INTEGRATED DIAGNOSTIC DEVICES HAVING EMBEDDED BIOMOLECULAR COMPUTING SYSTEMS AND USES THEREOF
20200386750 ยท 2020-12-10
Inventors
- Alexander A. Green (Scottsdale, AZ, US)
- Matthew Gilliam (Tempe, AZ, US)
- Kirstie Swingle (Phoenix, AZ, US)
- Nicholas Stephanopoulos (Scottsdale, AZ, US)
- Neal Woodbury (Tempe, AZ)
Cpc classification
B01L2300/0627
PERFORMING OPERATIONS; TRANSPORTING
G01N2458/10
PHYSICS
B01L3/502715
PERFORMING OPERATIONS; TRANSPORTING
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
Abstract
Integrated diagnostic devices comprising peptide-DNA conjugates for analyte detection, an embedded biomolecular computing system for sample analysis, and a layered device architecture are provided herein. In particular, provided herein are devices comprising a layered architecture that enables diagnostic reagents, sample components, and reaction products to flow through the system with minimal user intervention.
Claims
1. (canceled)
2. The device of claim 7, further comprising a nucleic acid amplification layer.
3. The device of claim 7, wherein at least one of the one or more biomolecular computing layers is an output layer.
4. The device of claim 3, wherein the output layer comprises a nucleic acid-based sensor reaction panel.
5. The device of claim 4, wherein the nucleic acid-based sensor reaction panel comprises a plurality of nucleic acid-based sensors.
6. The device of claim 5, wherein the plurality comprises nucleic acid-based sensors selected from the group consisting of a riboregulator and an aptasensor.
7. A diagnostic device for detecting a target analyte in a sample, the device comprising a sample receiving layer, an analyte detection layer, a microfluidic layer, and one or more biomolecular computing layers, wherein the device is configured for transverse liquid flow between the layers, wherein the analyte detection layer comprises a plurality of peptide-DNA conjugates bound to an antibody or epitope having specificity for the target analyte, wherein binding of the target analyte to the antibody or epitope displaces the peptide-DNA conjugate.
8. The device of claim 7, wherein the target analyte is a protein, carbohydrate, or lipid.
9. A diagnostic device for detecting a target analyte in a sample, the device comprising a sample receiving layer, an analyte detection layer, a microfluidic layer, and one or more biomolecular computing layers, wherein the device is configured for transverse liquid flow between the layers, wherein the layers in the diagnostic device are separated by one or more transient layers that dissolve in a prescribed amount of time when contacted to a sample to control transverse flow of amplification products, nucleic acids, and sample components through the device.
10. The device of claim 9, wherein the one or more transient layers comprise a dried sucrose solution.
11. The device of claim 7, wherein the microfluidic layer is configured for lateral flow of amplification products and nucleic acids across the device.
12. The device of claim 7, wherein the sample receiving layer comprises a separation membrane.
13. The device of claim 7, wherein the sample is a biological sample.
14. The device of claim 13, wherein the biological sample is a blood, serum, plasma, urine, or saliva sample.
15. The device of claim 7, wherein the device is paper-based.
16. The device of claim 9, wherein the sample receiving layer comprises a separation membrane.
17. The device of claim 9, wherein the sample is a biological sample.
18. The device of claim 17, wherein the biological sample is a blood, serum, plasma, urine, or saliva sample.
19. The device of claim 9, wherein the device is paper-based.
20. The device of claim 9, further comprising a nucleic acid amplification layer.
21. The device of claim 9, wherein at least one of the one or more biomolecular computing layers is an output layer.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0005] The present invention will be better understood and features, aspects, and advantages other than those set forth above will become apparent when consideration is given to the following detailed description thereof. Such detailed description makes reference to the following drawings, wherein:
[0006]
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020] While the present invention is susceptible to various modifications and alternative forms, exemplary embodiments thereof are shown by way of example in the drawings and are herein described in detail. It should be understood, however, that the description of exemplary embodiments is not intended to limit the invention to the particular forms disclosed, but on the contrary, the intention is to cover all modifications, equivalents and alternatives falling within the spirit and scope of the invention as defined by the appended claims.
DETAILED DESCRIPTION OF THE DISCLOSURE
[0021] All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as though set forth in their entirety in the present application.
[0022] Simple, low-cost, and rapid diagnostic devices like home pregnancy tests and blood glucose meters have transformed healthcare over the past four decades, enabling people to monitor and take charge of their health in non-clinical settings. Developing simple, low-cost, and rapid devices that integrate nucleic acid and protein detection with biomolecular computing in a single device for pathogen identification would enable a large range of viruses, microbes, and genetic diseases to be identified in the same test.
[0023] Accordingly, embodiments described herein relate to integrated diagnostic devices and systems that combine nucleic acid signals derived from protein and nucleic acid detection events with biomolecular computing to analyze a sample and provide test results without outside intervention or additional information processing. Embodiments described herein also relate to methods for construction of such integrated diagnostic devices and as well as testing systems for analyte (e.g., pathogen antigen) detection and identification using liquid biological samples such as serum, plasma, blood, saliva, and urine. Advantages of the diagnostic devices provided herein include lower cost and lower complexity. For example, devices provided herein require fewer handling steps, which can be a source of error. As the diagnostic devices and systems provided herein operate with minimal human intervention and require almost no laboratory equipment, they can be deployed in a variety of low-instrumentation settings such as homes and non-hospital clinics for fast, specific detection and identification of disease states.
[0024] The diagnostic devices and systems provided herein employ an innovative diagnostic platform that employs peptide-DNA conjugates for protein, carbohydrate, or lipid detection; an embedded, autonomous biomolecular computing system; and a layered device architecture that enables the diagnostic reaction to flow through the system without external user intervention. As shown in
[0025] In one aspect, provided herein is a diagnostic device detecting a target analyte in a sample. The diagnostic device can comprise comprising a sample receiving layer, an analyte detection layer, a microfluidic layer, and one or more biomolecular computing layers, wherein the device is configured for transverse liquid flow between the layers. In some cases, the device further comprises a nucleic acid amplification layer. For example, it can be advantageous to include a nucleic amplification layer if the sample does not contain a large concentration of the analyte of interest. As used herein, the terms analyte and target analyte refer to the molecule or atom to be detected in a test sample. Examples of target analytes include, but are not limited to, a protein, peptide, polypeptide, amino acid, antibody, nucleic acid, oligonucleotide, DNA, RNA, carbohydrate, lipid, hormone, steroid, toxin, vitamin, any drug administered for therapeutic and illicit purposes, a bacterium, a virus, cell, as well as any antigenic substances, haptens, antibodies, metabolites, and combinations thereof.
[0026] In some cases, at least one of the one or more biomolecular computing layers is an output layer comprising a nucleic acid-based sensor reaction panel. Preferably, the nucleic acid-based sensor reaction panel comprises a plurality of nucleic acid-based sensors selected from riboregulators (e.g., toehold switch riboregulators), aptamer-based sensors or aptasensors, and ultraspecific riboregulators. As used herein, the terms aptamer-based sensor, aptasensor, and aptamer beacon are used interchangeably to refer to a sensor (e.g., biomolecule sensor) that can be used to capture a target analyte by exploiting the affinity of an aptamer to its target. As used herein, the term ultraspecific riboregulator refers to a regulator of gene expression, configured to repress or activate translation of an open reading frame, and thus repress or activate production of a protein, only upon recognition of a target RNA with the exact sequence with single nucleotide specificity.
[0027] As described herein, the analyte detection layer can comprise a plurality of peptide-DNA conjugates bound to an antibody or epitope having specificity for the target analyte, where binding of the target analyte to the antibody or epitope displaces the peptide-DNA conjugate. For pathogen or disease detection, an exemplary diagnostic embodiment comprises detection of a target protein via release of a peptide-DNA conjugate, the release of which acts as a nucleic acid signal that flows to a biomolecular computing system embedded in the diagnostic device for analysis. Biomolecular computing systems integrate nucleic acid signals derived from protein and nucleic acid detection events to analyze the sample and provide test results without outside intervention or additional information processing. In some cases, results of analysis by the biomolecular computing system are detected as colorimetric results produced through an enzymatic reaction. Preferably, an input protein is obtained from a biological sample of a subject (e.g., human patient). Biological samples appropriate for use according to the methods provided herein include, without limitation, blood, serum, urine, saliva, tissues, cells, and organs. More preferably, the biological sample is a liquid biological sample such as blood, serum, plasma, urine, or saliva obtained from the subject.
[0028] As shown in
[0029] As used herein, the term transverse refers to liquid flow that is predominantly perpendicular to the length and width of a layer, and is predominantly in a direction parallel to the depth of a layer. Conversely, lateral flow is predominantly parallel to the length or width planes of a layer. As illustrated in
[0030] In some cases, a whole blood sample, which can be boiled to extract RNA from virus particles present, is initially separated into plasma using a plasma separation membrane. Protein analytes are detected in a protein detection layer followed by a DNA/RNA amplification layer that amplifies nucleic acids in the original sample and peptide-DNA conjugates from the protein detection layer. Next, a microfluidic layer routes the amplified, low-molecular-weight products laterally across the device. In subsequent layers, biomolecular computing layers process the nucleic acid inputs and test results from a panel of different tests are displayed in the final output layer. Liquid is transported through the device using capillary forces.
[0031] In certain embodiments, it will be advantageous to provide in a device different processing zones that are spatially and temporally separated. An aqueous sample can pass through such processing zones and encounter one or more dried solutions which provide a timed dissolvable barrier on paper-based devices. Device complexity can be reduced, and device sensitivity increased, through the use of transient layers between active layers of the device. In some embodiments, layers in the diagnostic device are separated by transient layers that dissolve in a predetermined amount of time to control transverse flow of amplification products, nucleic acids, and sample components through the device. In this manner, the transient layer is a fluid flow barrier that acts as a delay mechanism. Using transient layers, it is possible to impede sample flow so that sufficient time is allotted for different diagnostic chemical reactions. For instance, a layer that degrades over 30 minutes to two hours can be used after a layer involved with amplifying nucleic acids to ensure there is sufficient time to make enough nucleic acid copies (
[0032] Preferably, transient layers comprise water soluble polymers that are designed to dissolve in a time-dependent manner as they encounter a propagating water front from the sample. In certain embodiments, a transient layer comprises a dried sucrose solution. Sucrose is low cost, highly soluble in water, and has been shown to be useful as a soluble delay material in multistep paper-based lateral flow tests. See Lutz et al. (Lab Chip 2013, 13:2840). Fluid flow through a multi-layer device can be delayed with the addition of a sucrose-treated middle layer. In particular, by varying the concentration of sucrose solution, the amount of time required for fluid to reach the bottom layer can be increased (thus, flow is delayed) by the presence of a 5%-60% or greater sucrose solution (e.g., a 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 66% or greater sucrose solution). As described in Example 1, liquid passaged was delayed by 61 minutes using a 20% sucrose solution. Liquid passage can be delayed by 123 minutes using a 30% sucrose solution. In some cases, additional delay layers are added between the top and bottom layers in order to provide further control over sample passage.
[0033] In some embodiments, the output of the detection layer in the final device is a color change produced from the enzyme beta-galactosidase interacting with a substrate. When the device comprises one or more transient layers comprising a sucrose solution, the sample solution will become more concentrated with sucrose, or more generally the barrier compound, as it dissolves each barrier layer. Since the increased concentration of sucrose can affect the interaction between the enzyme and substrate and in turn the final readout of the device, it is important to test the viability of the enzyme-substrate interaction on paper in the presence of a concentrated sucrose solution. Such a test is described in the Examples that follow.
[0034] In some cases, the water soluble polymer of the transient layer is a biocompatible polymer such as, for example, as methyl cellulose, pullulan, poly(vinyl alcohol), polyvinylpyrrolidone, polylacticcoglycolic acid, hydroxypropylmethylcellulose. For example, fluid passage can be delayed by adding thin films of methyl cellulose or pullulan between top and bottom paper-based microfluidic layers. Degradable films comprising water soluble polymers have been widely used in the field of transient electronics for electronic devices that decompose over prescribed (e.g., predetermined) times when implanted in the body (Hwang et al., Science 337, 1640 (2012)). Theory has been developed to model their dissolution times as a function of layer density, thickness, and water diffusivity (Cheng et al., Theor. Appl. Mech. Lett. 6, 21 (2016)).
[0035] When selecting water soluble material for transient layers, it is important to consider that, when the target analyte for the detection layer is an RNA sequence, it is necessary that a given RNA or DNA molecule must be delayed but not completely blocked or otherwise deactivated by the dissolvable barriers. For example, in some cases the detection mechanism of a diagnostic device provided herein requires that an RNA sequence interact with a toehold-switch-containing RNA structure to, thus, regulate an enzyme (e.g., beta-galactosidase) that will interact with a substrate to produce the desired color change. To evaluate the barrier's ability to accommodate these requirements of a target RNA sequence, the delay times of an RNA molecule passing through the barriers can be measured.
[0036] In other cases, the detection mechanism employs a fluorescent broccoli-RNA/dye complex. In such cases, the bottom layer of a multilayer device is treated with a dye that only fluoresces when in contact with a particular RNA structure. For time-delay, sucrose treated wells can be placed on top of the dye-treated layer, along with one more untreated layer of paper on top of the sucrose layer. The RNA structure is then dropped onto the top wells of the device, which is then incubated in a plate reader at 37 C. to allow for detection and measurement of fluorescence in the bottom layers.
[0037] In some cases, it may be advantageous to additionally employ lateral flow to distribute small molecular weight reaction products (e.g., nucleic acids) following amplification. For example, microfluidic layers patterned using hydrophobic wax inks within the device can be used to distribute reaction products laterally, so that multiple agents can be detected simultaneously and products can be combined as computational inputs. Importantly, the sample will be driven through the device purely through capillary forces and employ reactions that are active at <37 C. Examples of potential reactions include recombinase polymerase amplification, cell-free protein expression, and in vitro transcription using RNA polymerases such as T7, SP6, and T3. As a result, the diagnostic can be run with minimal human intervention and employ patient body heat for power. The use of transverse flow means that the devices do not require much lateral area, so that it will be possible to run dozens of tests within a single business-card-sized diagnostic system. Existing commercial tests often employ lateral flow methods to report assay results in which capillary forces carry the analyte across a device. For example, the existing Zika diagnostic test requires multiple liquid handling steps and incubation at more than one temperature (
[0038] After capillary forces facilitate transfer of amplification products within the device for reporter reactions, assay results can be read out from the bottom (or lowest layer in
[0039] Protein Detection via Peptide-DNA Conjugates: While pathogen nucleic acids can be readily interfaced with RNA-based sensors like toehold switches, doing the same for protein detection is considerably more challenging. As shown in
[0040] As shown in
[0041] The devices provided herein are capable of protein detection with enhanced sensitivity. For example, application of isothermal amplification schemes such as recombinase polymerase amplification (RPA) and nucleic acid sequence-based amplification (NASBA) could enable PCR-like sensitivity to be achieved for protein detection. Referring to
[0042] The ability of RPA to discriminate between target and non-target DNA and amplify only target sequences is a key aspect of improved sensitivity. For the purposes of this disclosure, each of the terms target and non-target can refer to a wild-type or mutant (e.g., SNP-containing) nucleic acid molecule, depending on the intended target. For example, the target may be a SNP-containing nucleic acid molecule if the method is employed to detect the presence of a SNP in a sample. Any isothermal amplification protocol can be used. For example, other isothermal amplification methods include NASBA (nucleic acid sequence-based amplification), loop-mediated isothermal amplification (LAMP), strand displacement amplification (SDA), helicase-dependent amplification (HDA), nicking enzyme amplification reaction (NEAR), signal mediated amplification of RNA technology (SMART), rolling circle amplification (RCA), isothermal multiple displacement amplification (IMDA), and single primer isothermal amplification (SPIA).
[0043] The terms detect or detection as used herein indicate the determination of the existence, presence or fact of a target or signal in a limited portion of space, including but not limited to a sample, a reaction mixture, a molecular complex and a substrate including a platform and an array. Detection is quantitative when it refers, relates to, or involves the measurement of quantity or amount of the target or signal (also referred as quantitation), which includes but is not limited to any analysis designed to determine the amounts or proportions of the target or signal. Detection is qualitative when it refers, relates to, or involves identification of a quality or kind of the target or signal in terms of relative abundance to another target or signal, which is not quantified. An optical detection indicates detection performed through visually detectable signals: fluorescence, spectra, or images from a target of interest or a probe attached to the target.
[0044] As used herein, a sample means any material that contains, or potentially contains, which could be infected or contaminated by the presence of a pathogenic microorganism. Samples appropriate for use according to the methods provided herein include biological samples such as, for example, blood, plasma, serum, urine, saliva, tissues, cells, organs, organisms or portions thereof (e.g., mosquitoes, bacteria, plants or plant material), patient samples (e.g., feces or body fluids, such as urine, blood, serum, plasma, or cerebrospinal fluid), food samples, drinking water, and agricultural products. In some cases, samples appropriate for use according to the methods provided herein are non-biological in whole or in part. Non-biological samples include, without limitation, plastic and packaging materials, paper, clothing fibers, and metal surfaces. In certain embodiments, the methods provided herein are used in food safety and food biosecurity applications, such as screening food products and materials used in food processing or packaging for the presence of pathogens in biological and/or non-biological samples. In other embodiments, the methods provided herein are used for anti-counterfeit applications, such as confirming that pharmaceuticals are genuine or confirming the identity of high value items that have been fabricated or are known to contain specific nucleic acid species.
[0045] Multi Analyte Processing Using Embedded Biomolecular Computing Systems:
[0046] Following detection according to a scheme described herein, signal from the protein analyte can be converted into a nucleic acid signal that can be processed using nucleic-acid-based biomolecular computing systems. These systems can act on signals generated from proteins and from those generated by nucleic acids present in the original biological sample as illustrated schematically in
[0047] Upon completion of the computation, the result is output in the form of protein (e.g., lacZ, GFP, or an RNA polymerase), RNA, or an aptamer. In some cases, the output signal is a reporter (e.g., GFP or aptamer) that displays the diagnostic test result. In other cases, the output signal is RNA or RNA polymerase that can be used in a downstream biomolecular computing layer.
[0048] In some cases, the output is in the form of a reporter protein, e.g., a polypeptide with an easily assayed enzymatic activity or detectable signal that is naturally absent from a host cell. Exemplary but non-limiting reporter proteins include lacZ, catalase, xylE, GFP, RFP, YFP, CFP, neomycin phosphotransferase, luciferase, mCherry, and derivatives or variants thereof. In some embodiments of any of the aspects, the reporter protein is suitable for use in a colorimetric assay. Examples of genes encoding fluorescent proteins that may be used in accordance with the invention include, without limitation, those proteins provided in U.S. Patent Application No. 2012/0003630 (see Table 59 therein), incorporated herein by reference.
[0049] In some cases, the biomolecular computing system is an RNA-based biomolecular device that we have recently developed to perform logic operations. Such ribocomputing systems (i.e., RNA-based biomolecular computing systems) comprise de novo designed RNA parts and operate via predictable Watson-Crick base-pairing rules, enabling effective in silico design of devices with prescribed functions. Ribocomputing systems detect input RNA molecules and use them to compute a user-defined logic expression. If the expression is satisfied, the devices synthesize a desired protein as output. This protein can be a reporter enzyme, which can display the results of a diagnostic test, or it can be an RNA polymerase, which can synthesize an output RNA for a downstream ribocomputing element. To date, ribocomputing elements have been limited to use in living cells (Green et al., Nature 548:117-121 (2017)). However, in some cases, the devices and systems provided herein are configured for use in paper-based cell-free systems such that they can be used for diagnostic purposes.
[0050] Although we reference here ribocomputing devices based on toehold-mediated strand displacement reactions and protein outputs (Green et al., Nature 548:117-121 (2017)), it should be understood that multiple alternative biomolecular computing systems can be used instead. Other potential systems for implementing biomolecular computing in the diagnostics include loop-mediated riboregulator logic systems, near-threshold translational repressor systems, aptasensor systems based on aptamers such as Broccoli, or combinations thereof. In all these systems, RNA base pairing interactions can be used to evaluate logic expressions to determine if a biological sample has the specific combination of characteristics indicative of infection by a pathogen or a particular disease (e.g., cancer). Also the biomolecular computing system can be as simple as a single riboregulator that detects a released peptide-DNA conjugate or the amplified RNA product thereof. In this case, the computing system would only evaluate the simple IF/THEN expression IF RNA A, THEN translate gene B.
[0051] In some cases, the peptide-DNA conjugate detection scheme is used to detect a variety of known antigens through knowledge of common epitopes or by screening them on peptide arrays. By way of example, peptides that detect prostate specific antigen (PSA) can be designed to provide a high degree of binding affinity to PSA antibodies and low DNA signal leakage while maintaining efficient release upon antigen binding. In other cases, the peptide-DNA conjugate detection scheme is used with panel of mosquito-transmitted flaviviruses, which include Zika virus, dengue, chikungunya, and yellow fever. Zika is difficult to detect via nucleic acid testing outside of the acute phases of infection, even though it can still be transmitted sexually. Furthermore, Zika is notoriously difficult to distinguish from dengue using conventional antibody-based tests due to their similar immune responses. Thus, a multi-factorial test that detects the levels of multiple antibodies and nucleic acids before making a diagnosis provides an advanced diagnostic for a panel of closely related flaviviruses. Similarly, the diagnostic devices provided herein can be used to identify subjects having particular single nucleotide polymorphisms (SNPs) to, for example, stratify subjects in clinical studies. In other cases, the diagnostic devices provided herein can be used to acquire large data sets for understanding, for example, the spread of infectious diseases in a community.
[0052] Designing Sequence-Specific Integrated Devices and Systems:
[0053] The sequence-specificity of the diagnostic devices provided herein means that they can be used for various DNA testing applications. For example, the integrated devices described herein provide a very inexpensive sequence-specific device for detection of oncogenes via known SNPs (e.g., detecting BRCA1 and BRCA2 oncogenes in a patient sample). Other applications for sequence-specific devices include, without limitation, detecting antimicrobial drug resistance and detecting infection of various pathogens (e.g., viruses, bacteria, parasitic organisms, etc.). For example, detection of single-nucleotide differences can be used to identify individuals of interest with high confidence. This capability, particularly when implemented in a low-cost and portable format, could be useful for law enforcement, forensics, and as part of biometric security measures.
[0054] Field Applications of Integrated Devices for Conservation Efforts:
[0055] In some cases, it may be advantageous to use integrate diagnostic devices as provided herein in the field to guide a variety of wildlife conservation efforts. For example, integrated devices can be rapidly deployed in non-laboratory settings for DNA-based identification of endangered species and for acquiring large data sets for understanding species diversity in a particular region. In addition, the integrated devices can be used in customs offices, for example, to ensure that wildlife crossing the border is not infected with viruses or fungi whose import could be harmful to the indigenous wildlife.
[0056] Nucleic acids and/or other moieties of the invention may be isolated. As used herein, isolated means separate from at least some of the components with which it is usually associated whether it is derived from a naturally occurring source or made synthetically, in whole or in part.
[0057] Nucleic acids and/or other moieties of the invention may be purified. As used herein, purified means separate from the majority of other compounds or entities. A compound or moiety may be partially purified or substantially purified. Purity may be denoted by a weight by weight measure and may be determined using a variety of analytical techniques such as but not limited to mass spectrometry, HPLC, etc.
[0058] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms.
[0059] The terms comprising, comprises and comprised of as used herein are synonymous with including, includes or containing, contains, and are inclusive or open-ended and do not exclude additional, non-recited members, elements, or method steps. The phraseology and terminology used herein is for the purpose of description and should not be regarded as limiting. The use of including, comprising, having, containing, involving, and variations thereof, is meant to encompass the items listed thereafter and additional items. Use of ordinal terms such as first, second, third, etc., in the claims to modify a claim element does not by itself connote any priority, precedence, or order of one claim element over another or the temporal order in which acts of a method are performed. Ordinal terms are used merely as labels to distinguish one claim element having a certain name from another element having a same name (but for use of the ordinal term), to distinguish the claim elements.
[0060] The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.
[0061] The phrase and/or, as used herein in the specification and in the claims, should be understood to mean either or both of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with and/or should be construed in the same fashion, i.e., one or more of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the and/or clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to A and/or B, when used in conjunction with open-ended language such as comprising can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
[0062] As used herein in the specification and in the claims, or should be understood to have the same meaning as and/or as defined above. For example, when separating items in a list, or or and/or shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as only one of or exactly one of, or, when used in the claims, consisting of, will refer to the inclusion of exactly one element of a number or list of elements. In general, the term or as used herein shall only be interpreted as indicating exclusive alternatives (i.e. one or the other but not both) when preceded by terms of exclusivity, such as either, one of only one of or exactly one of Consisting essentially of, when used in the claims, shall have its ordinary meaning as used in the field of patent law.
[0063] As used herein, the terms approximately or about in reference to a number are generally taken to include numbers that fall within a range of 5% in either direction (greater than or less than) the number unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value). Where ranges are stated, the endpoints are included within the range unless otherwise stated or otherwise evident from the context.
[0064] It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
[0065] The present invention has been described in terms of one or more preferred embodiments, and it should be appreciated that many equivalents, alternatives, variations, and modifications, aside from those expressly stated, are possible and within the scope of the invention. The invention will be more fully understood upon consideration of the following non-limiting Examples.
EXAMPLES
Example 1Establishing Consistent Fluidic Delay Times
[0066] The sample to enter and flow through the proposed paper-based devices is an aqueous solution comprised of a variety of molecules and macromolecules, with one of the latter substances being the target RNA or DNA sequence that requires isolation and amplification. A time-sensitive barrier will impact each of these substances differently, with some moving through the barrier faster or slower than others. However, most if not all of these various substances will not advance faster than the water carrying them. Therefore, in order to assess the ability of the fluidic barriers to block the passage of fluid, the barriers will be evaluated for their ability to delay the advance of a water sample containing a low-molecular weight food color dye for visible detection.
[0067] To do this, we designed the setup shown in
[0068] We have successfully demonstrated that we can delay fluid flow through the 3-layer system with the addition of a sucrose-treated middle layer, and that, by varying the concentration of sucrose solution, we can control how long fluid is delayed from reaching the bottom layer. Using a 20% sucrose solution, we measured 61 minutes delays in liquid passage. Using a 30% sucrose solution, the delay was extended to 123 minutes. We expect that higher sucrose solution concentrations and repeated applications of the sucrose will enable delays of longer periods to be obtained. Furthermore, additional delay layers can also be added between the top and bottom layers in order to provide further control over sample passage. In addition to sucrose, we also studied methyl cellulose and pullulan as transient layers. These compounds also successful delayed fluid flow through the layered devices. Thin films of methyl cellulose added between top and bottom paper-based microfluidic layers were also successful at delaying fluid passage.
[0069] Verifying Enzyme Function after Interacting with Delay Material
[0070] The output of the detection layer in the final device is a color change produced from the enzyme beta-galactosidase interacting with a substrate. The sample solution will become more concentrated with sucrose, or more generally the barrier compound, as it dissolves each barrier layer. The increased concentration of sucrose may affect the interaction between the enzyme and substrate and in turn the final readout of the device. Therefore, it is important to test the viability of the enzyme-substrate interaction on paper in a concentrated sucrose solution. To test this, the same 3-layer setup as shown in
[0071] As shown in
[0072] Quantifying Delay Times for RNA or DNA Sample
[0073] Since the target analyte for the detection layer is an RNA sequence, it is necessary that a given RNA or DNA molecule must be delayed but not completely blocked or otherwise deactivated by the dissolvable barriers. The detection mechanism outlined in the proposed device requires an RNA sequence to interact with a toehold switch-containing RNA structure, regulating an enzyme (e.g., beta-galactosidase), which will then in turn interact with a substrate to produce the desired color change. To evaluate the barrier's ability to accommodate these requirements of a target RNA sequence, the delay times of an RNA molecule passing through the barriers will be measured.
[0074] In one example, the test utilizes a fluorescent broccoli-RNA/dye complex. A similar setup as described for the previous steps is used. A dye that can only fluoresce when in contact with a particular RNA structure is used to treat the bottom layer of a multilayer setup. Sucrose treated wells are placed on top of the dye-treated layer along with one more untreated layer of paper on top of the sucrose layer. The RNA structure is then dropped onto the top wells of the device, which is then be incubated in a plate reader at 37 C. to allow the fluorescence of the bottom layers to be measured. It is expected that the sucrose treated 3-layer setups would yield a slower fluorescence response than those that were untreated.
[0075] Quantifying Delay Times for Processed RNA Target and Full Detection Layer
[0076] The final step involves fabricating a similar 3-layer device as described previously, except with the detection layer being treated with the full RNA-based detection system that will be used in the proposed device. The middle layer is treated with sucrose as before, but the target will be the RNA sequence that will activate the toehold switch located in the detection layer and produce the protein via expression, which will then interact with the substrate and produce the desired color change. In summary, the final step involves timing target RNA flow and colorimetric output under the conditions of the actual device.
Example 2Using DNA-Peptide Conjugates to Activate Toehold Switches
[0077] This section describes assays performed to develop an improved integrated diagnostic device and system which integrates a peptide-displacement system for protein detection with the amplification and multiplexing capabilities of nucleic acid-based systems for amplification, signal processing, and readout. Critical to this integrated system is the use of DNA-peptide conjugates to bridge the gap between protein and nucleic acid capabilities in synthetic networks. Using a DNA-peptide conjugate as the cognate trigger to activate a toehold switch, our hybrid system is a paper-based diagnostic device that hosts two spatially separated reactions: a protein detection reaction employing peptide displacement and a nucleic acid detection reaction employing a toehold switch. Given the complexity of the final integrated diagnostic, we have focused initial research on three critical components that are crucial for proper function of the diagnostic: (1) Incorporation of peptide-DNA trigger conjugates into cell-free toehold switch reactions, (2) PCR Amplification with DNA-peptide conjugates, and (3) Implementation of peptide displacement reactions in paper test strips.
[0078] Referring to
Experimental Results
[0079] 1) Incorporation of Peptide-DNA Trigger Conjugates into Cell-Free Toehold Switch Reactions:
[0080] To explore the ability of a DNA-peptide conjugate to link protein and nucleic acid detection, we first needed to confirm that the peptide component of the conjugate would not inhibit interactions between the trigger DNA and toehold switch and ultimately enable toehold switch activation. A previously reported second-generation toehold switch, FER1_H16, was used as the output riboregulator for this study because of its high ON/OFF ratio of over 400-fold when paired with its cognate trigger experimentally (Green et al., Cell 2014. 159, 925-939). To construct the DNA-peptide conjugate, 5 amino-modified FER1_T16, which contained the cognate trigger sequence of FER1_H16, was reacted with N-hydroxysuccinimide-sulfo-dibenzylcyclo octyne. The modified trigger was then conjugated to a peptide containing an azido lysine using copper-free click chemistry to form the DNA-peptide conjugate. Peptides used for conjugation include the prostate specific antigen peptide from Francione et al. (RSC Adv. 2015. 5, 6595-6598), a streptavidin binding peptide, and an alpha tubulin peptide DM1A. Streptavidin binding peptide (SBP) was selected as a target peptide because of its ability to bind streptavidin with a dissociation constant of 2.5 nM, indicating it would bind streptavidin with a high binding affinity but could still be displaced by biotin (Keefe et al., Protein Expression and Purification. 2001. 23, 440-446). Peptide sequences used are found in Table 1.
TABLE-US-00001 TABLE1 SequencesofPeptidesandDNATriggersUsed PSApeptide H-DVCAQV-NH.sub.2(SEQIDNO:1) Streptavidin MDEKTTGWRGGHVVEGLAGELEQLRARLEHHP Binding QGQREP(SEQIDNO:2) Peptide FER1_T16DNA 5GCAGAAACTAACAGAAGCCAAATC trigger AATTACATACTA3(SEQIDNO:3) sequence DM1Apeptide AALEKDY(SEQIDNO:4)
[0081] To test for toehold activation, the peptide-DNA conjugates were combined with FER1_H16 toehold constructs in a cell free reaction following the In Vitro Protein Synthesis protocol from the PURExpress system (New England BioLabs). This system contains all enzymes and components required for transcription and translation outside of a cell. To monitor toehold switch activation, the reporter LacZ gene or green fluorescent protein (GFP) was incorporated downstream of the FER1_H16 hairpin module. Chlorophenol red--D-galactopyranoside, a substrate that when cleaved by -galactosidase results in dark purple color, was used to visualize the production of -galactosidase from the LacZ gene. A plate reader was used to measure the absorbance of chlorophenol red--D-galactopyranoside at 570 nm for LacZ over a 6-hour period. GFP was measured by fluorescence intensity at 475 nm (
[0082] Several peptides with different lengths and compositions were also tested for toehold activation. No discernable differences in toehold activation were found. Reporter genes for mCherry were also incorporated into toeholds with successful translation upon toehold activation. From these results, we conclude that peptide-conjugated nucleic acids can efficiently activate toehold switches in cell-free reactions. Although toehold switches were used for experiments, a wide array of different riboregulators or RNA-based switches should be compatible with DNA-peptide conjugates, including loop-mediated riboregulators, translational repressors, ultraspecific riboregulators, and aptasensors.
[0083] 2) PCR Amplification with DNA-Peptide Conjugate:
[0084] To understand the capacity of DNA-peptide conjugates to bridge this gap between proteins and nucleic acids, we next investigated whether the conjugates could successfully be used as amplification primers and templates. The ability to use DNA-peptide conjugates in typical amplification reactions has three important implications for their application in diagnostic systems:
[0085] (A) Amplification of protein detection signals: After displacement of the peptide-DNA by the target analyte, the displacement signal can be amplified using a technique such as PCR or an isothermal amplification method such as RPA or NASBA. For such an amplification to be successful, a target template with a covalently bound peptide must be compatible with the reactions. Nucleic acid amplification methods can in principle dramatically lower the detection limit of protein detection to enable identification of low copy number proteins.
[0086] (B) Simple and low-cost preparation of double-stranded DNA (dsDNA)-peptide conjugates: Using a DNA-peptide conjugate that contains the DNA sequence of a universal primer enables a peptide to be conjugated to a diverse array of different dsDNAs that can be used to activate different riboregulators in the readout phase of the diagnostic test. In this approach, two libraries would be used: a library of different peptides conjugated to a universal amplification primer, and a DNA library of different riboregulator trigger cassettes containing a promoter, a trigger sequence, and common sites for priming. With these two libraries and PCR amplification, a large library of peptides conjugated to specific dsDNA trigger cassettes can be generated to facilitate highly multiplexed tests.
[0087] (C) Transcription-based amplification of protein detection signals: dsDNA-peptide conjugates produced by PCR or another amplification method have the capacity to be transcribed to generate multiple RNA copies for detection by a riboregulator. In addition, the single-stranded form of the transcribed RNA will enable facile detection by a riboregulator and exploit the stronger thermodynamics of RNA-RNA binding compared to RNA-DNA binding. Thus, dsDNA-peptide conjugates that are transcribed can lower the detection limit of protein identification and simplify the assay.
[0088] Peptide was conjugated to the 5 end of T7 promoter forward and T7 terminator reverse primers using copper-free click chemistry. These two primers are designed to bind to universal sequences that flank nearly all the trigger expression cassettes in the riboregulators that our group has developed. These cassettes employ the T7 promoter to direct binding of T7 RNA polymerase for transcription and have a T7 terminator to halt transcription from the plasmid. Different primer concentrations were tested for reaction optimization and we evaluated multiple combinations of peptide-conjugated and unmodified primers. The data show only a slight increase in product concentration as initial primer concentration was increased compared to the control (
[0089] Double-stranded PCR products from biotin- and SBP-attached primers were also tested for functionality of toehold switch activation using a cell-free system. Results showed toehold activation, indicating not only PCR dsDNA product functionality was maintained but that the product could be transcribed with the SBP peptide attached in the cell-free system (
[0090] 3) Implementation of Peptide Displacement Reactions in Paper Test Strips:
[0091] Lateral flow assays based on paper test strips were studied as a means to test the ability of a peptide-DNA conjugate to be displaced upon detection of a target analyte. For a proof-of-concept assay, we aimed to bind the signal peptide-DNA conjugate to a test band line in the strip (
[0092] We first studied peptide displacement using the paper test strips. For these experiments, we employed a streptavidin-binding peptide (SBP) to bind to a commercial lateral flow test strip (Milenia HybriDetect, TwistDx Ltd.). These lateral flow strips have a test band containing streptavidin and a sample receiving area containing gold nanoparticles decorated with anti-FITC antibodies. A control band is positioned downstream of the test band and contains a secondary antibody for binding the conserved region of the anti-FITC antibody.
[0093] To enable detection using anti-FITC antibodies, the SBP peptide was further conjugated to FITC to produce SBP-FITC. SBP-FITC conjugates were first bound to the streptavidin test band by applying them in an aqueous solution to the sample receiving area (
[0094] We then implemented our proof-of-concept test by taking a conjugate consisting of SBP bound to the FER1_T16 DNA trigger sequence (SBP-FER1_T16). The conjugate was first applied to the sample area and allowed to bind to the streptavidin test band. Concentrations of 10 nM and 100 nM of SBP-FER1_T16 were evaluated to determine the optimal level for toehold switch activation. Following binding to streptavidin, excess SBP-FER1_T16 conjugates were then rinsed away by applying extra water to the sample receiving area. After this step, a biotin solution was applied as a sample while comparison experiments were conducted by applying water alone. After flow through of the sample had occurred, paper disks containing the cell-free systems and toehold switch FER1_H16 regulating lacZ were then contacted to the strip downstream of the control line and rehydrated to activate the cell-free reaction. We observed the resulting color-change reactions in a plate reader to assess activation of the toehold switch by any displaced SBP-FER1_T16 signal molecules (
[0095] The above research demonstrates the working components of a paper-based diagnostic that combines the ease of use and sensitivity of nucleic acid tests with the profound importance of other biomolecules such as proteins, antibodies, carbohydrates, and lipids in reporting human health. Upon completion, the working components will result in a synthetic gene network with the ability to respond to multiple nucleic acid and non-nucleic acid signals. In the presence of a target protein, a DNA-peptide conjugate is displaced from a target antibody. The DNA-peptide conjugate can then interact with a toehold switch, activating gene expression of a measurable protein. To expand on this project, we look to incorporate the use of peptide arrays, making it a cost-effective diagnostic to profile a wide range of diseases where a single biomarker is insufficient for conclusively identifying an illness. Applying this network to an array of peptides will provide a novel way to directly measure the products of the immune system through protein-to-nucleic signal transduction, creating a new class of diagnostics. This concept will result in a universal diagnostic that has durability and accessibility required for real world applications in global health.
[0096] Methods:
[0097] Toehold selection and construction: The trigger and toehold plasmid inserts were constructed using PCR. This was done through the combination of two linear constructs, containing the origin of replication site and antibiotic resistance gene, and the riboregulator or trigger sequence. Both plasmids contain T7 promoter and T7 terminator regions. The toehold plasmid also contains the coding sequence for either GFP or LacZ to monitor toehold activation.
[0098] Synthesis of DNA-Peptide Conjugate: Peptides were synthesized using solid phase peptide synthesis or purchased from Watson biotech with a non-canonical azidolysine at the N-terminus. Peptides synthesized from solid phase peptide synthesis were purified using high pressure liquid chromatography (HPLC) and characterized using matrix-assisted laser desorption/ionization mass spectrometry and gel electrophoresis. Peptides purchased from Watsonbio were >90% HPLC purity grade and no further purification was needed.
[0099] While the preferred embodiments of the present invention have been illustrated in detail, it should be apparent that modifications and adaptations to those embodiments may occur to one skilled in the art without departing from the scope of the present invention as set forth in the following claims.