn, and Arg; X9 is any one of Leu and Ile; and X12 is any one of Pro and Ser.
[0159] In some embodiments, a cyclic peptide disclosed herein comprises a disulfide bond between Cys5 and Cys10.
[0160] In some embodiments, a cyclic peptide disclosed herein is selected from the group consisting of SEQ ID NOs: 29 to 37. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a cyclic peptide that is selected from the group consisting of SEQ ID NOs: 29 to 37.
[0161] In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48. In some embodiments, the amino acid sequence of a cyclic peptide disclosed herein comprises Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100), wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser.
[0162] In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48. In some embodiments, the amino acid sequence of a cyclic peptide disclosed herein comprises Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100), wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser, wherein the cyclic peptide comprises a disulfide bond between Cys6 and Cys10.
[0163] In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48. In some embodiments, the amino acid sequence of a cyclic peptide disclosed herein comprises Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100), wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57.
[0164] In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48. In some embodiments, the amino acid sequence of a cyclic peptide disclosed herein comprises Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100), wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser, wherein the cyclic peptide comprises a disulfide bond between Cys6 and Cys10, and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57.
[0165] In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48. In some embodiments, the amino acid sequence of a cyclic peptide disclosed herein comprises Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100), wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser, wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57, and wherein the amino acid sequence of the cyclic peptide fused or conjugated to the light chain is selected from the group consisting of SEQ ID NOs: 58 to 66.
[0166] In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 9, 21, and 38 to 48. In some embodiments, the amino acid sequence of a cyclic peptide disclosed herein comprises Asp-Gly-X3-X4-X5-Cys6-Arg-Gly-Asp-Cys10-X11-X12-X13-X14-X15 (SEQ ID NO: 100), wherein X3 is any one of Glu, Val, Gly, Gln, and Asp; X4 is any one of Arg and Lys; X5 is any one of Asn, Ser, Ala, Gln, Leu, and Thr; X11 is any one of Ile and Phe; X12 is any one of Asp and Glu; X13 is any one of Gly, Asp, Pro, Val and Ala; X14 is any one of Gln, Ser, Pro, and Ala; and X15 is any one of Pro, Gln, Asp, Leu, Val, and Ser, wherein the cyclic peptide comprises a disulfide bond between Cys6 and Cys10, and wherein the amino acid sequence of the cyclic peptide is selected from the group consisting of SEQ ID NOs: 50 to 57, and wherein the amino acid sequence of the cyclic peptide fused or conjugated to the light chain is selected from the group consisting of SEQ ID NOs: 58 to 66.
[0167] In some aspect, an antibody disclosed herein comprises a light chain constant region (CL) and the heavy chain comprises a heavy chain constant region (CH). In some aspect, an antibody disclosed herein is of IgG1 subtype. In some embodiments, an antibody disclosed herein is of IgG2 subtype. In some embodiments, an antibody disclosed herein is of IgG3 subtype. In some embodiments, an antibody disclosed herein is of IgG4 subtype. In some embodiments, an antibody disclosed herein is of IgG4 subtype. In some embodiments, an antibody disclosed herein is of lambda subtype. In some embodiments, an antibody disclosed herein is of kappa subtype. In some embodiments, an antibody disclosed herein is of kappa subtype. In some embodiments, an antibody disclosed herein is of a full-length immunoglobulin format.
[0168] In some aspect, an antibody of full-length immunoglobulin format has a structure with two full-length light chains and two full-length heavy chains, and each light chain is linked to each heavy chain by a disulfide bond (SS-bond). In some embodiments, a constant region of the antibody is divided into a heavy-chain constant region and a light-chain constant region, and the heavy-chain constant region has , , , , and types, and 1, 2, 3, 4, 1 and 2 subclasses. In some embodiments, the light-chain constant region is of type or .
[0169] In some embodiments, an agent presented herein is an antibody, for example an intact immunoglobulin type antibody, having endosomal escape ability in its light chain variable region (VL) and/or heavy chain variable region (VH), in which the cyclic peptide is fused to N-terminus of its light chain variable region (VL) and/or heavy chain variable region (VH), and has target cell/tissue-penetrating ability.
[0170] The endosomal escape ability of an antibody is influenced by structural changes in the endosomal escape motif within the light chain variable region and/or the heavy chain variable region of the antibody. In certain embodiments a complementarity-determining region 3 (CDR3) of the VL and/or VH of an antibody disclosed herein comprises a WYWX (SEQ ID NO: 69) sequence motif in which X is selected from the group consisting of methionine (M), isoleucine (I), and leucine (L); and the first amino acid in the light chain variable region (VL) and/or the heavy chain variable region (VH) being aspartic acid (D) or glutamic acid (E).
[0171] In certain embodiments, an antibody disclosed herein is fused to a cyclic peptide using a linker. In some embodiments, the linker is a polypeptide comprising the amino acid sequence MGSSSN (SEQ ID NO: 102) and/or GGGGS (SEQ ID NO: 103).
[0172] In certain embodiments, the light chain variable region (VL) of the antibody exhibits reduced or no binding ability to heparan sulfate proteoglycan (HSPG) of the target cell.
[0173] In some embodiments, provided herein is a method for preparing a vector comprising a light chain variable region (VL) and/or a heavy chain variable region (VH) of a human antibody. In some embodiments a VL and/or VH disclosed herein has been modified using methods known in the art. As non-limiting examples, in some embodiments, a VL and/or a VH disclosed herein has been mutated (e.g., point mutations insertions, deletions, etc.), fused to a heterologous sequence, glycoengineered (e.g., glycosylated or de-glycosylated), etc. In specific embodiments, a VL and/or a VH disclosed herein has been fused to one or more peptide sequences (e.g., a cyclic peptide sequence). In some embodiments, a VL and/or a VH produced using the methods disclosed herein and comprise a cyclic peptide sequence. In some embodiments, a cyclic peptide sequence is fused to the N-terminus of the light chain variable region (VL). In some embodiments, a cyclic peptide sequence is fused to the N-terminus of the heavy chain variable region (VH). In some embodiments, a cyclic peptide sequence is fused to the N-terminus of the light chain variable region (VL) and a cyclic peptide sequence is fused to the N-terminus of the heavy chain variable region (VH). In some embodiments, an agent, e.g., a cytotransmab (CT) and/or an antibody disclosed herein comprises one or more cyclic peptide sequences. In some embodiments a CT disclosed herein comprises two cyclic peptide sequences.
[0174] In certain embodiments, provided herein are cyclic-peptide fused antibodies wherein the antibody has been modified such that a functional motif (e.g., an endosomal escape motif) has been removed, added, or modified on the antibody. In some embodiments, a cyclic peptide disclosed herein is fused to a modified antibody or fragment thereof. Typically, grafting of a protein-binding continuous sequence motif has been executed to transfer binding specificity and affinity to another protein with a similar structural scaffold (Lee, et al., 2011). The representative example includes grafting of the antigen-recognizing CDR loops to the corresponding regions of another antibody's FR during antibody humanization (Ewert, Honegger, & Pluckthun, 2004) (Kim & Bae, 2015)
[0175] In certain embodiments, provided herein are cyclic peptide-fused antibodies wherein an endosomal escape motif (e.g., composed of a pH-sensing pair and/or a membrane-binding motif) is modified. In some embodiments, provided herein are methods for modifying the two-dimensional amino acid sequence that constitute a motif (e.g., an endosomal escape motif) in an agent (e.g., an antibody, polypeptide, CT) disclosed herein. In some embodiments, provided herein are methods for modifying the two-dimensional amino acid sequence in order to modify a three-dimensional structural fold in the agent (e.g. antibody and/or antibody fragment, polypeptide). In certain embodiments, provided herein are methods of modifying an antibody, and/or antibody fragment by grafting amino acid sequences from the same antibody, an exogenous antibody, or a heterologous sequence onto the antibody and/or antibody fragment. In some embodiments, the modified regions are highly homologous motifs from one region of an antibody (e.g., VL) to another (e.g., VH). In some embodiments one or more regions (e.g., functional motifs) of an antibody and/or antibody fusion disclosed herein is modified to alter functional motifs within the antibody and/or antibody fusion. In some embodiments, the fusion proteins, antibodies, antibody-cyclic peptide fusions, antibody fragments, and any agents disclosed herein may be modified in order to alter certain properties (e.g., protein targeting, protein affinity, aggregation, hydrophobicity, disulfide bonding, conformation, etc.)
[0176] In some aspects, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 50 to 57. In some embodiments, the amino acid sequence of the cyclic peptide fused or conjugated to the light chain of an antibody disclosed herein is selected from the group consisting of SEQ ID NOs: 58 to 66.
[0177] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a light chain constant region (CL) and the heavy chain comprises a heavy chain constant region (CH). In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein is of the IgG1 isotype. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein is of the IgG2 isotype. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein is of the IgG3 isotype. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein is of the IgG4 isotype. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a light chain of the lambda subtype. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a light chain of the kappa subtype.
[0178] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein is of full-length immunoglobulin format. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises an endosomal escape motif in the light chain variable region (VL) and/or the heavy chain variable region (VH) of the antibody. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises an endosomal escape motif in the light chain variable region (VL) of the antibody. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises an endosomal escape motif in the heavy chain variable region (VH) of the antibody. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises an endosomal escape motif in the light chain variable region (VL) and the heavy chain variable region (VH) of the antibody.
[0179] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises an endosomal escape motif that comprises the amino acid sequence 1) WYWX (SEQ ID NO:69) in the complementarity-determining region 3 (CDR3) of the light chain variable region (VL) and/or the heavy chain variable region (VH), wherein W is tryptophan, Y is tyrosine, and X is selected from the group consisting of methionine (M), isoleucine (I), and leucine (L); and 2) aspartic acid (Asp or D) or glutamic acid (Glu or E) as the first amino acid in the light chain variable region (VL) and/or the heavy chain variable region (VH), wherein the endosomal escape motif induces penetration of the antibody into the cytosol of the cell.
[0180] In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a VL region wherein the binding ability to heparan sulfate proteoglycan (HSPG) is reduced or abolished. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a VL region selected from the group consisting of SEQ ID NOs: 2 to 8. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a VL region selected from the group consisting of SEQ ID NOs: 11 and 12. In some embodiments, a cell/tissue-specific cell-penetrating antibody disclosed herein comprises a VL region represented by SEQ ID NO: 8 and a VH region represented by SEQ ID NO: 12.
5.4.1 Cyclic Peptide Fused to Full-Length Immunoglobulin Format Antibody
[0181] Full-length IgG antibodies cannot cross cell membranes of living cells, limiting their use for direct targeting of cytosolic proteins. Full-length immunoglobulin G (IgG) antibodies have primarily been developed to target proteins expressed on the cell-surface and some secreted proteins. Provided herein are methods for targeting full-length format antibodies to intracellular proteins.
[0182] Further, full-length format antibodies generally cannot cross intact cellular or subcellular membranes in living cells due to their large size and hydrophilicity. Provided herein are methods of fusing full-length format antibodies to cyclic peptides, where the hydrophobicity of the cyclic peptide-fused full-length format antibody is modified.
[0183] In some embodiments, provided herein are methods for fusing a full-length format antibody, wherein the full-length antibody can penetrate a cell membrane. In some embodiments, provided herein are cyclic peptides that can be fused to a full-length format antibody, wherein the full-length antibody can be selectively targeted to a cell/tissue, wherein the antibody is active.
[0184] The term heavy chain as used herein may be interpreted to include a full-length heavy chain including variable region domain VH including an amino acid sequence having a variable region sequence sufficient to confer antigen-specificity and three constant region domains CH1, CH2 and CH3, and a fragment thereof. Also, the term light chain as used herein may be interpreted to include a full-length light chain including a variable region domain VL including an amino acid sequence having a variable region sequence sufficient to confer antigen-specificity and a constant region domain CL, and a fragment thereof.
[0185] In the present invention, an intact immunoglobulin-type antibody has a structure with two full-length light chains and two full-length heavy chains, and each light chain is linked to each heavy chain by a disulfide bond (SS-bond). A constant region of the antibody is divided into a heavy-chain constant region and a light-chain constant region, and the heavy-chain constant region has , , , , and types, and 1, 2, 3, 4, 1 and 2 subclasses. The light-chain constant region has and types.
[0186] In some embodiments, disclosed herein are cyclic peptides that can be linked to any antibody or antibody fragment. In some embodiments, further provided herein are agents, for example, a polypeptide such as an antibody, e.g., a cell-penetrating antibody, that are biologically active (e.g., functional) in the cytosol of a cell. In some embodiments, an agent described herein that is cell-penetrating, e.g., a full-length format antibody, can target cytosolic proteins. Non-limiting examples of a full-length format antibodies that can be selectively targeted to a cell/tissue using the methods disclosed herein are adalimumab (Humira) and bevacizumab (Avastin). (Choi, Bae, Shin, Shin, & Kim, 2014).
[0187] In some embodiments, a cyclic peptide disclosed herein can be attached to an agent, for example, an antibody comprising a clinically-approved antibody (e.g., adalimumab or bevacizumab). In some embodiments, a cyclic peptide disclosed herein can be attached to an agent, for example, an antibody comprising a clinically-approved antibody or a fragment thereof (e.g., 2 HCs of adalimumab or bevacizumab).
[0188] In some embodiments, a cytosol-penetrating antibody disclosed herein (e.g., a cytotransmab, or CT), comprises a full-length IgG. In some embodiments, a cytosol-penetrating antibody disclosed herein (e.g., a cytotransmab, or CT), comprises a full-length IgG by incorporating a cytosol-penetrating VL into light chains (LCs) and then co-expressing the LCs with the heavy chains (HCs).
[0189] In some embodiments, a cytosol-penetrating antibody disclosed herein (e.g., a cytotransmab, or CT), comprises a Ras antibody. In some embodiments, a cytosol-penetrating antibody disclosed herein is a full-length Ras antibody. Intracellular targeting of oncogenic Ras has been previously described (Shin, et al., 2017) (Korean Patent Application No. 10-2017-0152998). In some embodiments, an agent disclosed herein (e.g. a cytosol-penetrating antibodies, cytotransmab, or CT) comprises an antibody or an antibody fragment that can target Ras, e.g., oncogeneic Ras including K-Ras, N-Ras, and H-Ras. In some embodiments, an agent disclosed herein (e.g. a cytosol-penetrating antibody, cytotransmab, or CT) comprises a full-length immunoglobulin format anti-Ras antibody. In some embodiments, an anti-Ras antibody or fragment thereof can be fused or conjugated to a cyclic peptide. In some embodiments, a cyclic peptide disclosed herein, targeting a cell membrane protein (e.g., EpCAM, integrin v5, etc.) thereby selectively targeting cells/tissues exhibiting (e.g., expressing or overexpressing) the cell membrane protein, can be fused to a Ras antibody (e.g., a full-length antibody or fragment thereof.)
[0190] As a non-limiting example, a Ras antibody can be fused to an EpCAM-targeting cyclic peptide (see Example 20). In some embodiments, a cyclic-peptide fused Ras antibody can selectively target cells/tissues. In some embodiments, a cyclic-peptide fused Ras antibody can penetrate into a targeted cell.
5.4.2 Linkers
[0191] As described herein, the antibody with the cell-penetrating ability and cyclic peptides are fused by the genetic engineering method using MGSSSN linker (SEQ ID NO: 102) and G4S (Gly-Gly-Gly-Gly-Ser) (SEQ ID NO: 103) or (G4S).sub.2 linker (SEQ ID NO: 101), and they are cloned into an animal expression vector. The linker has been conventionally used for fusing antibodies and peptides. The linker is selected and used for fusing antibodies and peptides described herein because it provides its structural flexibility and spatial arrangement to maintain the original function of the proteins before and behind the linker. However, as used herein, a linker for fusing antibodies and cyclic peptides is not limited by the antibody as described above. Any linker can be applicable as used herein as long as the linker provides the structural flexibility and spatial distance, which is suitable for genetic engineering fusion in the art.
[0192] In some embodiments, the linker is a polypeptide linker of about 1 to about 20 residues in length. In some embodiments the linker is a polypeptide linker of about 1 to about 5 residues, about 6 to about 10 residues, about 10 to about 15 residues, or about 15 to about 20 residues. In some embodiments, the linker comprises the amino acid sequence MGSSSN (SEQ ID NO: 102). In certain embodiments the linker comprises the amino acid sequence GGGS (SEQ ID NO: 109).
5.4.3 Cytotransmabs
[0193] In general, antibodies do not penetrate directly into living cells due to their large size and hydrophilic nature. However, the development of cell-penetrating antibodies, referred to as cytotransmabs (CTs), was recently reported (Choi, Bae, Shin, Shin, & Kim, 2014). Cytotransmabs are full-length IgG antibodies, which are able to penetrate into living cells through endocytic internalization and localization to the cytosol. Without wishing to be bound by theory or mechanism, after the cell internalization (endocytosis), they are dissociated from the membrane protein in the endosome. Then, the endosomal escape ability causes the antibody to escape from the endosome into the cytoplasm, so that the antibody is located in the cytoplasm. In other words, the cytosolic localization of a cytotransmab takes place through the following three sequential steps: i) cellular internalization by receptor-mediated endocytosis, ii) dissociation from the endosomal lumen, and iii) escape from the endosomal lumen to the cytosol.
[0194] In certain embodiments, a CT binds to HSPG, a cell membrane receptor, but HSPG is not a cell membrane receptor specifically expressed in only target cells. Thus, in certain embodiments, presented herein are antibodies with lower HSPG binding ability, which can contribute to or increase the cell/tissue-specificity cell of the cyclic peptide-containing antibodies presented herein.
[0195] The initial version of cytotransmab, TMab4 and TMab4-WYW, showed cell-penetrating activity in a variety of tumor cells due to its cellular uptake through heparan sulfate proteoglycan (HSPG), a ubiquitously expressed receptor (Choi, Bae, Shin, Shin, & Kim, 2014); (Kim, et al., 2016). HSPG, a receptor for cytotransmab, is generally expressed in most animal tissues (Perrimon & Bernfield, 2000). The nonspecific cytosol-penetration activity of earlier cytotransmab is undesirable because it can lead to off-target effects and/or an accelerated clearance rate due to nonspecific tissue binding after systemic administration.
[0196] Previously reported cytotransmabs, such as TMab4 and TMab4-WYW localize to the cytosol of cells after receptor-mediated endocytosis via cell surface-expressed heparan sulfate proteoglycan (HSPG), and are subsequent released from endosomes into the cytosol. Generally, endocytosed molecules are first transported to early endosomes (EEs; pH 5.5-6.5) and then usually to late endosomes (pH 4.5-5.5), and subsequently to lysosomes (pH <5.0) for degradation (Kim, et al., 2016). However, rather than being routed to degradative lysosomes, CTs, including TMab4-WYW, are dissociated from HSPG in acidified EEs, allowing them to escape into the cytosol from the lumen of EEs (Kim, et al., 2016).
[0197] The endosomal escape motif of TMab4-WYW resides in the light chain variable domain (VL) and is composed of a pH-sensing pair [AspL1 (where L=light chain with Kabat numbering) (Kabat, Wu, Foeller, Perry, & Gottesman, 1991) in the framework region (FR) and MetL95 in the third complementarity-determining region of the VL (VL-CDR3)] and a membrane-binding motif of 92WYW94 (TrpL92, TyrL93, and TrpL94) in VL-CDR3. At the mildly acidified pH of early endosomes, the carboxyl group of the negatively charged Asp (or Glu) residues become more protonated and therefore more hydrophobic, facilitating new hydrophobic interactions with MetL95 and shortening the distance between AspL1 and MetL95 from 6.5 to 3-4 . This AspL1-MetL95 interaction subsequently triggers local structural rearrangement of the MetL95-neighboring residues of 92WYW94, forcing the side chains to become upright in a favorable conformation to interact with the endosomal membrane. This interaction causes membrane lipid flip-flop, leading to the formation of membrane toroidal pores composed of the cytotransmab and a phospholipid for the endosomal escape of the cytotransmab into the cytosol. Consequently, the endocytosed cytotransmab escapes into the cytosol from endosomes.
[0198] In some embodiments, a CT provided herein comprises an intact immunoglobulin. In some embodiments, a CT disclosed herein is bioengineered to have a reduction in the interaction with one or more cell membrane proteins (e.g., ubiquitously expressed proteins such as HSPG), such that the CT will not exhibit non-specific interactions with non-targeted cells and/or tissues. In some embodiments a CT disclosed herein comprises amino acid substitutions (and/or other mutations) in one or more domains (e.g. a VL domain) that result in reduced non-specific interaction with one or more cell surface proteins. In some embodiments, a CT disclosed herein exhibits improved biophysical properties. Optimization of protein physical properties is well-known in the art, and non-limiting examples of physical properties of a CT disclosed herein are reduced protein aggregation, higher stability, reduced degradation, and reduced hydrophobicity.
[0199] In certain embodiments, the CTs described herein exhibit improved properties, such as improved expression level, colloidal stability, and manufacturability.
5.5 Methods of Making
5.5.1 Vectors, Cloning, and Mutagenesis
[0200] Provided herein are methods of preparing a cyclic peptide, cyclic peptide fusion, CT, cyclic-peptide-CT fusion, or any agents disclosed herein. In some embodiments, provided herein is a method for preparing a vector comprising a light chain variable region (VL) and/or a heavy chain variable region (VH) of a human antibody.
5.5.2 Transfections, Cell Culture, Purification
[0201] In some embodiments, a CT disclosed herein is made by transfecting an animal cell with a VL and/or a VH of an antibody disclosed herein with prepared heavy chain and light chain expression vectors, thereby expressing an antibody fused with an intact immunoglobulin-type cell-penetrating antibody and a cyclic peptide specifically binding to a cell membrane surface protein; and purifying and recovering the expressed antibody.
[0202] In some embodiments, the method can produce an intact immunoglobulin-type antibody having a cell-penetrating ability by expressing a light chain expression vector and a heavy chain expression vector. In some embodiments, the light chain expression vector and the heavy chain expression vector may be introduced into the host cell by co-transformation. In certain embodiments, the vector-introduced host cell is cultured to express an intact IgG-type cell-penetrating antibody, and then the antibody is purified and recovered from the supernatant.
[0203] In certain embodiments, the host cell can be any host cell known in the art. Non-limiting examples of host cells include, for example, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, Bacillus sp. strains such as Bacillus thuringiensis and Bacillus subtilis, intestinal bacteria or strains such as Salmonella typhimurium, Serratia marcescens, and various Pseudomonas species. In some embodiments, the host cells for transforming eukaryotic cells include, as non-limiting examples, yeast (Saccharomyce cerevisiae), an insect cell, a plant cell or an animal cell such as SP2/0, CHO (Chinese hamster ovary) K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3, RIN and MDCK cell lines.
[0204] In certain embodiments, also disclosed herein are methods for making a cell/tissue-specific cell-penetrating antibody disclosed herein. In some embodiments, methods for making a cell/tissue-specific cell-penetrating antibody disclosed herein comprise introducing a vector into a host cell; expressing the vector in the host cell; and recovering the expressed antibody. In certain embodiments, further disclosed herein are methods for making a cell/tissue-specific cell-penetrating antibody disclosed herein. In some embodiments, methods for making a cell/tissue-specific cell-penetrating antibody disclosed herein comprise introducing a vector into a host cell; expressing the vector in the host cell; and recovering the expressed antibody.
[0205] In some embodiments, also disclosed herein are methods of making an antibody disclosed herein comprising introducing into a host cell a vector comprising a polynucleotide encoding a polynucleotides encoding a light chain variable region (VL) and/or a heavy chain variable region (VH) of an antibody comprising an endosome escape motif, a polynucleotide encoding the light chain variable region (VL) with reduced or abolished HSPG binding ability, and a polynucleotide encoding a cyclic peptide that specifically binds to a cell surface molecule fused at the N-terminus of the light chain variable region (VL) and/or the heavy chain variable region (VH); expressing the vector in the host cell; and recovering the expressed antibody.
[0206] In some embodiments, further disclosed herein are polynucleotides encoding a cell/tissue-specific cell-penetrating antibody disclosed herein. In some embodiments, disclosed herein are vectors comprising polynucleotides disclosed herein. In some embodiments, also provided herein are cells comprising vectors disclosed herein.
[0207] In some embodiments, further provided herein are pharmaceutical compositions comprising the cell/tissue-specific cell-penetrating antibody according disclosed herein as an active ingredient and a pharmaceutically acceptable carrier. In some embodiments, a pharmaceutical composition disclosed herein can be used in treating a disease or condition in a subject. In some embodiments, a pharmaceutical composition disclosed herein can be used in treating cancer. In some embodiments, a pharmaceutical composition disclosed herein can be used in treating an immune disease. In some embodiments, a pharmaceutical composition disclosed herein can be used in treating a neurological disease.
5.6 Therapeutic Methods of Use
[0208] In some embodiments, a cell/tissue-specific cell-penetrating antibody described herein can be useful for therapeutic agents which target cancer to which the fused cyclic peptide may specifically bind.
[0209] Further, in some embodiments, the tissue-specific cell-penetrating antibody can be genetically fused or chemically conjugated with payload such as a toxin, an enzyme, a protein, a peptide, an siRNA (small interfering RNA), and/or an antisense RNA, as a sole substance without cell-penetrating ability, so that it can be used as medium of delivering the payload to the cytoplasm.
[0210] Further, in certain embodiments, the properties of cell/tissue-specific cell-penetrating antibody of the present invention can be used to develop the antibody therapeutic agent in which the target disease and tissue are specified to increase the therapeutic effect and to lower the side effects (e.g., toxicity) by no distribution or little distribution of the antibody therapeutic agent in the normal tissue.
[0211] In some embodiments, provided herein are methods of preventing or treating a disease or condition in a subject comprising administering a therapeutically effective amount of an agent, e.g., a cell/tissue-specific cell-penetrating antibody and/or cyclic peptide disclosed herein to the subject.
[0212] In some embodiments, further provided herein are methods of preventing or treating a disease or condition in a subject comprising administering a therapeutically effective amount of the cell/tissue-specific cell-penetrating antibody or the cyclic peptide disclosed herein to the subject, wherein the disease or condition is a cancer. In some embodiments, further provided herein are methods of preventing or treating a disease or condition in a subject comprising administering a therapeutically effective amount of the cell/tissue-specific cell-penetrating antibody or the cyclic peptide disclosed herein to the subject, wherein the disease or condition is an immune disease.
6. EXAMPLES
6.1 Example 1. Design of Light Chain Variable Region (VL) Variants with Reduced HSPG Binding Ability
[0213] A cell-penetrating, human IgG1 antibody TMab4-WYW, generally referred to as a cytotransmab (CT), has been previously described (WIPO Publication Nos: WO2016013870A1 and WO2017204606A1 and Korean Patent Application No: 10-2017-0152998). Cell-penetrating antibodies can penetrate into the cytoplasm through a mechanism whereby the antibody's light chain variable region (VL) binds to cell surface heparan sulfate proteoglycan (HSPG) receptors, which mediate endocytosis. However, due to the ubiquitous expression of HSPG receptors, CT targets cells non-specifically. In order to improve the specificity of CT cell targeting, a next-generation CT was designed in which HSPG binding ability is reduced.
[0214] Previous studies have revealed that a unique cationic patch sequence composed of Arg27f, Arg29, and Lys30 in the complementarity-determining region 1 (CDR1) of the cytotransmab hT4-WYW antibody's light chain variable region (VL-CDR1) is critical for HSPG binding (Choi, Bae, Shin, Shin, & Kim, 2014). In order to reduce the binding of CT to HSPG, the VL-CDR1 region was targeted for mutagenesis. Variants were generated by replacing the cationic patch sequence of CDR1 and adjacent amino acids with the CDR1 sequence of Vx2-40 subtype, which has the same number of amino acids of CDR1 among human germline derived sequences. In this example, amino acids known to be important for the stability of the conventional light chain variable region were conserved.
[0215] In order to maintain a low HSPG binding ability, phenylalanine residue of 27c, which was thought to affect the loop structure formation of the light chain variable region CDR1 of hT4-WYW VL, was mutated with leucine conserved in the light chain variable region, which had the reduced HSPG binding ability. Further, residues at 27f to 30, which were located at the tip of the CDR1 loop structure in a region expected to expose the side chain, were also mutated. Variants were generated using hT4-WYW VL as a template. In variant CT03a VL (hT4-34 VL; Korean Patent Application No. 10-2017-0152998), residue 27c, which was thought to affect the loop structure formation in the light chain variable region CDR1, was point-mutated. In generating variant CT03b VL (hT4-35 VL; Korean Patent Application No. 10-2017-0152998), threonine, arginine, lysine, and asparagine residues of 28, 29, 30, and 31, respectively, were replaced with aspartate, glycine, asparagine, and threonine. To generate variant CT03c VL (hT4-36 VL; Korean Patent Application No. 10-2017-0152998), arginine, threonine, lysine, and asparagine residues 27f, 28, 30, and 31, respectively, were replaced with aspartate, aspartate, asparagine, and threonine. To create variant CT03d VL (hT4-38 VL; Korean Patent Application No. 10-2017-0152998), arginine and asparagine residues of 29 and 31, respectively, were replaced with glycine and threonine. In the case of CT03e VL (hT4-39 VL; Korean Patent Application No. 10-2017-0152998), threonine and arginine residues of 28 and 29, respectively, were replaced with aspartate and glycine. Amino acids are numbered according to the Kabat numbering scheme.
[0216] Table 1 shows sequences of light chain variable regions (VL) containing mutations for reducing HSPG binding ability.
TABLE-US-00002 TABLE1 Namesoflight SEQ chainvariable ID regions Aminoacidsequence NO: hT4-WYWVL 11020abcdef304050 1 DLVMTQSPSSLSASVGDRVTITCKSSQSLFNSRTRKNYLAWYQQKPGKAPKLLIYW 60708090100 ASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYWYWMYTFGQGTKVEIKR CT03aVL 11020abcdef304050 2 (hT4-34VL) DLVMTQSPSSLSASVGDRVTITCKSSQSLLNSRTRKNYLAWYQQKPGKAPKLLIYW 60708090100 ASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR CT03bVL 11020abcdef304050 3 (hT4-35VL) DLVMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGNTYLAWYQQKPGKAPKLLIYW 60708090100 LSYRASGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR CT03cVL 11020abcdef304050 4 (hT4-36VL) DLVMTQSPSSLSASVGDRVTITCKSSQSLLNSDDRNTYLAWYQQKPGKAPKLLIYW 60708090100 LSYRASGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR CT03dVL 11020abcdef304050 5 (hT4-38VL) DLVMTQSPSSLSASVGDRVTITCKSSQSLLNSRTGKTYLAWYQQKPGKAPKLLIYW 60708090100 ASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR CT03eVL 11020abcdef304050 6 (hT4-39VL) DLVMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGKAPKLLIYW 60708090100 ASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
6.2 Example 2. Expression and Purification
[0217] In order to construct a heavy chain expression vector for producing a monoclonal antibody in the form of an intact IgG, DNA encoding the heavy chain fused with DNA encoding the secretion signal peptide at the 5-terminus were cloned into NotI/HindIII of pcDNA3.4 (Invitrogen) vector. Heavy chain sequences included the heavy chain variable region (humanized HT0 VH: SEQ ID NO: 10) and the heavy chain constant region (CH1-hinge-CH2-CH3) of the antibody.
[0218] In order to construct alight chain expression vector, DNA encoding the light chain, fused with DNA encoding the secretion signal peptide at the 5-terminus were cloned into NotI/HindIII of pcDNA3.4 (Invitrogen) vector. Light chain sequences included the cell-penetrating light chain variable region (hT4-WYW, CT03a, CT03b, CT03c, CT03d, CT03e VL) and the light chain constant region (CL).
[0219] The light and heavy chain expression vectors were transiently transfected to express and purify proteins. In a shaking flask, HEK293-F cells (Invitrogen) suspended-growing in serum-free FreeStyle 293 expression medium (Invitrogen) were transfected with a mixture of plasmid and polyethylenimine (PEI) (Polyscience). Following 200 mL transfection in a shaking flask (Corning), HEK293-F cells were seeded in 100 ml of the medium at a density of 210.sup.6 cells/ml and cultured at 150 rpm and 8% CO.sub.2. In order to produce each monoclonal antibody, suitable heavy and light chain plasmids were diluted in 10 ml of FreeStyle 293 expression medium (Invitrogen) so as to yield 125 g of the heavy chain and 125 g of light chain for a total of 250 g (2.5 g/ml). These were mixed with 10 ml of culture medium, which was diluted with 750 g of PEI (7.5 g/ml), and the mixture was incubated at room temperature for 10 minutes. Then, the reacted mixture medium was added to 100 ml of seeded cells. The obtained mixture was cultured for 4 hours at 150 rpm and 8% CO.sub.2. The remaining 100 ml of FreeStyle 293 expression medium was further added thereto, and the obtained mixture was cultured for 6 days. Cell culture supernatant was collected and the protein was purified from the supernatant using standard protocols. Antibodies were applied to Protein A Sepharose column (GE healthcare), washed with PBS (pH 7.4), and eluted with 0.1 M glycine buffer at pH 3.0. Then, the sample was immediately neutralized with 1 M Tris buffer. The eluted antibody fractions were concentrated by dialysis while the buffer was exchanged with PBS (pH 7.4). The purified protein was quantified at 280 nm wavelength using absorbance and absorption coefficient.
6.3 Example 3. HSPG Binding Ability
[0220] The effect of light chain variable region (VL) mutation on HSPG binding was analyzed. HSPG binding of VL variants CT3a, CT3b, CT03c, CT03d, and CT03e was compared to binding for TMab4-WYW, which is the parent hT4-WYW light chain of TMab4. VL binding to HSPG was detected by confocal microscopy.
[0221]
[0222] A HeLa cell line expressing HSPG was placed in 0.5 ml of a medium containing 10% FBS, at a density of 210.sup.4 cells per well in a 24-well plate and cultured at 37 C. in a 5% CO.sub.2 for 5 hours. When the cells were stabilized, 1 M of PBS, TMab4-WYW, CT3a, CT03b, CT3c, CT3d, and CT3e, respectively, was cultured at 37 C. for 6 hours. Then, the medium was removed, and the remnants were washed with PBS. Then, proteins attached to the cell surface were removed with a mild-acidic solution (200 mM glycine, 150 mM NaCl pH 2.5). After washing with PBS, 4% paraformaldehyde was added thereto. Then, the cells were fixed at 25 C. for 10 minutes. Then, the cells were washed with PBS and cultured with a buffer solution which was PBS containing 0.1% saponin, 0.1% sodium azide, and 1% BSA at 25 C. for 10 minutes, thereby forming holes in the cell membrane. After washing with PBS again, the reaction was carried out at 25 C. for 1 hour with a buffer solution (PBS containing 2% BSA) to suppress non-specific binding. Each antibody was stained with a Alexa-488-conjugated secondary antibody that specifically recognizes human Fc (green fluorescence). The nuclei were stained (blue fluorescence) using Hoechst 33342.
6.4 Example 4. Physical Properties of VL Variants
[0223] For therapeutic proteins, aggregates are a significant risk factor for deleterious immune responses in patients. Controlling protein aggregation and degradation is essential for enabling improved design of therapeutic protein stability, ligand binding, targeting, and activity in vivo. Evaluation of protein hydrophobicity is an efficient parameter for indirectly confirming protein physical properties. Proteins with high hydrophobicity are likely to aggregate due to nonspecific interactions between protein molecules. Thus, during the drug development process, screening candidates with poor physical properties due to high hydrophobicity is critical for the success of new drug development.
[0224] To assess the biophysical properties of the CT variants at an early stage of construction, they were analyzed on the Zenix SEC-300 HPLC column (Sepax technologies) to evaluate the hydrophobicity of proteins by high-performance liquid chromatography.
[0225] 80 l of TMab4-WYW, CT03b, CT03c, CT3d, and CT3e at a 1 mg/ml concentration was prepared. CT03a, which showed the least reduction in HSPG binding in Example 3, was not analyzed. For the Zenix SEC-300 size-exclusion chromatography column, a buffer of 150 mM Na.sub.3PO.sub.4 and 137 mM NaCl at pH 7.0 flowed at a flow rate of 1.0 ml/min. Then, the chromatography column was set when the pressure and the mAU at 280 nm were stabilized. The purified antibodies were injected at 1.0 mg/mL and 30 L sample volume and were monitored at 280 nm for 30 min.
[0226] HPLC results reveal that CT03e showed a peak at a time similar to that of the Trastuzumab control monoclonal antibody (
6.5 Example 5. Design of New CT03e VL Variant with Improved Physical Properties
[0227] The results demonstrated that CT03e had better physical properties than other variant, but showed more aggregation than the control trastuzumab antibody (
[0228] A residue at L50 of VL-CDR2 of CT03e is tryptophan. A hydrophobic and bulky Trp residue at this position is known to cause more aggregation than negatively charged residues (Dudgeon, et al., 2012) and can negatively affect VH-VL interactions (Choi, Bae, Shin, Shin, & Kim, 2014). Therefore, studies have searched for clinically-approved antibodies that have a CDR2 sequence in which a negatively charged amino acid, particularly, aspartate or glutamate, is located at this 50th residue rather than tryptophan (Dudgeon, et al., 2012).
[0229] An endosomal escape motif was previously introduced into the light chain variable region of various clinically-approved antibodies to develop a new light chain variable region with endosomal escape ability (WIPO Publication No. W2017204606A1). Among the clinically-approved antibodies, panitumumab-WYW VL has an aspartate at the 50th residue. Therefore, the sequences of CT03e VL and panitumumab-WYW VL were combined to construct a novel light chain variable region sequence. The VL-CDR2 (.sup.50WASTERS.sup.56) of CT3e was replaced with (.sup.50DASNLET.sup.56) derived from panitumumab (Vectibix) to generate CT05 VL. Table 2 shows sequences of light chain variable regions (VL) containing mutations for improving protein aggregation.
TABLE-US-00003 TABLE2 Namesoflight SEQ chainvariable ID regions Aminoacidsequence NO: CT03eVL 11020abcdef304050 6 (hT4-39VL) DLVMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGKAPKLLIYW 60708090100 ASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR Panitumumab- 11020abcd4050 7 WYWVL DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYD 60708090100 ASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGTKVEIKR CT05VL 11020abcdef304050 8 DIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGKAPKLLIYD 60708090100 ASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGTKVEIKR
[0230] The light chain variable region was designed in the same method as described in Example 2. The VL was cloned into a light chain expression vector, and they were transiently co-transfected into HEK293F cells along with a cell-penetrating humanized heavy chain expression vector. Proteins were purified by the same method as in Example 2.
6.6 Example 6. Improved Physical Properties of the CT05 VL Variant
[0231] To test the physical properties of the newly generated CT05 variant using high-performance liquid chromatography, Zenix SEC-300 column analysis was conducted., in which the results are mAU values at 280 nm obtained by Zenix SEC-300 column analysis which can evaluate the protein hydrophobicity using a high-performance liquid chromatography.
[0232] 80 l of TMab4-WYW, CT03e, and CT05, were prepared at a concentration of 1 mg/ml as described in Example 4. For the Zenix SEC-300 size-exclusion chromatography column, a buffer of 150 mM Na.sub.3PO.sub.4 and 137 mM NaCl at pH 7.0 flowed at a flow rate of 1.0 ml/min. Then, the chromatography column was set when the pressure and the mAU at 280 nm were stabilized. Thereafter, 30 l of the prepared samples were loaded at the same flow rate thereof, and the mAU values had been measured at 280 nm for 30 min.
[0233] CT05 showed a sharp symmetric peak with a retention time similar to that of Trastuzumab (Herceptin) (
6.7 Example 7. HSPG Binding Ability of the CT05 VL Variant
[0234] Confocal microscopy was performed for detection of internalized antibodies in cultured cells, as described in Example 5. Confocal microscopy was used to compare the HSPG binding and cell internalization ability of CT05 and the parent TMab4-WYW.
[0235] A HeLa cell line expressing HSPG was placed in 0.5 ml of a medium containing 10% FBS, at a density of 210.sup.4 cells per well in a 24-well plate and cultured at 37 C. in 5% CO.sub.2 for 12 hours. Cells were treated with 1 M of TMab4-WYW, 1 M CT05, or PBS control and cultured at 37 C. for 6 hours. After two washes with PBS, the cells were washed two times for 30 s at room temperature with a mildly acidic glycine buffer (200 mM glycine, 150 mM NaCl, pH 2.5), followed by two additional washes with PBS to remove non-internalized and nonspecifically surface-bound antibodies. After fixation with 4% paraformaldehyde in PBS for 10 min at room temperature, permeabilization with PERM-buffer (0.1% saponin, 0.1% sodium azide, and 1% BSA in PBS) for 10 min at 25 C., and then blocking with 2% BSA in PBS for 1 h at room temperature, the internalized antibody was detected with an Alexa Fluor 488-conjugated goat anti-human IgG antibody (Invitrogen, A-11013) for 2 h at room temperature. The nuclei were stained with Hoechst 33342 for 5 min in PBS. After mounting the coverslips onto glass slides with the Perma Fluor aqueous mounting medium (Thermo Scientific, TA-030-FM), we obtained center-focused single z-section images on a Zeiss LSM710 system with the ZEN software (Carl Zeiss).
[0236] The experiment revealed that the fluorescence intensity of CT05 was only 17.3% that of TMab4-WYW, indicating a five-fold decrease in cellular internalization for the CT05 variant compared to the parent antibody (
6.8 Example 8. Endosomal Escape Ability
[0237] Previous studies have revealed that endosomal escape ability is due to a cell membrane-binding motif located in CDR3 as well as a pH-sensitive interaction between a residue in the framework region and a residue in CDR3, but it was not dependent on sequences within CDR1 and CDR2 (Kim, et al., 2016). The newly constructed CT05 variant includes the same pH-sensing pair and cell membrane-binding motif sequences as the parental antibody, hT4-WYW VL. Thus, its endosomal escape ability is expected to be similarly maintained. To test whether CT05 retains the endosomal escape ability of TMab4-WYW, we assessed the uptake of trypan blue dye by a nonadherent cell line that lacks HSPG expression (Ramos human Burkitt's lymphoma cells). As a negative control, a CT05-AAA mutant was created, harboring a .sup.92AAA.sup.94 substitution of the membrane-binding motif .sup.92WYW.sup.94 in VL-CDR3, wherein the 92nd to 94th amino acids responsible for the endosomal escape ability and located in the existing light chain variable region, was replaced with consecutive three alanines.
[0238] In order to adhere Ramos cells to cell culture plates, 24-well plates were first coated with poly-L-lysine. 200 l of 0.01% poly-L-lysine was added to the 24-well plate, and they were reacted at 25 C. for 20 min. After washing with PBS, Ramos cells adhered to the plate at 510.sup.4 cells per well. After confirming the cell adhesion, 1 M of TMab4-WYW, CT05, or CT05-AAA, was added to 200 l of buffers at two pHs. Buffer alone was used as a negative control. pH 7.4 buffer (HBSS (Welgene), 50 mM HEPES pH 7.4) is similar to the cytoplasmic pH. pH 5.5 buffer (HBSS (Welgene), 50 mM MES pH 5.5) is similar to initial endosomal pH. Cells were cultured at 37 C. for 2 hours. After carefully washing with PBS, 10 l of trypan blue was mixed with 190 l of PBS, and 200 l of the mixture was dispensed in each well. Then, they were observed by a microscope.
[0239] Antibody that retains endosomal escape ability will be expected to facilitate uptake of the dye at pH 5.5, which is the endosomal acidic pH condition, but not at pH 7.4, which is the cytosolic pH (
[0240] The percentage of blue-stained cells at each pH condition was also quantitated, showing strikingly similar endosomal escape ability between CT05 and TMab4-WYW (
6.9 Example 9. Design and Purification of epCT05, a Cyclic Peptide-Fused CT05 Variant Capable of Tumor Tissue-Specific Targeting
[0241] CT05 has maintains its endosomal escape ability, while maintaining a dramatically reduced HSPG binding ability. These combined features can confer the ability to selectively target specific receptors within tumors for the tumor tissue-specific cellular internalization and cytoplasmic penetration. EpCAM (epithelial cell adhesion molecule) was selected as a potential target receptor for tumor tissue-specific targeting by CT05. EpCAM is a glycosylated type I transmembrane protein involved in cell adhesion. It is overexpressed in many solid tumors, such as colon cancer, with limited expression in normal epithelial tissues (Went, et al., 2006) (Munz, Baeuerle, & Gires, 2009) and has been validated as a target for tumor tissue-specific delivery of cancer therapeutics (Simon, Stefan, Pluckthun, & Zangemeister-Wittke, 2013) (Di Paolo, et al., 2003) (Singh, et al., 2016).
[0242] To generate a tumor tissue-specificity cell-penetrating antibody, CT05, which has been engineered to have reduced HSPG-binding, was targeted to EpCAM receptors. The twelve residue cyclic peptide Ep133 (amino acid sequence EHLHCLGSLCWP (SEQ ID NO: 13)), which binds specifically to the EpCAM receptor, was employed to direct CT05 targeting. This cyclic peptide is described in U.S. Pat. No. 9,815,866B2, Peptides that bind to epithelial cell adhesion molecule. To selectively target CT05 to EpCAM receptors on EpCAM-expressing tumor tissues, Ep133 was fused at the N-terminus of the CT05 light chain variable region (VL) via a (G.sub.4S).sub.2 linker (SEQ ID NO: 101), thereby generating epCT05 (
[0243] For the mammalian cell expression of the cell-penetrating antibody fused with the EpCAM targeting cyclic peptide (epCT05), DNAs encoding the light chain including the cyclic peptide-fused CT05 light chain variable region and the light chain constant region (CL) were cloned into pcDNA3.4 vector fused with DNA encoding the secretion signal peptide at the 5-terminus as described in Example 2. Light chain expression constructs were transiently co-transfected into HEK293F cells along with a cell-penetrating humanized heavy chain expression vector, thereby expressing individual clones. They were purified by the same method as in Example 2. Table 3 depicts the sequences and names of light chain variable regions (VL) fused with tumor-specific cyclic peptides.
TABLE-US-00004 TABLE3 Namesof lightchain SEQ variable ID regions Aminoacidsequence NO: CT05VL 11020abcdef304050 8 DIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGKAPKLLIYD 60708090100 ASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGTKVEIKR epCT05(G.sub.4S).sub.2 11020304050 9 VL EHLHCLGSLCWPGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSR 60708090100110 DGKNYLAWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPED 120130 IATYFCQQYWYWMYTFGGGTKVEIKR
6.10 Example 10. Selective Targeting of epCT05 to EpCAM-Expressing Cells
[0244] The EpCAM-binding peptide-fused epCT05 was incubated with three cell lines in order to assay tissue-specific binding. HCT116 (human colon cancer cell line) and SW480 (colon adenocarcinoma cell line) cells are EpCAM positive, and HeLa (cervical carcinoma cell line) cells are EpCAM negative.
[0245] To detect cell-surface expression of EpCAM on the human tumor cells, 1105 cells of HCT116, SW480, and HeLa were prepared for the respective samples. The anti-EpCAM antibody was diluted and placed at 1:200 and cultured at 4 C. for 1 hour. Then, the primary antibody anti-EpCAM antibody was reacted with Alexa Fluor 488-labeled anti-EpCAM antibody specific for rat Fc (green fluorescence), at 4 C. for 30 min. After washing with PBS, the cells were analyzed by flow cytometry. The results revealed that anti-EpCAM antibodies bound to HCT116 and SW480 cells, but not to HeLa cells (
[0246] To test for epCT05 targeting to cell surface EpCAM receptors, the cells were cultured in PBSF (PBS buffer, 2% BSA) with 100 nM of CT05 or epCT05 at 4 C. for 1 hour. Then, each antibody was reacted with antibodies specific for human Fc to which Alexa488 (green fluorescence) was linked, at 4 C. for 30 min. After washing with PBS, the cells were analyzed by flow cytometery.
[0247] Flow cytometric analysis revealed that epCT05, but not CT05, selectively bound to EpCAM-positive HCT116 and SW480 cells with little binding to EpCAM-negative HeLa cells (
6.11 Example 11. Cellular Internalization and Endosomal Escape Ability of epCT05
[0248] It was demonstrated that epCT05, the cell-penetrating antibody containing an EpCAM-targeting cyclic peptide, can specifically bind to EpCAM-expressing tumor tissue. Experiments were carried out to confirm whether the in addition to binding to cell surface EpCAM, epCT05 is internalized into tumor cells.
[0249] SW480 and HeLa cells were treated with 1 M of the epCT05 antibody, 1 M TMab4-WYW, or buffer at 37 C. for 6 hours. Cells were grown in 0.5 ml of a medium containing 10% FBS in a 24-well plate at a density of 210.sup.4 cells/well. The cells were cultured at 37 C. in 5% CO.sub.2 for 12 hours. When the cells were stabilized, 1 M TMab4-WYW, 1 M epCT05 or PBS was added and cells were cultured at 37 C. for 6 hours. Then, the cells were washed with PBS and a mild-acidic solution as described in Example 3 and then subjected to cell fixation, cell perforation, and blocking. Each antibody was stained with an antibody that specifically recognizes human Fc to which Alexa-488 (green fluorescence) was conjugated. The nuclei were stained (blue fluorescence) using Hoechst 33342.
[0250] The epCAM-expressing SW480 cells were able to internalize both the epCT05 antibody and TMab4-WYW (
[0251] The EpCAM-targeting Ep133 cyclic peptide is a cyclic peptide which is formed by a disulfide bond. When the disulfide bond is cleaved due to the reducing conditions of the endosome, the peptide's affinity to EpCAM is significantly reduced (U.S. Pat. No. 9,815,866B2, Peptides that bind to epithelial cell adhesion molecule). Accordingly, following cellular internalization of epCT05, the Ep133 disulfide bond is cleaved inside the endosome, and the Ep133 cyclic peptide is expected to dissociate from EpCAM. Dissociation of Ep133 from EpCAM, would free the epCT05 within the endosome, allowing it to escape into the cytoplasm. In order to verify this hypothesis, the cell penetrating antibody CT05 was fused at the N-terminus with Ep114 peptide (U.S. Pat. No. 9,815,866B2, Peptides that bind to epithelial cell adhesion molecule). Ep114 is a linear peptide-type which specifically binds to EpCAM.
[0252] To examine escape of internalized antibodies from endosomes, a calcein leakage assay was performed. Cells are incubated with antibody and calcein and calcein is internalized into endosomes only when antibodies are internalized (
[0253] The HCT116 cell line was prepared as described in Example 3, and 1 M of cytotransmab, Ep133-fused cytotransmab, or Ep114-fused cytotransmab were incubated with the cells at 37 C. for 6 hours. After 4 hours, the wells containing the antibody were treated with 150 M calcein, and the cells were cultured at 37 C. for 2 hours. After washing with PBS and mild-acidic solution as described in Example 3, the cells were fixed. The nuclei were stained (blue fluorescence) using Hoechst 33342, and they were observed by confocal microscopy.
[0254] The cells treated with the linear peptide Ep114-fused cytotransmab showed almost no release of calcein fluorescence into the cytosol (
6.12 Example 12. Cellular Localization of epCT05
[0255] In order to directly demonstrate that epCT05 is located in the cytoplasm, an enhanced split green fluorescent protein (GFP) complementation assay was conducted as described in Korean Patent No. 10-1790669, Enhanced split-GFP complementation system, and its application thereof.. Complemented GFP fluorescence can be observed only when an extracellularly added IgG-GFP11-SBP2 antibody (IgG antibody fused with a GFP11 fragment and a streptavidin-binding peptide 2, SBP2, at the C terminus of HC) is internalized by cells via receptor-mediated endocytosis, escapes from endosomes into the cytosol, and then is assembled with a streptavidin (SA)-fused GFP1-10 fragment expressed in the cytosol of SW480 cells (
[0256] The GFP1-10 fragments were expressed in the cytoplasm, and the GFP11 fragment was fused to the C-terminus of the heavy chain of the cell-penetrating antibodies TMab4-WYW or epCT05. EpCAM-targeting cyclic peptide-fused light chain expression vector and GFP11-SBP2-fused cell-penetrating humanized heavy chain expression vector constructed as described (Korean Patent No. 10-1790669). Constructs were transiently co-transfected into a HEK293F protein expression cell. They were purified as described in Example 2.
[0257] The transformed SW480 cell line stably expressing SA-GFP1-10 was placed in 0.5 ml of medium containing 10% FBS at 210.sup.4 cells/well in a 24-well plate and was cultured at 37 C. in 5% CO.sub.2 for 12 hours. When cells were stabilized, 0.2, 0.8, and 3.2 M TMab4-WYW-GFP11-SBP2, epCT05-GFP11-SBP2 or PBS were incubated with cells at 37 C. for 6 hours. After washing with PBS and mild-acidic solution as described in Example 2, the cells were fixed. The nuclei were stained (blue fluorescence) using Hoechst 33342 to be observed by confocal microscopy. Image J software (National Institutes of Health, USA) was used to select 20 cells in each condition. Then, the mean values of fluorescence obtained were calculated.
[0258] epCT05-GFP11-SBP2 showed concentration-dependent complemented GFP fluorescence in the cytosol at the levels comparable to those of TMab4-WYW-GFP11-SBP2 (
[0259] The endosomal escape efficiency of epCT05 was determined using a method previously reported (Kim, et al., 2016) and as described in Example 16. To determine the endosomal escape efficiency of epCT05, the amount of epCT05 detected in the cytosol is divided by the total cellular internalized amount estimated by quantitative western blotting. epCT05 showed a concentration-dependent increase in endosomal escape efficiency (
6.13 Example 13. Generation of a CT with a VH-Mediated Endosomal Escape Activity
[0260] The endosomal escape activity of CTs such as TMab4-WYW and epCT05 reside in the VL. Although the VH and VL share low sequence similarity, their folding topology is the similar, with quite high similarity of tertiary structural in the framework backbone structure (Ewert, Honegger, & Pluckthun, 2004), comprising a beta-pleated sheet and three CDRs with a loop structure in common (
[0261] The endosomal escape motif of VL comprises the pH-sensing pair AspL1-MetL95 (
[0262] The VH-CDR3 was designed to impart endosomal escape activity, and appropriate acceptor human VH FR was selected based on the following criteria: 1) a negatively charged residue at H1 (the first residue of VH); 2) a hydrophobic residue in VH-CDR3 within a distance of 5-6 threshold from the H1 residue for a pH-sensing pair; and 3) an FR compatible with the designed length of VH-CDR3 carrying the membrane-binding motif WYW.
[0263] Four heavy chain variable region mutants were previously designed, in which the endosomal escape motif was introduced into the humanized heavy chain variable region containing all of these elements (WIPO publication No. WO2017204606A1). Among them, CT01 VH (SEQ ID NO. 11) was selected for further development (HT0-01 VH; WIPO Publication No. WO2017204606A1).
[0264] The number of amino acids in HT0 VH (SEQ ID NO. 10) of the CT was 11, and the center portion of the CDR loop structure was exposed to the surface. Thus, it was determined that these structural features would not be conducive to pH-sensitivity. Therefore, the number of amino acids in CDR3 was reduced to 7 or 8 while retaining a partial sequence. Further, it was determined that residue 102 of VH-CDR3 was located at a suitable distance to GluH1, suggesting that these residues may interact at the initial endosome condition of pH 5.5. Thus, the residue was substituted with leucine (
[0265] In order to introduce the CDR3 sequence containing the endosomal escape motif, the number of amino acids in CDR3 of the heavy chain variable region HT0 VH (SEQ ID NO. 10) of the CT was significantly reduced from 11 to 7. It was determined that these alterations may affect the overall stability of the heavy chain variable region. Thus, a new heavy chain variable region ws selected that can appropriately receive CDR3 containing the endosomal escape motif with 7 amino acids. Since the CDR3 of the RT22 VH of the anti-RasGTP iMab previously described (Korean Patent Application No. 10-2017-0152998) has 6 amino acids, and its first residue is the negatively charged glutamate residue, it was determined to be suitable for introducing the endosomal escape motif in VH-CDR3 of CT01 VH (SEQ ID NO. 11). The heavy chain variable region including the CDR3 sequence containing the endosomal escape motif in RT22 VH was named CT60 VH (SEQ ID NO. 12) (CT10 VH; WIPO publication number WO2017204606A1).
[0266] Table 4 shows the sequences of the heavy chain variable region (VH) containing the endosomal escape motif.
TABLE-US-00005 TABLE4 Namesof SEQ heavychain ID variableregions Aminoacidsequence NO: HT0VH 11020304050 10 EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYVMHWVRQAPGKGLEWVSAINPYNDGNYY 60708090110 ADSVKGRFTISRDNSRKTLYLQMNSLRAEDTAVYYCARGAYKRGYAMDYWGQGTTVTVSS CT01VH 11020304050 11 (HT0-01VH) EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYVMHWVRQAPGKGLEWVSAINPYNDGNYY 60708090110 ADSVKGRFTISRDNSRKTLYLQMNSLRAEDTAVYYCARGWYWMDLWGQGTTVTVSS CT60VH 1102030405052a 12 (CT10VH) EVQLVESGGGLVQPGGSLRLSCAASGFTFSDFSMSWVRQAPGKGLEWVSYISRTSHTTY 60708082a90100a110 YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWYWMDLWGQGTLVTVSS
[0267] Similarity-based structure modeling (ABodyBuilder) (Leem, Dunbar, Georges, Shi, & Deane, 2016), was used to generate the structure of the light chain variable region and the heavy chain variable region with the endosomal escape motifs. The superimposing method was used to compare the distance between the pH sensing pairs located at the framework and CDR3 and the location of the cell membrane binding motif located in CDR3. The distance between the pH sensing pairs was 5.1 in the heavy chain variable region, which was similar to 5.8 in the light chain variable region. The shape of the CDR3 loop structure and the location of the cell membrane binding motif of the heavy chain variable region were also similar to those of the light chain variable region (
[0268]
6.14 Example 14. cpCT65-AAA Exhibits VH-Mediated Endosomal Escape
[0269] Endosomal escape ability was examined in epCT05, epCT05-AAA and epCT65-AAA using trypan blue in Ramos cells adhered to the plate as described in Example 8. 1 M of epCT05, epCT05-AAA, and epCT65-AAA, was placed in 200 l of pH 7.4 buffer (HBSS (Welgene), 50 mM HEPES pH 7.4), or pH 5.5 buffer (HBSS (Welgene), 50 mM MES pH 5.5), and they were cultured at 37 C. for 2 hours. After carefully washing with PBS, 10 l of trypan blue was mixed with 190 l of PBS, and 200 l of the mixture was dispensed in each well. Then, they were observed by a microscope. The number of cells that had acquired trypan blue among all cells was counted to be shown in a percentage. A total of more than 400 cells were counted, and the mean value was plotted. The number of the trypan blue acquired by epCT65-AAA was about half of that of TMab4-3.
[0270] The percentage of blue-stained cells at each pH condition was also quantitated, revealing that epCT65-AAA, but not epCT05-AAA, showed pH-dependent membrane pore formation ability only at pH 5.5 (
[0271] To validate the endosomal escape activity of epCT65-AAA, we monitored epCT65-AAA-mediated cytosolic release of coincubated calcein, a membrane-nonpenetrating green fluorophore, in SW480 cells. The cytosolic diffusion of coincubated calcein is detected only when it escapes into the cytosol from the endosomal lumen through CT-induced endosomal pores after passive endocytic uptake. As expected, epCT05-AAA showed a punctate fluorescence of calcein, indicative of endosomal entrapment without a cytosolic release (
[0272] (MFI) of calcein in the cytoplasm of cells as compared were quantitated, confirming uptake of calcein in the presence of epCT65-AAA is dose-dependent (
[0273] Complemented GFP fluorescence assay was conducted to further verify with the format of epCT65-AAA-GFP11-SBP2 revealed concentration-dependent cytosolic localization in SW480-SA-GFP10 cells (
[0274] The cells treated with epCT05-AAA-GFP11-SBP2 showed almost no spread-type fluorescence (
6.15 Example 15. Generation of epCT65, a CT with an Endosomal Escape Motif in Both the VH and VL
[0275] To generate a CT with a high endosomal escape activity, the HC of epCT65-AAA and the LC of epCT05, both of which have endosomal escape motifs, were co-expressed. The resulting intact IgG-type CT, epCT65, comprises a total of four endosomal escape motifs, and fused EpCAM-targeting cyclic peptide (
[0276] To produce epCT65, the endosomal escape humanized heavy chain expression vector containing the heavy chain variable region with the endosomal escape motif and the light chain expression vector containing the tumor-specific light chain variable region fused with the EpCAM target cyclic peptide were transiently co-transfected into HEK293F cells to express individual clones. They were purified by the same method as in Example 2.
[0277] SEC analysis on a Superdex column verified that epCT65 was in the correctly assembled monomeric form without non-native oligomers, (
[0278] Zenix SEC-300 column-based SMAC analysis revealed the elution of epCT65 in a symmetric Gaussian-shaped peak in the absence of any heterogeneous species but with somewhat longer retention time compared to that of trastuzumab (
[0279] epCT05 and epCT65 showed the peak at the time similar to that of Trastuzumab as the control monoclonal antibody. The widths of the peaks were normally narrow (
6.16 Example 16. Endosomal Escape Ability and Cytosol-Penetration of epCT65
[0280] Endosomal escape ability was assessed by measuring the uptake of trypan blue dye by a nonadherent cell line that lacks HSPG expression as described in Example 8. Briefly, Ramos cells adhered to the plate in the same method as in Example 8. Then, 0.5 and 1 M of epCT05, epCT65, or buffer were placed in 200 l of pH 7.4 buffer (HBSS (Welgene), 50 mM HEPES pH 7.4), which is the same to the cytoplasm's pH, and pH 5.5 buffer (HBSS (Welgene), 50 mM MES pH 5.5), which is the same to initial endosomal pH, and they were cultured at 37 C. for 2 hours. After carefully washing with PBS, 10 l of trypan blue was mixed with 190 l of PBS, and 200 l of the mixture was dispensed in each well. Then, they were observed by a microscope. The percent of cells acquiring trypan blue is shown (
[0281] In order to further demonstrate that epCT05 is located in the cytoplasm, an enhanced split green fluorescent protein (GFP) complementation assay was conducted as described in Korean Patent No. 10-1790669 and herein. Briefly, the transformed SW480 cell line stably expressing SA-GFP1-10 was prepared in the same method as in Example 12. When the cells were stabilized, 0.1, 0.2, 0.4, 0.8, and 1.6 M of epCT05-GFP11-SBP2 and epCT65-GFP11-SBP2, respectively, were cultured at 37 C. for 6 hours. After washing with PBS and mild-acidic solution in the same method as in Example 3, the cells were fixed. The nuclei were stained (blue fluorescence) using Hoechst 33342, and they were observed by a confocal microscope. The cells treated with epCT65-GFP11-SBP2 showed concentration-dependently intense green GFP fluorescence in the cells compared with the cells treated with epCT05-GFP11-SBP2 (
[0282] The results revealed that epCT65, which bears endosomal escape motifs in both VL and VH, showed improved endosomal escape ability and localization to the cytoplasm compared to epCT05, which has endosomal escape motifs in VL alone (
[0283] Table 5 shows the cytosolic concentration and the endosomal escape efficiency of the intact IgG-type cell-penetrating antibody fused with GFP11-SBP2 and the endosomal escape ability-increased cell-penetrating antibody. The cytosolic concentrations of epCT65 were 1.8-fold higher than those of epCT05, being 20, 141, and 377 nM after 6 h of extracellular treatment of SW480-SA-GFP1-10 cells with 0.1, 0.5, or 1 M epCT65, for treatment concentrations of 0.1, 0.5 and 1 M, respectively (Table 5, top). In contrast, the internalized amounts of epCT65, estimated by quantitative western blotting, were similar to those of epCT05 in SW480 cells (Table 5 and
TABLE-US-00006 TABLE 5 Treated concentrations (M) Parameters Cytotransmabs 0.1 0.5 1 Cytosolic epCT05 13 4 97 5 215 16 concentration epCT65 20 6 141 10 377 20 (nM).sup.c Endosomal escape epCT05 2.50 0.3 6.66 0.4 9.53 0.6 efficiency epCT65 5.00 0.4 10.1 1.1 17.5 1.3 (%).sup.d Table 5. .sup.cThe cytosolic molar concentration was estimated by dividing the cytosolic amount by the cytosolic volume of SW480 cells and cell numbers in each well, as described in detail (Kim, et al., 2015); .sup.dThe endosomal escape efficiency was estimated by dividing the cytosolic amount with the internalized amount of antibodies, as described in detail previously (Kim, et al., 2015).
6.18 Example 17. Generation of Biotinylated EpCAM Protein for Selection of Targeting Peptides
[0284] In order to construct tumor-specific cell-penetrating antibodies, Ep133 cyclic peptide was used to target EpCAM. Ep133 binds to EpCAM target but shows relatively low binding ability considering the binding ability to EpCAM expressed on the cell surface. Thus, in order to generate efficient tumor tissue-specificity for enhancing the EpCAM target affinity, an EpCAM target cyclic peptide library was constructed at the N-terminus of the light chain variable region to select a cyclic peptide with the improved EpCAM target affinity.
[0285] First, a human recombinant EpCAM antigens was constructed for the library selection. Briefly, PCR was performed using GSG linker to construct DNA fused with 6His tag and the Avi-tag at N-terminus and the extracellular domain (residues 1 to 265) except for the intracellular domain and the C-terminal transmembrane domain in the EpCAM protein. These were cloned into pcDNA3.4 vector for animal cell expression using NotI/HindIII restriction enzymes. Then, the constructed pcDNA3.4 EpCAM antigen vector was transiently transfected to express the protein in a similar manner as in Example 2. The cell culture supernatant was collected using standard protocol in the art and was purified using Ni-NTA resin that specifically purified the protein fused with His tag. After washing with 50 ml of wash buffer (20 mM Tris, pH 7.4, 300 mM NaCl, 20 mM imidazole) to remove Ni-NTA resin, the proteins were eluted by the lysis buffer (20 mM Tris, pH 7.4, 300 mM NaCl, 250 mM imidazole). The eluted protein was buffered with the preservative buffer (50 mM Tris-HCl, pH 8.0) using a dialysis method. The purified protein was quantified using absorbance and absorption coefficient at 280 nm wavelength. The purified human recombinant EpCAM protein was biotinylated for the library screening (EZ-LINK Sulfo-NHS-LC-Biotinylation kit, Pierce Inc., USA).
6.19 Example 18. Construction of EpCAM-Targeting Cyclic Peptide Library
[0286]
[0287] Specifically, the light chain variable region used in the screening of EP133 cyclic peptide-based affinity-enhanced EpCAM target cyclic peptide was the hT4-ep59 MG light chain variable region described (Korean Patent Application No. 10-2017-0152998, Antibody which internalize into the cytosol of cells and binds to inhibit activated Ras and use thereof). Several EpCAM target cyclic peptide sequences described in the art were analyzed, and random mutations were introduced into the amino acid residues which were predicted to play a critical role in antigen binding. A degenerated codon capable of including several amino acid sequences was used for the residues 1, 2, 4, 6 to 9, and 12. VRK was used for the residues 1 and 2 so that amino acid sequence having a polarity such as aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, and serine can be located at the position. BNK was used for the residue 4 so that all amino acid sequences except for isoleucine, lysine, asparagine, methionine, and threonine can be located at the position. The residues 6 to 9 were located inside the disulfide bond and were thought to play a critical role in antigen binding. Thus, NNK containing all amino acids was used for the position. YCA encoding Pro and Ser, which was maintained in the conventional patent (WIPO Publication No. WO2014042209A1), was used for the residue 12 (
[0288] DNAs encoding the designed library were amplified by PCR, and then concentrated by the ethanol precipitation method. Yeast surface expression vector (C-aga2) expressing aga2 protein at C-terminus for homologous recombination was treated with NheI/BamHI restriction enzyme. The result was purified by the agarose gel extraction method and concentrated by the ethanol precipitation method. Each 12 g of DNA encoding library was transformed by electroporation using yeast surface expression yeast Jar200 with 5 g of vector treated with restriction enzymes (Baek, Liss, Clancy, Chesnut, & Katzen, 2014). The serial dilution was carried out to calculate the number of colonies grown on selective medium SDU-CAA (20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na.sub.2HPO.sub.4, 8.6 g/L NaH.sub.2PO.sub.4, 5 g/L casamino acids, final concentration 0.002% Uracil) to confirm the library size.
6.20 Example 19. Identification of Affinity-Enhanced EpCAM-Targeting Cyclic Peptides
[0289] The biotinylated human recombinant EpCAM antigen prepared in Example 17 was used to screen EP133 peptide-based affinity-enhanced EpCAM-targeting cyclic peptide library constructed in Example 18.
[0290] Using SGU-CAA media (20 g/L galactose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na.sub.2HPO.sub.4, 8.6 g/L NaH.sub.2PO.sub.4, 5 g/L casamino acids, final concentration 0.002% Uracil), 1 M of purified EpCAM was reacted with yeast at room temperature for 1 hour, inducing the cell surface expression of the light chain variable region fused at the N-terminus with the cyclic peptide library (
[0291] Each step of the screen for high affinity EpCAM-targeting peptides was plotted following dual parameter flow cytometry (FACS) (
[0292]
[0293] Table 6 shows the selected 7 cyclic peptide sequences having the high binding ability to EpCAM.
TABLE-US-00007 TABLE6 Namesof Target Aminoacid SEQ cyclicpeptide receptor sequence IDNO: EP133 EpCAM 110 13 EHLHCLGSLCWP 3-27 110 14 RGLRCLGRLCWP 4-8 110 15 RNLLCIGNLCWP 4-12 110 16 RNLLCLRRICWP 4-13 110 17 RNLQCIRNICWS 4-14 110 18 RNLHCIGNLCWP 4-19 110 19 RNLRCIGNICWS 4-27 110 20 RHLWCLGRLCWP
6.21 Example 20. Analysis of Antigen Binding Ability of Affinity-Enhanced EpCAM Target Cyclic Peptide
[0294] The affinity-enhanced EpCAM target cyclic peptides, which were selected by the same method described in Example 2, were fused to the N-terminus of the light chain of the cell-penetrating humanized light chain hT4-59 using the MGSSSN linker (SEQ ID NO: 102), and then were cloned into the mammalian expression vector.
[0295] Table 7 shows sequences of light chain variable regions (VL) fused with the selected affinity-enhanced EpCAM target cyclic peptides.
TABLE-US-00008 TABLE7 Namesof lightchain SEQ variable ID regions Aminoacidsequence NO: hT4-ep59 1102030405060 21 MGVL EHLHCLGSLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 22 (3-27) RGLRCLGRLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 23 (4-8) RNLLCIGNLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 24 (4-12) RNLLCLRRICWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 25 (4-13) RNLQCIRNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 26 (4-14) RNLHCIGNLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 27 (4-19) RNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 28 (4-27) RHLWCLGRLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG MGVL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
[0296] RT22 heavy chain expression vector was described in (Korean Patent Application No. 10-2017-0152998, Antibody which internalize into the cytosol of cells and binds to inhibit activated Ras and use thereof). TheEpCAM-targeting cyclic peptide-fused cell-penetrating humanized light chain expression constructs were transiently co-transfected into BTEK293F cells to express affinity-enhanced EpCAMV-targeting cyclic peptide-fused anti-RasGTP iMab individual clones. Then, they were purified by the same method as in Example 2. The purified antibodies were named epRas03, epRas03 (3-27), epRas03 (4-8), epRas03 (4-12), epRas03 (4-13), epRas03 (4-14), epRas03 (4-19) and epRas03 (4-27).
[0297] In order to confirm the specific binding of these cyclic peptide-fused antibodies to EpCAM, the interaction was assayed by ELISA (enzyme-linked immunosorbent assay). The human recombinant EpCAM was bound to each well of a 96-well EIA/RIA plate at a concentration of 5 g/ml at room temperature for 1 hour. Then, they were washed with 0.1% PBST (PBS pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.1% Tween 20) for 10 minutes 3 times. Then, they were bound with 4% PBSB (PBS pH 7.4, 137 mM NaCl, 2.7 mM KCl 4% BSA) for 1 hour, and then washed with 0.1% PBST for 10 minutes 3 times. The affinity-enhanced EpCAM target cyclic peptide-fused anti-RasGTP iMab (epRas03, epRas03 (3-27), epRas03 (4-8), epRas03 (4-12), epRas03 (4-13), epRas03 (4-14), epRas03 (4-19) and epRas03 (4-27)) were diluted with 4% PBSB and bound at various concentrations of 100 nM, 10 nM and 1 nM at room temperature for 1 hour. Then, they were washed with 0.1% PBST for 10 minutes 3 times. Labeled antibodies were used for the conjugation to produce RP-conjugated anti-his mAb. The results were reacted with TMB ELISA solution, quantifying the absorbance at 450 nm.
[0298] The ELISA analysis indicated that the epRas03 (4-13) and epRas03 (4-19) showed higher antigen binding ability compared with epRas03 (
[0299] Surface plasmon resonance (SPR) was carried out using Biacore 2000 instrument in order to more quantitatively analyze the binding ability of the 7 affinity-enhanced cyclic peptide clones with the human recombinant EpCAM. The human recombinant EpCAM antigen was diluted with 10 mM NaAc buffer (pH 4.0) at a concentration of 20 l/ml. The diluted antigen was fixed on a CM5 sensor chip (GE healthcare) in about 211 response units (RU). Then, the analysis was performed using HBS-EP buffer at a flow rate of 30 l/min. The EpCAM target cyclic peptide-fused anti-RasGTP iMab was analyzed at a concentration of 6.25 nM from 100 nM. After the binding and disassociation analysis, the CM5 chip was regenerated by flowing a buffer (20 mM NaOH, 1 M NaCl, pH 10.0) at a flow rate of 30 l/min for 1 minute. Each sensorgram obtained at 3 minutes of binding and at 3 minutes of dissociation was compared with a blank cell for normalization, and affinity was calculated.
[0300] Table 8 shows the results of the affinity analysis of EpCAM and EpCAM target cyclic peptide-fused anti-RasGTP iMab using SPR (BIACORE 2000).
6.22
[0301]
TABLE-US-00009 TABLE 8 EpCAM k.sub.a (M.sup.1s.sup.1) k.sub.d (s.sup.1) K.sub.D (M) epRas03 1.36 10.sup.5 2.89 10.sup.3 2.13 10.sup.8 epRas03 (3-27), 2.96 10.sup.4 1.71 10.sup.3 5.78 10.sup.8 epRas03 (4-8) 7.37 10.sup.5 2.24 10.sup.3 3.04 10.sup.9 epRas03 (4-12) 6.64 10.sup.4 1.17 10.sup.3 1.77 10.sup.8 epRas03 (4-13) 5.69 10.sup.6 1.05 10.sup.3 .sup.1.85 10.sup.10 epRas03 (4-14) 1.12 10.sup.4 2.05 10.sup.3 1.83 10.sup.7 epRas03 (4-19) 5.38 10.sup.5 1.68 10.sup.3 .sup.3.13 10.sup.10 epRas03 (4-27) 4..24 10.sup.5 4.21 10.sup.3 9.94 10.sup.9
6.23 Example 21. Physical Properties of Affinity-Enhanced EpCAM-Targeting Cyclic Peptide-Fused Anti-RasGTP iMab
[0302] Zenix SEC-300 column analysis was conducted to evaluate the hydrophobicity of the 7 EpCAM-targeting cyclic peptide-fused anti-RasGTP iMabs constructed in Example 19. 80 l of each antibody was prepared at a concentration of 1 mg/ml, and then they were placed into an insert to prepare samples. For the Zenix SEC-300 size-exclusion chromatography column, the buffer of 20 mM Na.sub.3PO.sub.4 at pH 7.0 flowed at a flow rate of 1.0 ml/min. Then, the chromatography column was set when the pressure and the mAU values at 280 nm were stabilized. 10 l of the prepared samples were loaded at the same flow rate, and the mAU values were measured at 280 nm for 30 min.
[0303] Ep133 cyclic peptide-fused anti-RasGTP iMab (epRas03) had a similar peak to the control trastuzumab (
6.24 Example 22. Rational Design for Improving the Physical Properties of Affinity-Enhanced EpCAM-Targeting Cyclic Peptide-Fused Anti-RasGTP iMab
[0304] As confirmed in Example 21, the affinity-enhanced EpCAM-targeting cyclic peptide-fused anti-RasGTP iMabs exhibit high affinity to EpCAM, however, they have inferior physical properties than the Ep133 cyclic peptide from which they were derived. Thus, novel cyclic peptides were designed wherein the physical properties (e.g., low aggregation, hydrophobicity) are improved while maintaining the enhanced affinity exhibited by the cyclic peptide clones.
[0305] The first residue of the cyclic peptide is thought to be an important factor in determining physical properties of the cyclic peptides. The first residue of Ep133 (SEQ ID NO. 13) was glutamic acid, whereas all 7 cyclic peptide clones (SEQ ID NO. 14-20) had arginine, which tend to be non-specific, as the first residue. The first residue of cyclic peptides was thus changed to polar and charged amino acid residues such as glutamate, lysine, histidine, asparagine and aspartate. Used for the second residue were histidine from the parental peptide Ep133, and asparagine, the most frequently found residue among the 7 cyclic peptide clones. For the 4th and 12th residues, residues frequently found in the cyclic peptide clones with higher affinity, such as leucine, glutamine (4.sup.th) and serine (12.sup.th) were used. For the 6th to 9th residues, isoleucine, glycine, asparagine and leucine, the amino acid residues showing the highest frequency of occurrence at the respective position among the 7 cyclic peptide clones, were sequentially used. Based on the above logic, 9 new variants of cyclic peptides were rationally designed.
[0306] Table 9 lists the amino acid sequences of the 9 rationally designed cyclic peptides with improved physical properties. They were constructed using the overlapping PCR method.
TABLE-US-00010 TABLE9 Namesof SEQ cyclic Target Aminoacid ID peptides receptor sequence NO: EP133 EpCAM 110 13 EHLHCLGSLCWP Ep1 110 29 ENLLCIGNLCWS Ep2 110 30 EHLLCIGNLCWS Ep3 110 31 ENLQCIGNLCWS Ep4 110 32 EHLHCLGSLCWS Ep5 110 33 HNLRCIGNICWS Ep6 110 34 NNLRCIGNICWS Ep7 110 35 DNLRCIGNICWS Ep8 110 36 ENLRCIGNICWS Ep9 1 37 KNLRCIGNICWS
6.26 Example 23. Physical Properties of Rationally-Designed EpCAM-Targeting Cyclic Peptide
[0307] In order to improve the physical properties of the affinity-enhanced cyclic peptides, rationally-designed cyclic peptides (SEQ ID NO. 29-37) were fused to the N-terminus of the light chain of the cell-penetrating humanized light chain hT4-59 via the MGSSSN linker (SEQ ID NO: 102). They were then cloned into the mammalian expression vector using methods described in Example 2 above. Table 10 shows sequences of the rationally-designed cyclic peptides fused to light chain variable regions (VL) for improving physical properties (SEQ ID NO. 21-46).
TABLE-US-00011 TABLE10 Namesof lightchain SEQ variable ID regions Aminoacidsequence NO: hT4-ep59MG 1102030405060 21 VL EHLHCLGSLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 38 (ep1)MGVL ENLLCIGNLCWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 39 (ep2)MGVL EHLLCIGNLCWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 40 (ep3)MGVL ENLQCIGNLCWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 41 (ep4)MGVL EHLHCLGSLCWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 42 (ep5)MGVL HNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 43 (ep6)MGVL NNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 44 (ep7)MGVL DNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 45 (ep8)MGVL ENLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 46 (ep5)MGVL KNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
[0308] The anti-Ras-GTP RT22 heavy chain expression vector and the EpCAM-targeting cyclic peptide-fused cell-penetrating humanized light chain expression vectors were transiently co-transfected into HEK293F cells, thereby expressing affinity-enhanced EpCAM-targeting cyclic peptide-fused anti-Ras-GTP iMab individual clones. Antibodies were purified by the same method as described in Example 2 above. The purified antibodies were named epRas03, ep1-Ras03, ep2-RasO3, ep3-RasO3, ep4-RasO3, ep5-RasO3, ep6-RasO3, ep7-RasO3, ep8-Ras03 and ep9-RasO3.
[0309] To test if the rationally-designed cyclic peptides exhibited improved physical properties, fused antibodies were evaluated for hydrophobicity using high-performance liquid chromatography (Zenix SEC-300 column analysis). Specifically, 80 l of each antibody was prepared at a concentration of 1 mg/ml, and then placed into an insert to prepare samples. For the Zenix SEC-300 size-exclusion chromatography column, the buffer of 20 mM Na.sub.3PO.sub.4 at pH 7.0 flowed at a flow rate of 1.0 ml/min. Then, the chromatography column was set when the pressure and the mAU values at 280 nm were stabilized. 10 l of the prepared samples were loaded at the same flow rate, and the mAU values were measured at 280 nm for 30 min.
[0310] epRas03, ep3-Ras03, ep4-Ras03, ep6-Ras03, ep7-Ras03 and ep8-Ras03 cyclic peptide-fused anti-RasGTP iMab behaved similarly to the control trastuzumab (
[0311] Rational design of cyclic peptides resulted in improved physical properties for ep3-RasO3, ep4-RasO3, ep6-RasO3, ep7-RasO3 and ep8-Ras03.
6.27 Example 24. Antigen Binding Ability of Rationally-Designed Cyclic Peptide with Improved Physical Properties
[0312] It was confirmed that the EpCAM-targeting cyclic peptides described in Example 22 had improved physical properties as desired. Further experiments were conducted to confirm whether the improved affinity of the cyclic peptides for EpCAM described in Example 20 was maintained.
[0313]
[0314] The ELISA analysis indicated that the ep3-RasO3, ep4-RasO3, ep6-RasO3, ep7-Ras03 and ep8-Ras03 showed higher antigen binding ability compared with epRas-3 (
[0315] Surface plasmon resonance (SPR) was carried out using Biacore 2000 instrument in order to more quantitatively analyze the binding ability of the human recombinant EpCAM and the affinity-enhanced EpCAM-targeting cyclic peptide-fused anti-RasGTP iMabs. Specifically, the human recombinant EpCAM antigen was diluted with 10 mM NaAc buffer (pH 4.0) at a concentration of 20 l/ml. The dilute was fixed on a CM5 sensor chip (GE healthcare) in about 367 response units (RU). Then, the analysis was performed using HBS-EP buffer at a flow rate of 30 l/min. The ep3-RasO3, ep4-RasO3, ep6-RasO3, ep7-RasO3 and ep8-Ras03 were analyzed at a concentration of 6.25 nM from 100 nM. After the binding and disassociation analysis, the CM5 chip was regenerated by flowing a buffer (20 mM NaOH, 1 M NaCl, pH 10.0) at a flow rate of 30 l/min for 1 minute. Each sensorgram obtained at 3 minutes of binding and at 3 minutes of dissociation was compared with a blank cell to be normalized and subtracted, thereby calculating the affinity.
[0316] Table 11 shows the results of the SPR affinity analysis (BIACORE 2000) of EpCAM and the EpCAM-targeting cyclic peptide-fused anti-RasGTP iMabs variants that displayed both improved affinity and physical properties.
TABLE-US-00012 TABLE 11 EpCAM k.sub.a (M.sup.1s.sup.1) k.sub.d (s.sup.1) K.sub.D (M) epRas03 9.06 10.sup.4 .sup.1.94 10.sup.3 2.14 10.sup.8 ep3-Ras03 1.7 10.sup.6 .sup.3.6 10.sup.3 2.11 10.sup.9 ep4-Ras03 7.28 10.sup.5 .sup.9.05 10.sup.3 1.24 10.sup.8 ep6-Ras03 3.02 10.sup.6 3.02 10.sup.6 1.86 10.sup.9 ep7-Ras03 1.36 10.sup.6 1.36 10.sup.6 4.35 10.sup.9 ep8-Ras03 1.67 10.sup.6 1.67 10.sup.6 2.39 10.sup.9
[0317] The binding of the cyclic peptide variants to EpCAM on the cell surface in the human colon cancer cell line DLD-1 and the human cervical cancer cell line HeLa was analyzed by FACS. Specifically, DLD-1 cells (which express EpCAM) and HeLa cells (which do not express EpCAM) were prepared at 1105 cells per sample. The cells were cultured with 100 nM of ep3-RasO3, ep4-RasO3, ep6-RasO3, ep7-RasO3 or ep8-Ras03, in PBSF (PBS buffer, 2% BSA) at 4 C. for 1 hour. Then, each sample was incubated with Alexa488-linked secondary antibodies specific for human Fc at 4 C. for 30 minutes. After washing with PBS, the samples were analyzed by flow cytometry. The results indicated that all variants, ep3-RasO3, ep4-RasO3, ep6-RasO3, ep7-RasO3 and ep8-Ras03, showed an improved binding to EpCAM compared with epRas03 in the EpCAM positive cell line (DLD-1) (
6.29 Example 25. Analysis of Non-Specific Binding of Affinity-Enhanced EpCAM-Targeting Cyclic Peptides
[0318]
[0319] The results indicated that ep4-Ras03 and ep8-Ras03 showed greater nonspecific cell surface binding compared with epRas03 (
6.30 Example 26. Ep-Ras03, a CT with Enhanced Physical Properties and Enhanced, Selective EpCAM
[0320] The newly selected cyclic peptide ep-Ras03 was fused to the light chain variable region of the cell-penetrating antibody CT05 in order to impart the CTs with tumor cell/tissue-specificity. Ep6 cyclic peptide (SEQ ID NO. 34) was fused to the N-terminus of epCT05 (G4S) 2 VL constructed in Example 9 instead of Ep133. In this Example, two linkers (G.sub.4S).sub.2 and MGSSSN were used for fusing the Ep6 cyclic peptide.
[0321] The following Table 12 shows light chain variable region sequences of the physical property- and affinity-enhanced EpCAM target cyclic peptide-fused cell-penetrating antibody.
TABLE-US-00013 TABLE12 Namesof light chain SEQ variable ID regions Aminoacidsequence NO: hT4-ep59 1102030405060 21 MGVL EHLHCLGSLCWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-ep59 1102030405060 43 (ep6)MG NNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG VL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR epCT05 1102030405060 (G.sub.4S).sub.2VL EHLHCLGSLCWPGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQ 9 708090100110120130 QKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGT KVEIKR ep6-CT05 1102030405060 47 MGVL NNLRCIGNICWSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGTKVEIKR ep6-CT05 1102030405060 (G.sub.4S).sub.2VL NNLRCIGNICWSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQ 48 708090100110120130 QKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGT KVEIKR
[0322] Ep6 was cloned into the light chain mammalian expression vector as described in Example 2. It was transiently co-transfected with the heavy chain expression vector containing the heavy chain variable region containing the endosomal escape motif into BTEK293F cells, thereby expressing individual clones. They were purified by the same method as described in Example 2. The purified antibodies were named ep6-CT65(G.sub.4S).sub.2 and ep6-CT65 MG.
[0323]
[0324] The human recombinant EpCAM was bound to each well of a 96-well EIA/RIA plate at a concentration of 5 g/ml at room temperature for 1 hour in the same method as in Example 24. Then, they were washed with 0.1% PBST (PBS pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.1% Tween 20) for 10 minutes 3 times. Then, they were bound with 4% PBSB (PBS pH 7.4, 137 mM NaCl, 2.7 mM KCl, 4% BSA) for 1 hour, and then washed with 0.1% PBST for 10 minutes 3 times. The indicated EpCAM-targeting cyclic peptides were diluted in 4% PBSB and bound at various concentrations of 10 nM, 1 nM and 0.1 nM at room temperature for 1 hour. Then, they were washed with 0.1% PBST for 10 minutes 3 times. The labeled antibodies were used for the conjugation so as to produce RP-conjugated anti-His mAb. The results were reacted with TMB ELISA solution, thereby quantifying the absorbance at 450 nm.
[0325] The ELISA analysis indicated that the Ep6 cyclic peptide-fused ep6-CT65(G.sub.4S).sub.2 and ep6-CT65 MG showed higher antigen binding ability compared with the conventional Ep133 cyclic peptide-fused epCT65 (
6.31 Example 27. Construction of Integrin-Targeting Peptide RGD10-Based High-Diversity Peptide Library and Screening of Peptide with Enhanced Affinity Specific for Integrin v5
[0326] A search was conducted for a novel tumor tissue-specific receptor capable of the cellular internalization rather than EpCAM. RGD10 was selected due to its property of specifically binding to integrin (e.g., integrin v3 and integrin v5) which is overexpressed in neovascular cells and various tumors (DGARYCRGDCFDG (SEQ ID NO: 49)) (Holig, et al., 2004).
[0327] The RGD10 peptide show binding ability to integrin v3 and integrin v5. Integrin v3 is a receptor overexpressed in neovascular cells, making it suitable for targeting neovascular cells in tumor tissues, but is rarely expressed in tumor cells, into which antibodies should actually penetrate. Thus, the present work sought to increase the affinity for integrin v5, which is known to be overexpressed in tumor tissues.
[0328]
[0329] Specifically, the RGD10 cyclic peptide was fused with the MGSSSN linker (SEQ ID NO: 102) at the N-terminus of the hT4-59 light chain variable region (VL) so as to construct a template for the phage library. The complex structure of the RGD peptide and the integrin revealed that the C-terminus of the RGD peptide interacted with the beta chain of the integrin (Xiong, et al., 2002). Thus, two additional amino acids were added at the C-terminal direction of the RGD10 cyclic peptide so as to construct the cyclic peptide library consisting of 15 amino acids in total. Cysteine was fixed at the 6th and 10th residue, such that cysteine forms disulfide bonds with arginine, glycine and aspartate, respectively, which are the 7th to 9th residues an known to bind directly to integrin. The NNK degenerate codon, which can encode all amino acids, was introduced at residues 3, 5, 11, 13, 14 and 15 that are positioned outside the cyclic peptide. The 4th and 12th residues are expected to be responsible for binding to the integrin. For the 4th and 12th residues, respectively, the ARR degenerate codon was used to encode arginine and lysine that are positively charged amino acids so as to encode amino acids similar in nature to the wild-type peptide RGD10, and the GAN degenerate codon was used to encode aspartate and glutamate which are negatively charged amino acids.
[0330] Specifically, the DNAs encoding the designed library were amplified using the PCR and then concentrated using ethanol precipitation to obtain genes. After cleaving with SfiI restriction enzyme, they were ligated into pComb3X vector (Barbas, Burton, Scott, & Silverman, 2007) cleaved with the same restriction enzyme. Then, they were transformed into XL-1 Blue E. coli, which were cultured in a medium containing ampicillin, thereby obtaining a library having a size of 410.sup.8.
[0331]
[0332] Specifically, 5 g of recombinant human integrin v5 protein (R&D systems, 2528-AV-050) was added to the immunotube to allow the protein to adhere onto the surface of the tube for 1 hour. Then, 5% powdered milk containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2 and 2 mM CaCl.sub.2)) was added to the tube to prepare a condition for activating the integrin while shielding the surface on which the integrin v5 protein did not adhere. Then, the phage library of 10.sup.11 CFU diluted was placed in a solution of the powdered milk containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2 and 2 mM CaCl.sub.2)) so as to bind to the integrin. After washing with a TBST (Tris Buffered Saline-Tween 20) solution containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2 and 2 mM CaCl.sub.2)) in order to wash the non-specifically bound phages, the remaining phages were eluted with glycine solution (pH 2.2). The eluted phages were neutralized with an 1M Tris-HCl solution (pH 9.0), and they were transfected into XL-1 Blue E. coli. at 37 C. for 1 hour. Then, the transfected E. coli was suspended in SB (Super Broth) containing ampicillin and cultured at 37 C. When the absorbance of the 600 nm light of the culture solution became 0.5, 10.sup.12 PFU (plaque-forming unit) VSCM helper phage was added thereto. Then, while the mixture was slowly stirred, they were cultured at 37 C. for 1 hour. Kanamycin was added thereto, and the mixture was cultured overnight. The next day, the culture was centrifuged, and the supernatant containing the phage particles was completely isolated from the E. coli. Then, 4% PEG and 3% NaCl were added to concentrate the phage. The phage was then dissolved in TBS and stored. They were used for subsequent panning. The panning conditions were set so that the amount of antigen decreased and the number of washing increased as the number of times increased, thereby linking only stronger binding clones. At the 1st to 5th panning orders, the content of antigens was decreased to 5, 3, 2, 1, and 1 g, respectively, and the number of washes was increased to 3, 5, 10, 15, and 25, respectively.
[0333]
[0334] Specifically, after the 5th panning, the E. coli containing the antibody gene was applied to an LB agar medium containing ampicillin so as to obtain a single colony. The colony was inoculated and cultured in 200 l SB-ampicillin medium. IPTG induced the expression of cyclic peptide-light chain variable region proteins in the periplasm. After culturing at 20 C. overnight, the periplasm was extracted using a TES solution. ELISA was conducted on the periplasm to confirm its binding ability to the integrin v5 antigen.
[0335] Specifically, the respective integrin v5 proteins adhered to 96-well EIA/RIA plates at a concentration of 1 g/ml at room temperature for 1 hour. Then, 3% solution of powdered milk containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2 and 2 mM CaCl.sub.2)) was added to the wells so as to shield the surface to which the integrin v5 protein did not adhere. Then, they were washed with TBST solution containing divalent cations 3 times. The extracted periplasm solution bound for 1 hour. They were washed with TBST solution containing divalent cations 3 times. The labeled antibodies were used for the conjugation so as to produce HRP-conjugated anti-his mAb. The results were reacted with TMB ELISA solution, thereby quantifying the absorbance at 450 nm. Then, they were compared with the wild-type peptide RGD10.
[0336] The ELISA analysis revealed that 31 clones of 190 individual clones showed the higher binding ability to integrin v5 than the conventional cyclic peptides. A further test was conducted on these 31 individual clones. The results demonstrated that 15 individual clones showed repeated experimental results. Among these, clones with three or more positively charged amino acids expected to exhibit nonspecific binding were excluded.
[0337] The following Table 13 shows sequences for 8 individual clones targeting integrin v5 selected through the phage library.
TABLE-US-00014 TABLE13 Namesof SEQ cyclic ID peptides Targetreceptor Aminoacidsequence NO: RGD10 IntegrinV3, 110 49 IntegrinV5 DGARYCRGDCFDG in1 110 50 DGEKNCRGDCIEDQP in2 110 51 DGEKSCRGDCFDPSQ in3 110 52 DGVRACRGDCFDVQD in4 110 53 DGVRQCRGDCFDGPL in5 110 54 DGGRLCRGDCFDAQQ in6 110 55 DGERQCRGDCFDAPV in7 110 56 DGQRTCRGDCFDPPS in8 110 57 DGDKQCRGDCFDPAP
6.32 Example 28. Expression and Purification of Affinity-Enhanced Integrin v5-Targeting Cyclic Peptide-Fused iMabs
[0338] In order to evaluate the cyclic peptides specific for the selected human integrin v5, each cyclic peptide-fused intact IgG-type anti-Ras-GTP iMab was produced to perform the experiment.
[0339] Using the same method as described in Example 2 above, the selected affinity-enhanced integrin v5 target cyclic peptides were fused, by a genetic engineering method, at the N-terminus of the light chain of the cell-penetrating humanized light chain hT4-59 using an MGSSSN linker. Then, they were cloned into an animal expression vector.
[0340] The following Table 14 shows sequences of light chain variable regions (VL) fused with affinity-enhanced integrin v5 target cyclic peptides.
TABLE-US-00015 TABLE14 Namesof light chain SEQ variable ID regions Aminoacidsequence NO: hT4-i59 1102030405060 58 MGVL DGARYCRGDCFDGMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKP 708090100110120130 GKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 59 (in1) DGEKNCRGDCIEDQPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 60 (in2) DGEKSCRGDCFDPSQMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 61 (in3) DGVRACRGDCFDVQDMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 62 (in4) DGVRQCRGDCFDGPLMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 63 (in5) DGGRLCRGDCFDAQQMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 64 (in6) DGERQCRGDCFDAPVMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 65 (in7) DGQRTCRGDCFDPPSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 66 (in8) DGDKQCRGDCFDPAPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGK MGVL 708090100110120130 APKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
[0341] The heavy chain expression vector of RT22, which is an anti-RasGTP iMab, and the HEK293F protein expression cell were transiently co-transfected to express individual clones. They were purified in the same manner as in Example 2. The purified antibodies were named inRas03, in1-Ras03, in2-RasO3, in3-RasO3, in4-RasO3, in5-RasO3, in6-RasO3, in7-Ras03 and in8-Ras03.
[0342]
[0343] The results showed a molecular weight of about 150 kDa under non-reducing conditions (DTT) and a molecular weight of 50 kDa for the heavy chain and 25 kDa for the light chain under reducing conditions (DTT+). These results indicated that the expressed and purified individual clones were present as a monomer in a solution state and did not generate a dimer or oligomer through a non-natural disulfide bond.
6.33 Example 29. Analysis of Binding Ability of Affinity-Enhanced Integrin v5 Target Cyclic Peptide-Fused iMab to Human Integrin v5
[0344] In order to analyze the binding ability of the anti-RasGTP iMab fused with the cyclic peptide having enhanced affinity to the integrin v5 for the human integrin v5, ELISA and flow cytometry (FACS) were conducted on the binding ability of the activated integrin v5 fixed on the plate and the activated integrin v5 expressed in cells.
[0345] The respective integrin v5 proteins adhered to 96-well EIA/RIA plates at a concentration of 1 g/ml at room temperature for 1 hour. Then, 3% solution of powdered milk containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2 and 2 mM CaCl.sub.2)) was added to the wells so as to transform activated integrin during shielding the surface to which the integrin v5 protein did not adhere. Then, they were washed with a TBS-T solution containing divalent cations 3 times. They had bound to inRas03, in1-Ras03, in2-Ras03, in3-Ras03, in4-Ras03, in5-Ras03, in6-Ras03, in7-Ras03 and in8-Ras03 diluted with TBS containing divalent cations for 1 hour. Then, they were washed 3 times with TBST solution containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2 and 2 mM CaCl.sub.2)). The labeled antibodies were used for the conjugation so as to produce HRP-conjugated anti-Fc mAb. The results were reacted with TMB ELISA solution, thereby quantifying the absorbance at 450 nm. Then, they were compared with the antibodies fused with the wild-type peptide RGD10 as a control.
[0346] The ELISA analysis revealed that 5 peptides (in4-8) among 8 kinds of cyclic peptides selected showed the higher binding ability to integrin v5 compared with the conventional RGD10-fused antibody.
[0347] Specifically, HT29 (integrin v5+) was prepared at 1105 cells per sample. The cells were cultured with 100 nM of inRas03, in1-Ras03, in2-Ras3, in3-Ras03, in4-Ras03, in5-Ras03, in6-Ras03, in7-Ras03 and in8-Ras03, respectively, in TBSF (TBS buffer, 2% BSA) containing divalent cations (1 mM MnCl.sub.2, 1 mM MnCl.sub.2 and 2 mM CaCl.sub.2)) at 4 C. for 1 hour. Then, each antibody was reacted with antibodies specific for human Fc to which Alexa488 (green fluorescence) was linked at 4 C. for 30 minutes. After they were washed with TBS containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2), the cells were analyzed by flow cytometry. The results demonstrated that in4-Ras03, in6-Ras03 and in7-Ras03 showed the high intensity of fluorescence for binding to the cells compared with inRas03.
[0348] The results showed the stronger binding ability than RGD10 in the ELISA and the strongest binding to cell surface integrin v5. Further experiments were performed using in4 cyclic peptide.
[0349]
[0350] Specifically, 210.sup.5 cells of HCT8 were placed in 4 ml medium containing 10% FBS in a 60-pi culture dish, and they were cultured in a condition of 5% CO.sub.2 at 37 C. for 12 hours. After culturing for 24 hours, siRNA was transiently transfected. 100 nM the control siRNA having no targeting ability for the transient transfection and siRNA targeting inhibition of integrin 5 expression, respectively, were reacted with 1 ml Opti-MEM media (Gibco) and 3.5 l Lipofectamine 2000 (Invitrogen, USA) for 10 min at room temperature, and then they were added to each well. Further, 1 ml DMEM media without antibiotics was added thereto. The mixtures were cultured in 5% CO.sub.2 at 37 C. for 6 hours. Thereafter, their medium was changed to 4 ml DMEM medium containing 10% FBS, and then the cells were cultured for 48 hours.
[0351] The results showed that expression of integrin v5 of HCT8 was inhibited by 5 siRNA. Further, when treating with the control siRNA, in4-RasO3 showed the stronger binding ability to integrin v5 than wild-type peptide (RGD10). On the other hand, in HCT8, which did not express integrin v5 by treating with 5 siRNA treatment, both antibodies showed no binding ability and exhibited a binding ability similar to that of Ras03. This indicated that in4-RasO3 binds specifically to integrin v5.
6.34 Example 30. Analysis of the Binding Ability of Cell-Penetrating Antibody Fused with Affinity-Enhanced Integrin v5 Target Cyclic Peptide to Cell Surface Integrin v5
[0352] A cell-penetrating antibody has been developed can be applied to various tumor tissues by fusing cyclic peptides targeting integrin v5 as well as EpCAM to cell-penetrating antibodies as well as anti-RasGTP iMabs. Thus, RGD10 and in4 cyclic peptides, instead of Ep133, were fused to the N-terminus of epCT05 (G4S)2 VL constructed in Example 9. In this Example, MGSSSN was used as a linker for fusing RGD10 and in4 cyclic peptides.
[0353] The following Table 15 shows sequences of the light chain variable region of cell-penetrating antibodies fused with wild-type and affinity-enhanced integrin v5 target cyclic peptides.
TABLE-US-00016 TABLE15 Namesof light chain SEQ variable ID regions Aminoacidsequence NO: hT4-i59 1102030405060 58 MGVL DGARYCRGDCFDGMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGKA 708090100110120130 PKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 1102030405060 62 (in4)MG DGVRQCRGDCFDGPLMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG VL 708090100110120130 KAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR inCT05 1102030405060 67 MGVL DGARYCRGDCFDGMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPGKA 708090100110120130 PKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGTKVEIKR in4-CT05 1102030405060 68 MGVL DGVRQCRGDCFDGPLMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSRDGKNYLAWYQQKPG 708090100110120130 KAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQQYWYWMYTFGGGTKVEIKR
[0354] The light chain variable region fused with the affinity-enhanced integrin v5 target cyclic peptide was cloned into a light chain animal expression vector in the same manner as in Example 2. Then, they were transiently co-transfected into the heavy chain expression vector containing the heavy chain variable region with the endosomal escape motif and the HEK293F protein expression cell so as to express individual clones. They were purified in the same manner as in Example 2. They were named inCT65 and in4-CT65, respectively. Further experiments were performed with in4-CT65 fused with affinity-enhanced in4 cyclic peptides.
[0355]
[0356] Specifically, 110.sup.5 cells of MCF-7 (integrin v5+) and Raji (integrin v5-), respectively, were prepared for each sample. The cells were cultured with 10 mM in4-CT65 in TBSF (TBS buffer, 2% BSA) containing divalent cations (1 mM MnCl.sub.2, 1 mM MnCl.sub.2 and 2 mM CaCl.sub.2)) at 4 C. for 1 hour. Then, each sample was incubated with antibodies specific for human Fc to which Alexa488 (green fluorescence) was linked at 4 C. for 30 minutes. After washing with TBS containing divalent cations, they were analyzed by a flow cytometer. The results indicated that the cell-penetrating antibody comprising the affinity-enhanced cyclic peptides showed binding to the MCF-7 cell line expressing integrin v5, but not to the Raji cell line not expressing integrin v5 showed no binding ability.
[0357] The results showed that the antibody, in which the affinity-enhanced integrin v5 target cyclic peptide in4 was fused at N-terminus of the light chain of the cell-penetrating antibody, which was a different kind of an antibody, showed specific binding ability to the integrin v5.
6.35 Example 31. Confirmation of Enhancement of Tumor Tissue Targeting Ability of Affinity-Enhanced EpCAM or Integrin v5 Target Cyclic Peptide
[0358]
[0359] Specifically, 20 g of DyLight fluorescence-labeled anti-RasGTP iMab Ras03, epRas03, and ep6-RasO3, respectively, were injected into human colorectal LoVo tumor xenografted BALB/c nude mice. The fluorescence emitted from the whole body of mice were observed by IVIS Lumina XRMS Series III (Perkin Elmer) at 0, 6, 12, 24, 48 and 72-hours, respectively. In this Example, the mice were anesthetized using 1.5% to 2.5% isoflurane (Piramal Critical Care). Each image was analyzed by Living Image software (Perkin Elmer) so as to quantify fluorescence values of the whole body.
[0360] As illustrated in
[0361] After the experiments as described above, the mice were euthanized 72 hours after the antibody injection. Then, the tumor as well as the heart, lung, liver, kidney, pancreas and spleen were excised, and the fluorescence in the organs was quantified by living image software (Perkin Elmer).
[0362] As illustrated in
[0363]
[0364] Specifically, 20 g of DyLight fluorescence-labeled anti-RasGTP iMab Ras03, inRas03, and in4-RasO3, respectively, were injected into human colorectal LoVo tumor xenografted BALB/c nude mice. The fluorescence emitted from the whole body of mice were observed by IVIS Lumina XRMS Series III (Perkin Elmer) at 0, 6, 12, 24, 48 and 72-hours, respectively. In this Example, the mice were anesthetized using 1.5% to 2.5% isoflurane (Piramal Critical Care). Each image was analyzed by Living Image software (Perkin Elmer) so as to quantify fluorescence values of the whole body.
[0365] As illustrated in
[0366] Specifically, after the experiments as described above, the mice were euthanized 72 hours after the antibody injection. Then, the tumor and the heart, lung, liver, kidney, pancreas and spleen were excised, and the fluorescence in the organs was quantified by living image software (Perkin Elmer).
[0367] As illustrated in
6.36 Example 32. Construction of Additional Phage Libraries Based on In4 Cyclic Peptide
[0368] Integrin v5 and integrin v6 are overexpressed by cells of several tumors. The in4 cyclic peptide, having high affinity to integrin v5, has been selected as described in Example 27 above. To screen for additional peptides that can bind to integrin v5 and integrin v6 with high affinity, additional phage libraries were constructed.
[0369]
[0370] The RGD motif of the in4 cyclic peptide is immediately flanked by single cysteine on both sides. The loop structure of the cyclic peptide was made wider by expanding the number of amino acids between these two cysteine residues. In particular, between the cysteines at positions 6 and 10, two amino acids were added N-terminal to the RGD motif, and four amino acids were added C-terminal to the RGD motif. As a result, the cyclic peptide forms a loop structure of 9 amino acids between the two cysteines. The overall length of the cyclic peptide was then increased by adding four amino acids N-terminal to the cysteine at position 6 and four amino acids C-terminal to the cysteine at position 10. To generate a cyclic peptide library, the NHB degenerate codon, which can encode phenylalanine, isoleucine, leucine, methionine, valine, serine, proline, threonine, alanine, tyrosine, histidine, glutamine, asparagine, lysine, aspartic acid, and glutamic acid, was introduced at residues 1, 3, 5 and 18 of the peptide. The NNK degenerate codon, which can encode all 20 amino acids, was introduced in the 2nd, 4th, 7th, 8th, 14th, 15th, 17th, and 19th residues. The 5#1 and 5#2 libraries, created to target integrin v5, were designed to have serine (5#1) or threonine (5#2) as the 12th amino acid immediately following the RGD motif and phenylalanine as the 13th amino acid (both), because, in proteins having an affinity for integrin v5, the first amino acid after RGD was often serine or threonine and the second amino acid after RGD was often phenylalanine (Rubtsov, Syrkina et al. 2016). To generate the 6# cyclic peptide library, designed to target integrin v6, leucine was used as the 12th amino acid immediately following the RGD motif and phenylalanine was used as the 13th amino acid. MTH degenerate codon encoding leucine or isoleucine were introduced at the 15th amino acid. The 6# library was designed this way because it was known that proteins with ability to bind integrin v6 generally have an LXXL or LXXI motif after the RGD motif (Rubtsov, Syrkina et al. 2016).
[0371] The DNA encoding each of the designed libraries was amplified using PCR. The 5#1, 5#2, and 6# libraries were amplified individually, and then combined and concentrated using ethanol precipitation. The resulting DNA was cleaved with restriction enzymes EcoRI and NheI to form sticky ends, and then the phage display vector pComb3X vector was linearized with the same restriction enzymes. The restriction enzyme-cleaved insert gene and the linearized vector gene were ligated by T4 ligase. The library DNA was transformed into XL1-blue competent cells via electroporation. The library was cultured in a medium containing ampicillin to finally generate a library with a size of 310.sup.8 phage molecules.
[0372]
[0373] Specifically, the extracellular domain portion of integrin v chain (31 Phe-992 Val), the extracellular domain portion of integrin 5 chain (24 Gly-719 Asn), and the extracellular domain portion of integrin 6 chain (22 Gly-709 Pro) were used as antigens. The integrin is a heterodimer composed of chain and chain. To replicate this, the chain was fused at the C-terminus of the extracellular domain with a negatively charged leucine zipper of integrin via a linker consisting of 10 amino acids in HPGGGSGGGS sequence (SEQ ID NO: 104), and the leucine zipper was fused at the C-terminus with a 6His tag for purification. The chain was fused at the C-terminus of the extracellular domain with a positively charged leucine zipper via the same linker as was used for the chain. The integrin DNA was constructed by PCR and cloned into the animal cell expression vector pcDNA3.4 vector using restriction enzymes NotI and BamHI. The resulting chain vector and chain vector were simultaneously transfected transiently into HEK293F protein-expressing cells and expressed for 6 days, and proteins present in the supernatant were purified using Ni-NTA Agarose resin.
[0374]
[0375] Specifically, it was shown that chain and chain exist at a molecular weight of 100 to 155 kDa under the reducing condition, indicating that the proteins expressed as both the chain and chain are purely present as a heterodimer.
[0376]
[0377] Specifically, integrin v5 and integrin v6 purified using above methods and commercially available integrin v5 and integrin v6 were fixed on 96-well EIA/RIA plates. Recombinant human integrin v5 (ACRO Biosystems, IT5-H52W5) and integrin v6 (ACRO Biosystems, IT6-H52E1) were used for the commercially available recombinant human integrins. The antigens were fixed at a concentration of 2 g/mL for 1 hour at room temperature. 3% skim milk solution containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2)) was added to the wells to shield the non-adsorbed side of the antigen. Thereafter, the wells were washed 3 times for 10 minutes with a TBS-T (TBS with 0.05% Tween20) solution containing divalent cations. As the negative control for integrin v5 and integrin v6, anti-Ras-GTP iMab not fused with cyclic peptide was used at a concentration of 20 nM. Commercially available mouse anti-integrin v3 antibody (R&D, MAB3050) was diluted 1:100 and processed. For validation of each integrin v5, commercially available mouse anti-Integrin v5 antibody (R&D, MAB2528, diluted 1:100) and anti-Ras iGTP iMab fused with cyclic peptide in4 with improved affinity for integrin v5 were used at a concentration of 20 nM. For validation of each integrin v6, anti-Ras-GTP iMab fused with cyclic peptide SFITGv6, known to specifically bind to integrin v6 (Altmann, Sauter et al. 2017), and commercially available mouse anti-integrin v6 antibody (Millipore, MAB2077Z, diluted 1:200), were used at a concentration of 20 nM. All antibody incubations were for 1 hour at room temperature. After washing 3 times for 10 minutes in the same manner as described above, HRP-conjugated anti-human antibody (HRP-conjugated anti-human mAb) and anti-mouse antibody (HRP-conjugated anti-mouse maAb) were added for 30 minutes at room temperature. Subsequently, the wells were washed 3 times for 10 minutes, and treated with TMB ELISA solution, and the absorbance at 450 nm was quantified.
[0378] The above-described ELISA experiments show that human recombinant integrin v5 and v6 expressed and purified according to the above methods are equivalent to commercially available recombinant integrin v5 and v6. For further experiments, human recombinant integrins that were expressed and purified according to the above method were used.
[0379] Table 16 below shows the protein sequences of human recombinant integrin v, 5, and 6 chains used to produce human recombinant integrin v5 and v6.
TABLE-US-00017 TABLE16 SEQ Antigen ID Names Aminoacidsequence NO: Integrin 1102030405060 70 V FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCD Extra- 708090100110120 cellular WSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ domain- 130140150160170180 Acidic EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ Leucine 190200210220230240 zipper- GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFV Hisx6 250260270280290300 SGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLF 310320330340350360 MDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAI 370380390400410420 AAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYP 430440450460470480 DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLK 490500510520530540 ADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIA 550560570580590600 YLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN 610620630640650660 VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNN 670680690700710720 EALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSS 730740750760770780 NLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIY 790800810820830840 ELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQT 850860870880890900 TEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVK 910920930940950960 SLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPM 97098099010001010 PVHPGGGSGGGSGGSAQLEKELQALEKENAQLEWELQALEKELAQGATHHHHHH Integrin 1102030405060 71 5Extra- GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPA cellular 708090100110120 domain- SSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYL Basic 130140150160170180 Leucine MDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCI zipper 190200210220230240 GYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKI 250260270280290300 GWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLG 310320330340350360 EKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVE 370380390400410420 LSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFA 430440450460470480 LRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDG 490500510520530540 ENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLC 550560570580590600 SGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGE 610620630640650660 MCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCF 670680690700710720 YKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNHPGGGSGGGSGGSAQLKKKLQALK 730740 KKNAQLKWKLQALKKKLAQGAT Integrin 1102030405060 72 6Extra- GCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGCQLNFIENPVSQ cellular 708090100110120 domain- VEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDL Basic 130140150160170180 Leucine SASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIP zipper 190200210220230240 YFCLPTFGFKHILPLTNDAERFNEIVKNQKISANTDTPEGGFDAIMQAAVCKEKIGWRND 250260270280290300 SLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQ 310320330340350360 NNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLG 370380390400410420 DTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLG 430440450460470480 DALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDS 490500510520530540 CKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDCG 550560570580590600 ECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCG 610620630640650660 DPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLIT 670680690700710720 FLITTDNEGKTIIHSINEKDCPKPPNIPHPGGGSGGGSGGSAQLKKKLQALKKKNAQLKW 730 KLQALKKKLAQGAT
[0380]
[0381] Specifically, the human recombinant integrin v5 and v6 expressed and purified in
[0382]
[0383] Specifically, the bacteriophages obtained after the 5th round of panning were used to infect XL1-blue E. coli, which were then plated on LB agar plate containing ampicillin to obtain a single colony. The colony was then inoculated in 200 L SB-ampicillin medium and incubated at 37 C. for 2 hours and induced to express the protein fused with the cyclic peptide-VL with IPTG in the periplasmic space. After incubation at 30 C. overnight, the periplasmic extract was obtained by osmotic shock to E. coli using periplasmic extraction solution (200 mM Tris-HCl, pH 8.0, 500 mM Sucrose). Divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2)) were added to the extract of this periplasm, and ELISA was used to analyze the ability of individual clones to bind human recombinant integrin v5 and v6.
[0384] Specifically, 96-well EIA/RIA plates were used to adsorb integrin v5 and integrin v6 at a concentration of 2 g/mL and a buffer only, containing no antigen, in a off-target analysis for 1 hour at room temperature. 3% skim milk solution containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2)) was added to the wells to block the surface on which the antigen was not adsorbed. The periplasmic extracts containing the divalent cations obtained from the individual clones were placed in each well, bound at room temperature for 1 hour, and washed with TBS-T containing divalent cations for 3 times for 10 minutes. Each phage particles were labeled with HRP-conjugated secondary antibody that specifically recognizes the human influenza hemagglutinin (HA) tag. TMB-ELISA solution was used to determine the absorbance at 450 nm. The absorbance of the off-target wells was used to normalize the binding signal, and the normalized signal of each clone was compared with that of the parental cyclic peptide in4.
[0385] Through the above ELISA analysis, it has been confirmed that 65 out of 94 of individual clones obtained from a library panned using recombinant human integrin v5 showed higher binding affinity for integrin v5 than parental cyclic peptide in4. And 52 out of 94 individual clones obtained from a library panned using recombinant human integrin v6 showed higher binding affinity for integrin v6 than the parental cyclic peptide in4.
[0386] Table 17 below shows the amino acid sequences of 12 individual clones capable of binding to integrin v5 or integrin v6 selected via the phage library panning and the cyclic peptide SFTIGv6 reported to have the ability to bind strongly to integrin v6.
TABLE-US-00018 TABLE17 Namesof SEQ cyclic ID peptides Targetreceptor Aminoacidsequence NO: 5#1 Integrinv5 110 73 LPSGACVVRGDTFQCVSVG 5#2 110 74 ASYNDCQSRGDTFCVAD 5#3 110 75 SRDETCTPRGDTFAIC 5#4 110 76 EHATNCTTRGDTFVVLCGLG SFITGv6 Integrinv6 110 77 GRCTFRGDLMQLCYPD 6#1 110 78 NENPDCPRRGDLFHICLKWP 6#2 110 79 HVEFPCTRRGDLFVLCEGS 6#3 110 80 TAIEPCKNRGDLFMLCSA 6#4 110 81 ESFRPCQYRGDLFVLCFPSD 6#5 110 82 TLIKACHRRGDTFVLCEHYS 6#6 110 83 LGPLPCQTRGDLFSLCHY 6#7 110 84 DRDRHCNKRGDLFSLCALRS 6#8 110 85 FPNNQCQHRGDLFALCAD
6.37 Example 33. Expression and Purification of iMab Fused Cyclic Peptide with Improved Affinity for Integrin v5 and Integrin v6
[0387] In order to evaluate four cyclic peptides selected from the above phage library that were expected to have the ability to bind integrin v5, and eight cyclic peptides expected to have the ability to bind integrin v6, each cyclic peptide was genetically fused at the N-terminus of the light chain using an MGSSSN linker (SEQ ID NO: 102) to produce the full IgG form of the anti-Ras-GTP iMab for further experiments.
[0388] Specifically, in the same manner as described in Example 2 above, the selected integrin targeting cyclic peptide was genetically fused to the N-terminus of the cell penetrating human light chain hT4-59 light chain. An animal cell expression vector pcDNA3.4 vector was cloned using restriction enzymes NotI and BamHI.
[0389] Table 18 below shows the sequences of light chain variable region (VL) fused with affinity maturated integrin v5 and integrin v6-targeting cyclic peptides.
TABLE-US-00019 TABLE18 Namesof light chain SEQ variable ID regions Aminoacidsequence NO: hT4-i59 11020304050 86 (5#1) LPSGACVVRGDTFQCVSVGMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLL MGVL 60708090100 NSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 110120130 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 87 (5#2) ASYNDCQSRGDTFCVADMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLL MGVL 60708090100 NSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 110120130 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 88 (5#3) SRDETCTPRGDTFAICMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLL MGVL 60708090100 NSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 110120130 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 89 (5#4) EHATNCTTRGDTFVVLCGLGMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLL MGVL 60708090100110 NSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 120130140 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 90 (SFITGv6) GRCTFRGDLMQLCYPDMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLNSR MGVL 60708090100110 DGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPED 120130 FATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 91 (6#1) NENPDCPRRGDLFHICLKWPMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSL MGVL 60708090100110 LNSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 120130 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 92 (6#2) HVEFPCTRRGDLFVLCEGSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLL MGVL 60708090100110 NSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQP 120130 EDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 93 (6#3) TAIEPCKNRGDLFMLCSAMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLN MGVL 60708090100110 SRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQP 120130 EDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 94 (6#4) ESFRPCQYRGDLFVLCFPSDMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSL MGVL 60708090100110 LNSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 120130140 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 95 (6#5) TLIKACHRRGDTFVLCEHYSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSL MGVL 60708090100110 LNSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 120130140 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 96 (6#6) LGPLPCQTRGDLFSLCHYMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLN MGVL 60708090100110 SRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQP 120130 EDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 97 (6#7) DRDRHCNKRGDLFSLCALRSMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSL MGVL 60708090100110 LNSRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSL 120130140 QPEDFATYFCQQYWYWMYTFGQGTKVEIKR hT4-i59 11020304050 98 (6#8) FPNNQCQHRGDLFALCADMGSSSNDIQMTQSPSSLSASVGDRVTITCKSSQSLLN MGVL 60708090100110 SRDGKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQP 120130 EDFATYFCQQYWYWMYTFGQGTKVEIKR
[0390] The RT22 heavy chain expression vector is described in Korean Patent Application No. 10-2017-0152998, Antibody which internalize into the cytosol of cells and binds to inhibit activated Ras and use thereof). The Integrin v5 and integrin v6 targeting cyclic peptide-fused anti-Ras-GTP iMab expression constructs were transiently co-transfection into BEK293F protein-expressing cells. Individual clones were expressed as full IgG and purified as described in Example 2 above.
[0391]
[0392] Specifically, each of anti-Ras GTP iMab antibody fused with cyclic peptides affinity maturated for integrin v5 or integrin v6 was prepared in 25 L at a concentration of 1 mg/mL, and then placed in the insert before the sample was added. In the case of a Superdex size exclusion chromatography column, PBS (pH 7.4) buffer was flowed at a flow rate of 0.75 mL/min. After pressure and mAU values had stabilized, the analysis was started. The preparation sample was then loaded with 10 L at the same flow rate and the mAU value at 280 nm for 35 minutes was measured using high performance liquid chromatography.
[0393] Most of the clones were similar to the Ras03 antibody used as the control, which is not fused with the cyclic peptide, in that they were present as a monomer in a liquid phase. However, among the cyclic peptides targeting the integrin v6, Ras03 fused with the 6#2 and 6#5 cyclic peptides exhibited abnormal peaks, and no peaks were observed with antibodies fused with the 6#7 cyclic peptide. This is because the proportion of positively charged amino acids in the amino acid sequence of the three cyclic peptides is large, and it is likely that the peak is not correctly observed due to nonspecific binding to the resin in the column.
6.38 Example 34. Identification of Non-Specific Binding of Affinity Maturated Cyclic Peptides Fused Anti-Ras-GTP iMab
[0394] In order to analyze non-specific binding ability of the anti-Ras-GTP iMab fused with the cyclic peptide candidates targeting integrin v5 and integrin v6, which were affinity maturated as described in the above Example 33, (Jain, Sun et al. 2017), ELISA was carried out using 3 kinds of antigens, dsDNA, keyhole limpet hemocyanin (KLH), and cardiolipin, which can confirm nonspecific binding of the antibody.
[0395]
[0396] Specifically, 1 g/mL of dsDNA (Sigma, D4522), 5 g/mL of Keyhole limpet hemocyanin (Sigma, H8283), and 10 g/mL of cardiolipin (Sigma, C0563), were added to 96-well EIA/RIA plate, diluted with PBS, and adsorbed to the plate surface at room temperature for 1 hour. Then, 3% skim milk in PBS was added to the wells to block the non-adsorbed side of the antigen. Subsequently, the plates were washed three times for 10 minutes with PBS-T solution containing 0.05% Tween 20 with PBS, and each antibody was diluted with the blocking solution to a concentration of 500 nM and incubated at room temperature for 1 hour. TMab4 was used as a positive control. TMab4 is an antibody having a large amount of amino acids with a cation in CDR-L1, and is known to bind nonspecifically with HSPG. As a negative control, Ras03, an anti-Ras-GTP iMab without cyclic peptide, and adalimumab were used. After washing with PBS-T for 3 times for 10 minutes, HRP-conjugated anti-human mAb (HRP conjugated anti-human mAb) was added to the plate for 1 hour at room temperature, and the plates were then reacted with TMB ELISA solution and absorbance at 450 nm was quantified.
[0397] It was determined from the above experiment that there is non-specific binding when the absorbance at 450 nm is more than 0.05 for at least one of the three antigens. Thus, it was confirmed that cyclic peptide candidates 6#2, 6#3, 6#5, 6#7, and 6#8 have non-specific binding ability.
6.39 Example 35. Binding Ability Analysis of Anti-Ras-GTP iMab Fused with Affinity Maturated Cyclic Peptides Targeting Human Integrin v5 or Human Integrin v6
[0398] The binding ability of anti-Ras-GTP iMab fused with affinity maturated cyclic peptides targeting human integrin v5 or human integrin v6, expressed and purified as described in Example 33 above, was determined using Flow cytometry (FACS) against cells expressing integrin v5 or integrin v6 on the surface. To quantify the affinity, the kinetics were measured by Octet instrument (ForteBio) based on the principle of BLI (Bio-Layer Interferometry).
[0399]
[0400] Specifically, 1105 cells were prepared for each sample. The cells were incubated with inRas03 and in4-RasO3 (anti-Ras-GTP iMab fused with parental cyclic peptides, RGD10 and in4, respectively), and anti-Ras-GTP iMabs fused with the four cyclic peptides selected through the phage library (5#1, 5#2, 5#3, 5#4) at a concentration of 20 nM for 1 hour at 4 C. Each sample was then incubated with an antibody conjugated with Alexa488 (green fluorescence) label specifically recognizing human Fc at 4 C. for 30 minutes. After washing with TBSF solution containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2), the fluorescence value of each cell was analyzed using a flow cytometer.
[0401] It was confirmed from the above experiment that anti-Ras-GTP iMab fused with 5#1 cyclic peptide showed stronger binding ability to cells expressing integrin v5 than anti-Ras-GTP iMab fused with parental in4 cyclic peptide. The anti-Ras-GTP iMab fused with the 5#1 cyclic peptide showed the same degree of binding in the four cell lines expressing integrin v5, and in those four cell lines, anti-Ras-GTP iMab fused with the 5#1 cyclic peptide showed stronger binding than anti-Ras-GTP iMab fused with parental cyclic peptide in4. The non-specific binding was determined by using Raji and Ramos cell line that does not express integrin. None of the four clones bound to Raji or Ramos cell, indicating that none of the four clones has non-specific binding ability.
[0402]
[0403] Specifically, each sample was prepared in the same manner as shown in
[0404] It was confirmed from the above experiment that the anti-Ras-GTP iMab fused with the cyclic peptides screened through the phage library (6#1, 6#2, 6#3, 6#4, 6#5, 6#6, 6#7, 6#8) exhibited higher binding ability to the integrin v6 expressed on the cell surface than the anti-Ras-GTP iMab fused with the parental peptide (RGD10, in4). However, in the Raji cell line not expressing integrin, it was confirmed that the anti-Ras-GTP iMab fused with 6#5 and 6#7 cyclic peptides showed non-specific binding. Among the remaining cyclic peptides, anti-Ras-GTP iMab fused with 6#1 cyclic peptide exhibited the lowest binding ability to the BxPC-3 cell line expressing integrin v6. Thus, only the anti-Ras-GTP iMabs fused with cyclic peptides 6#2, 6#3, 6#4, 6#6, 6#8 were used for further study.
[0405]
[0406] Specifically, each sample was prepared in the same manner as described in
[0407] As a result of the above experiment, it was confirmed that the anti-Ras-GTP iMabs fused with the five cyclic peptides targeting integrin v6 exhibited almost the same binding affinity to the cell line expressing the integrin v6. All the 5 cyclic peptides showed significantly higher binding ability than the parental cyclic peptide in4 fused anti-Ras-GTP iMab. And for Ramos cell lines that do not express integrin, none of the clones showed binding ability, indicating that none of the clones had non-specific binding ability.
[0408]
[0409] Specifically, anti-Ras-GTP iMab fused with an integrin v5 target cyclic peptide having improved affinity was diluted with TBS containing a divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2)) and 0.02% Tween 20, at a concentration of 2 g/mL to immobilize on the anti-human IgG Fc (AHC) biosensor. Subsequently, the recombinant human integrin v5 protein was analyzed for association and dissociation at concentrations of 100 nM, 50 nM, 25 nM, 12.5 nM, 6.2 nM and 3.1 nM for 300 seconds and 900 seconds, respectively. After the analysis, immersion for 5 seconds in pH 2.2 glycine solution and pH 7.4 TBS solution for regeneration of AHC biosensor was repeated three times. The affinities were calculated by normalizing the results by excluding the results of blank spaces that did not contain integrin.
[0410] When the affinity was measured by the above-described method, anti-Ras-GTP iMab antibody fused with 5#1 cyclic peptide showed binding affinity similar to that against cell surface integrin v5. The anti-Ras-GTP iMab fused with 5#1 cyclic peptide showed about 2-fold higher affinity than anti-Ras-GTP iMab fused with parental in4 cyclic peptide against recombinant human integrin v5.
[0411] Table 19 shows the results of kinetic assay using Octet (ForteBio) between human recombinant integrin v5 and anti-Ras-GTP iMabs fused with cyclic peptides targeting integrin v5.
TABLE-US-00020 TABLE 19 K.sub.on (1/Ms) K.sub.off (1/s) K.sub.D (M) R.sup.2 inRas03 (7.88 0.064) 10.sup.4 (3.56 0.023) 10.sup.4 (4.52 0.047) 10.sup.9 0.9993 in4-Ras03 (8.06 0.064) 10.sup.4 (1.66 0.020) 10.sup.4 (2.06 0.030) 10.sup.9 0.9993 5#1-Ras03 (5.67 0.046) 10.sup.4 (6.39 0.162) 10.sup.5 (1.13 0.030) 10.sup.9 0.9996 5#2-Ras03 (4.55 0.055) 10.sup.4 (1.20 0.022) 10.sup.4 (2.63 0.058) 10.sup.9 0.9994 5#3-Ras03 (3.33 0.069) 10.sup.4 (1.63 0.030) 10.sup.4 (4.88 0.14) 10.sup.9 0.9989 5#4-Ras03 (2.25 0.083) 10.sup.4 (1.58 0.037) 10.sup.4 (7.01 0.31) 10.sup.9 0.9983
[0412]
[0413] Specifically, anti-Ras-GTP iMab fused with an integrin v6 target cyclic peptide having improved affinity was diluted with TBS containing a divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2)) and 0.02% Tween 20 at a concentration of 2 g/mL to immobilize on the anti-human IgG Fc (AHC) biosensor. Subsequently, the recombinant human integrin v6 protein was analyzed for association and dissociation at concentrations of 100 nM, 50 nM, 25 nM, 12.5 nM, 6.2 nM and 3.1 nM for 150 seconds and 450 seconds, respectively. After the analysis, immersing for 5 seconds in pH 2.2 glycine solution and pH 7.4 TBS solution for 5 seconds for regeneration of AHC biosensor was repeated 3 times. The affinities were calculated by normalizing the results by excluding the results of blank spaces that did not contain integrin.
[0414] When the affinity was measured by the above-described experimental method, it was confirmed that the anti-Ras-GTP iMab fused with the 6#6 cyclic peptide exhibited the highest binding affinity to the human recombinant integrin v6, except for the cyclic peptides showing non-specific binding in Example 34. Compared with the anti-Ras-GTP iMab fused with parental cyclic peptide in4, the anti-Ras-GTP iMab fused with the 6#6 cyclic peptide exhibited about 12-fold higher binding affinity.
[0415] Table 20 shows the results of kinetic assay using Octet (ForteBio) between human recombinant integrin v6 and anti-Ras-GTP iMabs fused with cyclic peptides targeting integrin v6.
TABLE-US-00021 TABLE 20 K.sub.on (1/Ms) K.sub.off (1/s) K.sub.D (M) R.sup.2 inRas03 (6.05 0.34) 10.sup.5 (5.83 0.95) 10.sup.3 (9.63 0.56) 10.sup.9 0.9699 in4-Ras03 (5.83 0.33) 10.sup.5 (7.03 0.12) 10.sup.3 (1.21 0.07) 10.sup.8 0.9732 6#2-Ras03 (2.12 0.046) 10.sup.5 (1.53 0. 078) 10.sup.4 (7.22 0.38) 10.sup.10 0.9988 6#3-Ras03 (2.08 0.25) 10.sup.5 (1.29 0.068) 10.sup.4 (6.21 0.33) 10.sup.10 0.9992 6#4-Ras03 (1.75 0.037) 10.sup.5 (2.65 0.12) 10.sup.4 (1.52 0.074) 10.sup.9 0.9976 6#6-Ras03 (2.16 0.024) 10.sup.5 (1.82 0.065) 10.sup.4 (8.43 0.31) 10.sup.10 0.9992 6#8-Ras03 (1.84 0.021) 10.sup.5 (1.75 0.061) 10.sup.4 (9.52 0.35) 10.sup.10 0.9993
6.40 Example 36. Comparative Analysis of Cyclic Peptide 6#6 with Improved Affinity for Integrin v6 and Cyclic Peptide SFITGv6 Known to Bind Integrin v6 in Previous Studies
[0416] The 6#6 cyclic peptide was the peptide with the highest binding affinity to human integrin v6, without any non-specific binding through the above studies. Experiments were conducted to compare the 6#6 cyclic peptide with the cyclic peptide SFITGv6, which were studied to bind integrin v6 with high affinity. The affinity analysis was carried out using non-specific ELISA and Octet (ForteBio), in the same manner as described in Example 34 for the non-specific ELISA and in Example 35 for the comparative analysis of binding ability.
[0417]
[0418] Specifically, the experiment was performed in the same manner as described in Example 34 above. 1 g/mL of dsDNA (Sigma, D4522), 5 g/mL of Keyhole limpet hemocyanin (Sigma, H8283), and 10 g/mL of cardiolipin (Sigma, C0563), were added to 96-well EIA/RIA plate diluted with PBS and adsorbed on the plate surface at room temperature for 1 hour. Then, 3% skim milk dissolved in PBS was added to the wells to block the non-adsorbed side of the antigen. Subsequently, the cells were washed three times for 10 minutes with PBS-T solution containing 0.05% Tween 20 with PBS, and each antibody was diluted with the blocking solution to a concentration of 500 nM and incubated at room temperature for 1 hour. TMab4 was used as a positive control. As a negative control, Ras03, an anti-Ras-GTP iMab without cyclic peptide was used. After washing with PBS-T three times for 10 minutes, HRP-conjugated anti-human mAb (HRP conjugated anti-human mAb) was added to the plate for 1 hour at room temperature, and the plates were then reacted with TMB ELISA solution and absorbance at 450 nm was quantified.
[0419] In the above experiment, anti-Ras GTP iMab fused with affinity maturated cyclic peptide 6#6 targeting integrin v6 showed no non-specific binding to any of the three antigens, while anti-Ras-GTP iMab fused with the SFITGv6 cyclic peptide, which has been reported to have strong binding ability to integrin v6, showed non-specific binding to all three antigens.
[0420]
[0421] Specifically, the experiment was performed in the same manner as described in Example 35 above. Anti-Ras-GTP iMab fused with an integrin v6 target cyclic peptide 6#6 and SFITGv6 was diluted with TBS containing divalent cations (1 mM MnCl.sub.2, 1 mM MgCl.sub.2, 2 mM CaCl.sub.2)), 0.02% Tween 20 at a concentration of 2 g/mL to immobilize on the anti-human IgG Fc (AHC) biosensor. Subsequently, the recombinant human integrin v6 protein was analyzed for association and dissociation at concentrations of 100 nM, 50 nM, 25 nM, 12.5 nM, 6.2 nM and 3.1 nM for 150 seconds and 450 seconds, respectively. After the analysis, immersion for 5 seconds in pH 2.2 glycine solution and pH 7.4 TBS solution for 5 seconds for regeneration of AHC biosensor was repeated three times. The affinities were calculated by normalizing the results by excluding the results of blank spaces that did not contain integrin.
[0422] Through the above experiment, anti-Ras-GTP iMab fused with the cyclic peptide 6#6, affinity maturated to bind integrin v6, and anti-Ras-GTP iMab fused with the cyclic peptide SFITGv6, previously reported to have strong binding ability to integrin v6, were confirmed to bind human integrin v6 with similar affinity.
[0423] Table 21 shows the results of kinetic assay using Octet (ForteBio) between human recombinant integrin v6 and anti-Ras-GTP iMabs fused with 6#6 or SFITGv6 cyclic peptide targeting integrin v6.
TABLE-US-00022 TABLE 21 K.sub.on (1/Ms) K.sub.off (1/s) K.sub.D (M) R.sup.2 6#6-Ras03 (2.16 0.024) 10.sup.5 (1.82 0.065) 10.sup.4 (8.43 0.31) 10.sup.10 0.9992 SFITGv6-Ras03 (2.79 0.041) 10.sup.5 (1.28 0.009) 10.sup.4 (4.57 0.33) 10.sup.10 0.9983
[0424] Hereinabove, although the present invention is described by specific matters such as concrete components, and the like, embodiments, and drawings, they are provided only for assisting in the entire understanding of the present invention. Therefore, the present invention is not limited to the embodiments. Various modifications and changes may be made by those skilled in the art to which the present invention pertains from this description. Therefore, the spirit of the present invention should not be limited to the above-described embodiments, and the following claims as well as all modified equally or equivalently to the claims are intended to fall within the scope and spirit of the invention.
[0425] The entirety of each patent, patent application, publication and document referenced herein is hereby incorporated by reference for all purposes.
REFERENCES
[0426] Al-Lazikani, B., Lesk, A. M., & Chothia, C. (1997). Standard conformations for the canonical structures of immunoglobulins. J Mol Biol, 273(4), 927-48. [0427] Baek, C. H., Liss, M., Clancy, K., Chesnut, J., & Katzen, F. (2014). DNA Assembly Tools and Strategies for the Generation of Plasmids. Microbiol Spectr, 2(5), 1-12. [0428] Barbas, C. F., Burton, D. R., Scott, J. K., & Silverman, G. J. (2007). Quantitation of DNA and RNA. Cold Spring Harb. Protoc. [0429] Choi, D. K., Bae, S. M., Shin, J. Y., Shin, S. K., & Kim, Y. S. (2014). A general strategy for generating intact, full-length IgG antibodies that penetrate into the cytosol of living cells. mAbs, 6(6), 1402-1414. [0430] Di Paolo, C., Willuda, J., Kubetzko, S., Lauffer, I., Tschudi, D., Waibel, R., . . . Zangemeister-Wittke, U. (2003). A recombinant immunotoxin derived from a humanized epithelial cell adhesion molecule-specific single-chain antibody fragment has potent and selective antitumor activity. Clin Cancer Res, 9, 2837-2848. [0431] Dohi, T., Rennert, P. D., Fujihashi, K., Kiyono, H., Shirai, Y., & Kawamura, Y. I. (2001). Elimination of colonic patches with lymphotoxin receptor-Ig prevents Th2 cell-type colitis. The Journal of Immunology, 167(5), 2781-2790. [0432] Dudgeon, R., Rouet, I., Kokmeijer, P., Schofield, J., Stolp, D., Langley, D., . . . Christ, D. (2012). General strategy for the generation of human antibody variable domains with increased aggregation resistance. Proc Natl Acad Sci USA, 109, 10879-10884. [0433] Edman, P. (1959). Chemistry of amino acids and peptides. Annu Rev Biochem, 28, 69-96. [0434] Ewert, S., Honegger, A., & Pluckthun, A. (2004). Stability improvement of antibodies for extracellular and intracellular applications: CDR grafting to stable frameworks and structure-based framework engineering, Methods, 184-199. [0435] Fernandes, M. T., Dejardin, E., & dos Santos, N. R. (2016). Context-dependent roles for lymphotoxin- receptor signaling in cancer development. Biochimica et Biophysica Acta, 1865, 204-219. [0436] Gouttefangeas, C., Walter, S., Welters, M. J., Ottensmeier, C., van der Burg, S. H., & Britten, C. M. (2014). Flow Cytometry in Cancer Immunotherapy: Applications, Quality Assurance, and Future. Cancer Immunology, 471-490. [0437] Guidotti, G., Brambilla, L., & Rossi, D. (2017). Cell-Penetrating Peptides: From Basic Research to Clinics. Trends in Pharmacological Sciences, 38, 406-424. [0438] Guillard, S., Minter, R. R., & Jackson, R. H. (2015). Engineering therapeutic proteins for cell entry: the natural approach. Trends in biotechnology, 33, 163-171. [0439] Holig, P., Bach, M., Volkel, T., Nahde, T., Hoffmann, S., Muller, R., & Kontermann, R. E. (2004). Novel RGD lipopeptides for the targeting of liposomes to integrin-expressing endothelial and melanoma cells. Prot Eng Des Sel, 433-441. [0440] Hollingshead, M. G. (2008). Antitumor Efficacy Testing in Rodents. JNCI: Journal of the National Cancer Institute, 100(21), 1500-1510. [0441] Horton, D. A., Bourne, G. T., & Smythe, M. L. (2002). Exploring privileged structures: the combinatorial synthesis of cyclic peptides. J Comput Aided Mol Des., 16, 5-6. [0442] Imai, K., & Takaoka, A. (2006). Comparing antibody and small-molecule therapies for cancer. Nat Rev Cancer, 6(9), 714-727. [0443] Kabat, E. A., Wu, T. T., Foeller, C., Perry, H. M., & Gottesman, K. S. (1991). Sequences of Proteins of Immunological Interest (5 ed.). Bethesda, Md.: National Institutes of Health. [0444] Kai, I., & Takaoka, A. (2006). Comparing antibody and small-molecule therapies for cancer. Nat Rev Cancer., 6(9), 714-27. [0445] Kim, J. S., Choi, D. K., Park, W. W., Shin, S. M., Bae, J., Kim, D. M., . . . Kim, Y. S. (2015). Quantitative assessment of cellular uptake and cytosolic access of antibody in living cells by an enhanced split GFP complementation assay. Biochemical and Biophysical Research Commun, 771-777. [0446] Kim, J. S., Choi, D. K., Shin, J. Y., Shin, S. M., Park, S. W., Cho, H. S., & Kim, Y. S. (2016). Endosomal acidic pH-induced conformational changes of a cytosol-penetrating antibody mediate endosomal escape. J Control Release, 235, 165-175. [0447] Kim, Y. S., & Bae, D. S. (2015). Humanization of a phosphothreonine peptide-specific chicken antibody by combinatorial library optimization of the phosphoepitope-binding motif. Biochemical and biophysical research communications, 414-420. [0448] Lee, C. H., Park, K. J., Kim, S. J., Kwon, O., Jeong, K. J., Kim, A., & Kim, Y. S. (2011). Generation of bivalent and bispecific kringle single domains by loop grafting as potent agonists against death receptors 4 and 5. Journal of Molecular biolgoy, 210-219. [0449] Leem, J., Dunbar, J., Georges, G., Shi, J., & Deane, C. M. (2016). ABodyBuilder: Automated antibody structure prediction with data-driven accuracy estimation. mAbs, 1259-1268. [0450] Leshchiner, E. S., Parkhitko, A., Bird, G. H., Luccarelli, J., Bellairs, J. A., Escudero, S., . . . Walensky, L. D. (2015). Direct inhibition of oncogenic KRAS by hydrocarbon-stapled SOS1 helices. Proc Natl Acad Sci USA., 112(6), 1761-6. [0451] Mauri, D. N., Ebner, R., Montgomery, R. I., Kochel, K. D., Cheung, T. C., & Yu, G. L. (1998). LIGHT, a new member of the TNF superfamily, and lymphotoxin alpha are ligands. Immunity, 8, 21-30. [0452] Munz, M., Baeuerle, P. A., & Gires, O. (2009). The emerging role of EpCAM in cancer and stem cell signaling. Cancer Res, 69, 5627-5629. [0453] Patgiri, A., Yadav, K. K., & Bar-Sagi, D. (2011). An orthosteric inhibitor of the Ras-Sos interaction. Nat Chem Biol, 7(9),585-7. [0454] Perrimon, N., & Bernfield, M. (2000). Specificities of heparan sulphate proteoglycans in developmental processes. Nature, 72508. [0455] Pimenta, E. M. (n.d.). Pimenta, E. M., & Barnes, B. J. (2014). Role of tertiary lymphoid structures (TLS) in antitumor immunity: Potential tumor-induced cytokines/chemokines that regulate TLS formation in epithelial-derived cancers. 6(2), 969-997. [0456] Pimenta, E. M., & Barnes, B. J. (2014). Role of tertiary lymphoid structures (TLS) in antitumor immunity: Potential tumor-induced cytokines/chemokines that regulate TLS formation in epithelial-derived cancers. Cancer, 6(2), 969-997. [0457] Rezai, T., Yu, B., Millhauser, G. L., Jacobson, M. P., & Lokey, R. S. (2006). Testing the conformational hypothesis of passive membrane permeability using synthetic cyclic peptide diastereomers. J Am Chem Soc, 128, 2510-2511. [0458] Shin, S. M., Choi, D. K., Jung, K., J, B., Kim, J. S., Park, S. W., . . . Kim, Y. S. (2017). Antibody targeting intracellular oncogenic Ras mutants exerts anti-tumour effects after systemic administration. Nature Communications, 8, 15090. [0459] Simon, M., Stefan, N., Pluckthun, A., & Zangemeister-Wittke, U. (2013). Epithelial cell adhesion molecule-targeted drug delivery for cancer therapy, Expert opinion on drug delivery. Expert opinion on drug delivery, 10, 451-468. [0460] Singh, R., Setiady, Y. Y., Ponte, J., Kovtun, Y. V., Lai, K. C., Hong, E. E., . . . Widdison, W. C. (2016). A New Triglycyl Peptide Linker for Antibody-Drug Conjugates (ADCs) with Improved Targeted Killing of Cancer Cells. Molecular Cancer Therapeutics, 15, 1311-1320. [0461] Sudhamsu, J., Yin, J., Chiang, E. Y., Starovasnik, M. A., Grogan, J. L., & Hymowitz, S. G. (2013). Dimerization of LTOR by LT12 is necessary and sufficient for signal transduction. Proc Natl Acad Sci USA, 110(49), 19896-901. [0462] Teicher, B. A. (2009). In vivo/ex vivo and in situ assays used in cancer research: a brief review. Toxicol Pathol, 37(1), 114-22. [0463] Wang, J., Lo, J. C., Foster, A., Yu, P., Chen, H. M., Wang, Y., . . . Fu, Y. X. (2001). The regulation of T cell homeostasis and autoimmunity by T cell-derived LIGHT. J Clin Invest, 108, 1771-1780. [0464] Weinstein A M, S. W. (2015). Lymphotoxin Therapeutic Lymphoid Organogenesis in the Tumor Microenvironment. Adv Cancer Res., 128, 197-233. [0465] Went, P., Vadei, M., Bubendorf, L., Terracciano, L., Tornillo, L., Riede, U., . . . Baeuerle, P. A. (2006). Frequent high-level expression of the immunotherapeutic target Ep-CAM in colon, stomach, prostate and lung cancers. Br J Cancer, 94(1), 128-135. [0466] Xiong, J. P., Stehle, T., Zhang, R., Joachimiak, A., Frech, M., Goodman, S. L., & Arnaout, M. A. (2002). Crystal structure of the extracellular segment of integrin alpha Vbeta3 in complex with an Arg-Gly-Asp ligand. Science, 296, 151-5.