Regulation of mesodermal specification
10858627 ยท 2020-12-08
Assignee
Inventors
- Daniel J. Garry (Eagan, MN, US)
- Naoko Koyano-Nakagawa (Shoreview, MN, US)
- Mary G. Garry (Eagan, MN, US)
- Bhairab Singh (Falcon Heights, MN, US)
Cpc classification
C12N5/0606
CHEMISTRY; METALLURGY
C12N2506/45
CHEMISTRY; METALLURGY
A61K35/44
HUMAN NECESSITIES
C12N5/0692
CHEMISTRY; METALLURGY
A61P17/02
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
C12N5/0647
CHEMISTRY; METALLURGY
C12N5/0696
CHEMISTRY; METALLURGY
International classification
A61K48/00
HUMAN NECESSITIES
A61K35/44
HUMAN NECESSITIES
A61P17/02
HUMAN NECESSITIES
Abstract
Disclosed is a method to differentiate stern, progenitor or precursor cells comprising contacting said stem, progenitor or precursor cells with miR-130a, or an RNA having at least 95% identity thereto, so as to yield cells of endothelial lineage. Further disclosed are compositions comprising the endothelial lineage cells obtained and methods of using the compositions for treating diseases including cardiovascular diseases.
Claims
1. A method to differentiate cells comprising over-expressing miR-130a in Flk1.sup.+/Pdgfra.sup.low hemato-endothelial progenitors or Fkl1.sup.+/Pdgfra.sup.+ mesodermal precursor cells, or nucleic acid having at least 95% identity miR-130a, so as to yield cells of endothelial lineage, wherein the nucleic acid is RNA.
2. The method of claim 1, wherein the cells are mammalian cells.
3. The method of claim 1, further comprising admixing the endothelial lineage cells with a pharmaceutically acceptable carrier or a cell culture medium.
4. The method of claim 1, wherein cells administered to the subject are autologous or allogeneic.
5. A composition comprising Flk1.sup.+/Pdgfra.sup.low hemato-endothelial progenitors or Fkl1.sup.+/Pdgfra.sup.+ mesodermal precursor cells overexpressing mir-130a and a carrier.
6. The composition of claim 5, wherein the cells are mammalian.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION OF THE INVENTION
(10) MicroRNAs (small non-coding RNAs) are known to regulate developmental stages during embryogenesis. MicroRNAs (miRNAs) govern the molecular switch by suppressing gene expression, thereby modulating and fine-tuning cell fate decisions (Ivey and Srivastava, 2010). Although global deletion as well as hypomorphic mutants of Dicer (miRNA processing enzyme) results in embryonic lethality (Bernstein et al., 2003; Yang et al., 2005), it is unclear whether miRNAs play any role in the hemato-endothelial segregation and vascular development.
(11) Herein is disclosed a novel Etv2-miR-130a cascade that regulates mesodermal specification and determination. Ablation of Dicer in the Etv2-expressing precursors resulted in altered mesodermal lineages and embryonic lethality by E12.5. miR-130a was identified as a direct target of Etv2 and demonstrated its role in the segregation of bipotent hemato-endothelial progenitors towards the endothelial lineage. Loss- and gain-of-function experiments demonstrated that miR-130a is a regulator of the endothelial program at the expense of cardiac program without impacting the hematopoietic lineages. Mechanistically, miR-130a directly suppresses expression level of Pdgfra and promotes the endothelial program by blocking Pdgfra signaling. Inhibition or activation of Pdgfra signaling phenocopied the miR-130a over-expression and knockdown, respectively. This is the first report of a miRNA that specifically promotes the divergence of the common hemato-endothelial progenitor to the endothelial lineage (miRNA mediated regulation of mesodermal precursors).
Definitions
(12) The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention.
(13) As used herein, the indefinite articles a, an and the should be understood to include plural reference unless the context clearly indicates otherwise.
(14) The phrase and/or, as used herein, should be understood to mean either or both of the elements so conjoined, e.g., elements that are conjunctively present in some cases and disjunctively present in other cases.
(15) As used herein, or should be understood to have the same meaning as and/or as defined above. For example, when separating a listing of items, and/or or or shall be interpreted as being inclusive, e.g., the inclusion of at least one, but also including more than one, of a number of items, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as only one of or exactly one of, or, when used in the claims, consisting of, will refer to the inclusion of exactly one element of a number or list of elements. In general, the term or as used herein shall only be interpreted as indicating exclusive alternatives (i.e., one or the other but not both) when preceded by terms of exclusivity, such as either, one of, only one of, or exactly one of.
(16) As used herein, the terms including, includes, having. has, with, or variants thereof, are intended to be inclusive similar to the term comprising.
(17) As used herein, the term about means plus or minus 10% of the indicated value. For example, about 100 means from 90 to 110.
(18) The term isolated refers to a cell or cells which are not associated with one or more cells or one or more cellular components that are associated with the cell or cells in vivo.
(19) A subject is a vertebrate, such as a mammal, including a human. Mammals include, but are not limited to, humans, farm animals, sport animals and companion animals. Included in the term animal is dog, cat, fish, gerbil, guinea pig, hamster, horse, rabbit, swine, mouse, monkey (e.g., ape, gorilla, chimpanzee, and orangutan) rat, sheep, goat, cow and bird. Subjects that can benefit from the cells and methods of the invention include, but are not limited to, those suffering from a loss of function of endodermal cells, including, but not limited to, liver or pancreatic cells, as a result of physical or disease related damage.
(20) Totipotent (a.k.a. omnipotent) stem cells can differentiate into embryonic and extraembryonic cell types. Such cells can construct a complete, viable organism. These cells are produced from the fusion of an egg and sperm cell. Cells produced by the first few divisions of the fertilized egg are also totipotent. Pluripotent stem cells are the descendants of totipotent cells and can differentiate into nearly all cells, i.e. cells derived from any of the three germ layers. Multipotent stem cells can differentiate into a number of cell types, but only those of a closely related family of cells. Oligopotent stem cells can differentiate into only a few cell types, such as lymphoid or myeloid stem cells. Unipotent cells can produce only one cell type, their own,[4] but have the property of self-renewal, which distinguishes them from non-stem cells (e.g. progenitor cells, muscle stem cells).
(21) Expansion refers to the propagation of cells without differentiation.
(22) Progenitor cells are cells produced during differentiation of a stem cell that have some, but not all, of the characteristics of their terminally-differentiated progeny. Defined progenitor cells are committed to a lineage, but not to a specific or terminally-differentiated cell type. The phrase endothelial cells encompasses not only terminally-differentiated cells types, but also cells that are committed to an endothelial lineage, but are not terminally-differentiated.
(23) Differentiation factors refer to cellular factors, preferably growth factors or angiogenic factors that induce lineage commitment.
(24) Self-renewal refers to the ability to produce replicate daughter cells having differentiation potential that is identical to those from which they arose. A similar term used in this context is proliferation.
(25) An effective amount generally means an amount which provides the desired local or systemic effect and/or performance, particularly for treating a condition of interest.
(26) The terms comprises, comprising, and the like can have the meaning ascribed to them in U.S. Patent Law and can mean includes, including and the like. As used herein. including or includes or the like means including, without limitation.
(27) Stem/Precursor/Progenitor Cells
(28) Stem/Precursor/Progenitor cells are undifferentiated biological cells that can differentiate into specialized cells and can divide (through mitosis) to produce more stem cells. They are found in multicellular organisms. In adult organisms, stem cells and progenitor cells act as a repair system for the body, replenishing adult tissues. In a developing embryo, stem cells can differentiate into all the specialized cells-ectoderm, endoderm and mesoderm (see induced pluripotent stem cells)-but also maintain the normal turnover of regenerative organs, such as blood, skin, or intestinal tissues.
(29) Autologous adult stem cells can be obtained from many sources in humans, such as bone marrow (which requires extraction by harvesting that is, drilling into bone (typically the femur or iliac crest); adipose tissue (lipid cells; which requires extraction, such as by liposuction); and/or blood (which requires extraction through apheresis, wherein blood is drawn from the donor (similar to a blood donation), and passed through a machine that extracts the stem cells and returns other portions of the blood to the donor). Heterologous and xenogeneic cells can also be used in methods of the invention.
(30) Stem cells can also be taken from umbilical cord blood just after birth. By definition, autologous cells are obtained from one's own body, just as one may bank his or her own blood for elective surgical procedures.
(31) In one embodiment, the precursor cells are multipotent mesodermal precursor cells expressing Flk1.sup.+/Pdgfra.sup.+.
(32) Methods of isolating various stem and/or progenitor and/or precursor cells are available to an art worker. Stem and/or progenitor and/or precursor cells can also be isolated in the presence of various factors such as LIF (e.g., at a concentration of about 5,000 U/ml to about 50,000 U/ml, such as about 10,000 U/ml). EGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng/ml), basic FGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng/ml) or PDGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng/ml).
(33) During and after isolation, stem and/or progenitor and/or precursor cells can be cultured in culture medium that is well established in the art and commercially available from the American Type Culture Collection (ATCC). Such media include, but are not limited to, Dulbecco's Modified Eagle's Medium (DMEM), DMEM F12 medium, Eagle's Minimum Essential Medium, F-12K medium, Iscove's Modified Dulbecco's Medium, or RPMI-1640 medium. It is within the skill of one in the art to modify or modulate concentrations of media and/or media supplements as needed for the cells used. It will also be apparent that many media are available as low-glucose formulations, with or without sodium pyruvate.
(34) Also contemplated is supplementation of cell culture medium with mammalian sera. Sera often contain cellular factors and components that are necessary for viability and expansion. Examples of sera include fetal bovine serum (FBS), bovine serum (BS), calf serum (CS), fetal calf serum (FCS), newborn calf serum (NCS), goat serum (GS), horse serum (HS), human serum, chicken serum, porcine serum, sheep serum, rabbit serum, rat serum (RS), serum replacements, and bovine embryonic fluid. It is understood that sera can be heat-inactivated at 55-65 C if deemed necessary to inactivate components of the complement cascade. Modulation of serum concentrations, or withdrawal of serum from the culture medium can also be used to promote survival of one or more desired cell types. In one embodiment, the endodermal progenitor cells are cultured in the presence of FBS/or serum specific for the species cell type. For example, endodermal progenitor cells can be isolated and/or expanded with total serum (e.g., FBS) concentrations of about 0.5% to about 5% or greater including about 5% to about 15%. Concentrations of serum can be determined empirically.
(35) Additional supplements can also be used to supply the cells with trace elements for optimal growth and expansion. Such supplements include insulin, transferrin, sodium selenium, and combinations thereof. These components can be included in a salt solution such as, but not limited to, Hanks' Balanced Salt Solution (HBSS), Earle's Salt Solution, antioxidant supplements. MCDB-201 supplements, phosphate buffered saline (PBS), N-2-hydroxyethylpiperazine-N-ethanesulfonic acid (HEPES), nicotinamide, ascorbic acid and/or ascorbic acid-2-phosphate, as well as additional amino acids. Many cell culture media already contain amino acids; however some require supplementation prior to culturing cells. Such amino acids include, but are not limited to, L-alanine, L-arginine, L-aspartic acid, L-asparagine, L-cysteine, L-cystine, L-glutamic acid, L-glutamine, L-glycine, L-histidine, L-inositol, L-isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, L-proline, L-serine, L-threonine, L-tryptophan, L-tyrosine, and L-valine.
(36) Antibiotics are also typically used in cell culture to mitigate bacterial, mycoplasmal, and fungal contamination. Typically, antibiotics or anti-mycotic compounds used are mixtures of penicillin/streptomycin, but can also include, but are not limited to, amphotericin (Fungizone), ampicillin, gentamicin, bleomycin, hygromycin, kanamycin, mitomycin, mycophenolic acid, nalidixic acid, neomycin, nystatin, paromomycin, polymyxin, puromycin, rifampicin, spectinomycin, tetracycline, tylosin, and zeocin.
(37) Hormones can also be advantageously used in cell culture and include, but are not limited to, D-aldosterone, diethylstilbestrol (DES), dexamethasone, -estradiol, hydrocortisone, insulin, prolactin, progesterone, somatostatin/human growth hormone (HGH), thyrotropin, thyroxine, and L-thyronine, -mercaptoethanol can also be supplemented in cell culture media.
(38) Lipids and lipid carriers can also be used to supplement cell culture media, depending on the type of cell and the fate of the differentiated cell. Such lipids and carriers can include, but are not limited to cyclodextrin, cholesterol, linoleic acid conjugated to albumin, linoleic acid and oleic acid conjugated to albumin, unconjugated linoleic acid, linoleic-oleic-arachidonic acid conjugated to albumin, oleic acid unconjugated and conjugated to albumin, among others. Albumin can similarly be used in fatty-acid free formulation.
(39) Also contemplated is the use of feeder cell layers. Feeder cells can be used to support the growth of cultured cells, including, stem and/or progenitor and/or precursor cells. Feeder cells are normal cells that have been inactivated by -irradiation. In culture, the feeder layer serves as a basal layer for other cells and supplies cellular factors without further growth or division of their own (Lim and Bodnar 2002). Examples of feeder layer cells typically used with liver cell cultures are hepatocytes and embryonic fibroblasts (Suzuki, A. et al. 2000), but can be any post-mitotic cell that is capable of supplying cellular components and factors that are advantageous in allowing optimal growth, viability, and expansion of, stem and/or progenitor and/or precursor cells. In some cases, feeder cell layers are not needed to keep cells in an undifferentiated, proliferative state, as leukemia inhibitory factor (LIF) has anti-differentiation properties. Often, supplementation of a defined concentration of LIF is all that is necessary to maintain cells in an undifferentiated state.
(40) Cells in culture can be maintained either in suspension or attached to a solid support, such as extracellular matrix components and synthetic or biopolymers. Cells often require additional factors that encourage their attachment to a solid support (e.g., attachment factors) such as type I, type II, and type IV collagen, concanavalin A, chondroitin sulfate, fibronectin, superfibronectin and/or fibronectin-like polymers, gelatin, laminin, poly-D and poly-L-lysine, Matrigel, thrombospondin, and/or vitronectin.
(41) The maintenance conditions of cells can also contain cellular factors that allow cells, such as stem and/or progenitor and/or precursor cells, to remain in an undifferentiated form. It may be advantageous under conditions where the cell must remain in an undifferentiated state of self-renewal for the medium to contain epidermal growth factor (EGF), platelet derived growth factor (PDGF), leukemia inhibitory factor (LIF), basic fibroblast growth factor (bFGF) and combinations thereof. It is apparent to those skilled in the art that supplements that allow the cell to self-renew (e.g., to produce replicate daughter cells having differentiation potential that is identical to those from which they arose; a similar term used in this context is proliferation), but not differentiate should be removed from the culture medium prior to differentiation. It is also apparent that not all cells will require these factors. In fact, these factors may elicit unwanted effects, depending on the cell type.
(42) Stem and/or progenitor and/or precursor cells can be selected based on the markers (gene and/or protein) described herein. Accordingly, positive selection methods can be used, either alone or together with the methods described above, to identify and/or isolate the cells of the invention. Methods of positive selection can include visual selection, using microscopy and/or other means of detection, including, but not limited to, immunoblotting, immunofluorescence, and/or enzyme-linked immunosorbent assay. Other methods of positive selection can also include, but are not limited to, additional selective culture techniques (e.g., variable cell densities or amounts of CO.sub.2), flow cytometry, RT-PCR, and/or microchip-based methods of cell separation.
(43) Endothelium
(44) The endothelium is the thin layer of simple squamous cells that lines the interior surface of blood vessels and lymphatic vessels, forming an interface between circulating blood or lymph in the lumen and the rest of the vessel wall. The cells that form the endothelium are called endothelial cells. Endothelial cells in direct contact with blood are called vascular endothelial cells, whereas those in direct contact with lymph are known as lymphatic endothelial cells.
(45) Vascular endothelial cells line the entire circulatory system, from the heart to the smallest capillaries. These cells have unique functions in vascular biology. These functions include fluid filtration, such as in the glomeruli of the kidney, blood vessel tone, hemostasis, neutrophil recruitment, and hormone trafficking. Endothelium of the interior surfaces of the heart chambers is called endocardium.
(46) Endothelium is mesodermal in origin. Both blood and lymphatic capillaries are composed of a single layer of endothelial cells called a monolayer. In straight sections of a blood vessel, vascular endothelial cells typically align and elongate in the direction of fluid flow.
(47) The foundational model of anatomy makes a distinction between endothelial cells and epithelial cells on the basis of which tissues they develop from, and states that the presence of vimentin rather than keratin filaments separate these from epithelial cells.
(48) Endothelial cells are involved in many aspects of vascular biology, including: barrier function (the endothelium acts as a semi-selective barrier between the vessel lumen and surrounding tissue, controlling the passage of materials and the transit of white blood cells into and out of the bloodstream; Excessive or prolonged increases in permeability of the endothelial monolayer, as in cases of chronic inflammation, may lead to tissue edema/swelling); blood clotting (thrombosis & fibrinolysis; the endothelium normally provides a non-thrombogenic surface because it contains, for example, heparan sulfate which acts as a cofactor for activating antithrombin, a protease that inactivates several factors in the coagulation cascade); inflammation; formation of new blood vessels (angiogenesis); vasoconstriction and vasodilation (and hence the control of blood pressure); repair of damaged or diseased organs via an injection of blood vessel cells; and angiopoietin-2 works with VEGF to facilitate cell proliferation and migration of endothelial cells.
(49) Endothelial dysfunction, or the loss of proper endothelial function, is a hallmark for vascular diseases, and is often regarded as a key early event in the development of atherosclerosis. Impaired endothelial function, causing hypertension and thrombosis, is often seen in patients with coronary artery disease, diabetes mellitus, hypertension, hypercholesterolemia, as well as in smokers. Endothelial dysfunction has also been shown to be predictive of future adverse cardiovascular events, and is also present in inflammatory disease such as rheumatoid arthritis and systemic lupus erythematosus. One of the main mechanisms of endothelial dysfunction is the diminishing of nitric oxide, often due to high levels of asymmetric dimethylarginine, which interfere with the normal L-arginine-stimulated nitric oxide synthesis and so leads to hypertension. The most prevailing mechanism of endothelial dysfunction is an increase in reactive oxygen species, which can impair nitric oxide production and activity via several mechanisms. The signaling protein ERK5 plays a role in maintaining normal endothelial cell function. A further consequence of damage to the endothelium is the release of pathological quantities of von Willebrand factor, which promote platelet aggregation and adhesion to the sub-endothelium, and thus the formation of thrombi.
(50) Differentiation and Use for Endothelial Cells
(51) Stem, precursor and progenitor cells can be used for the generation of endothelial cells or endothelia precursors (the term endothelial cells refers to cells of varying degree of differentiation, some may be fully differentiated down the endothelial pathway, while others are in the early stages and can still be directed down one or endothelial lineages). One embodiment provides methods for providing endothelial cells comprising differentiating stem, precursor and progenitor cells in the presence of miR-130a and optionally Etv2 (sequence information provided in Example 2 below), and isolating the endothelial cells. Differentiation can occur in vitro, in vivo or ex vivo.
(52) miR-130 microRNA precursor is a small non-coding RNA that regulates gene expression. This microRNA has been identified in mouse (MI0000156 (GAGCUCUUUUCACAUUGUGCUACUGUCUAACGUGUACCGAGCAGU GCAAUGUUAAAAGGGCAUC; SEQ ID NO:1), MI0000408 (GGCUUGUUGGACACUCUUUCCCUGUUGCACUACUGUGGGCCUCUG CGGAAGCAGUGCAAUGAUGAAAGGGCAUCUGUCCGGGCC; SEQ ID NO:2)), and in human (MI0000448 (UGCUGCUGGCCAGAGCUCUUUUCACAUUGUGCUACUGUCUGCACC UGUCACUAGCAGUGCAAUGUUAAAAGGGCAUUGGCCGUGUAGUG; SEQ ID NO:3), MI0000748 (GGCCUGCCCGACACUCUUUCCCUGUUGCACUACUAUAGGCCGCUG GGAAGCAGUGCAAUGAUGAAAGCCjCAUCGGUCAGGUC; SEQ ID NO:4)). Mentioned below is the seed sequence for miR-130a. The data is obtained from the mirbase (http//www.mirbase.org)>mmu-miR-130a-3p MIMAT0000141-CAGUGCAAUGUUAAAAGGGCAU (SEQ ID NO:5) (the seed sequence for miR-130 can be used as a screening tool to search and/or engineer small molecules that bind/interact with the seed sequence and cause the effect of, for example, increased endothelium, as with miR-130).
(53) In one embodiment, the miR-130 is as disclosed herein or 95% identical thereto. IN another embodiment, the mirNA-130 has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity to the nucleic acid sequences disclosed herein.
(54) As used herein, percent identity of two nucleic acid sequences (or of two amino acid sequences) is determined using the algorithm of Karlin and Altschul (PNAS USA 87:2264-2268, 1990), modified as in Karlin and Altschul, PNAS USA 90:5873-5877, 1993). Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al. (J. Mol. Biol. 215:403-410, 1990). BLAST nucleotide searches are performed with the NBLAST program, score=100, wordlength=12. BLAST protein searches are performed with the XBLAST program, score=50, wordlength=3. To obtain gapped alignment for comparison purposes GappedBLAST is utilized as described in Altschul et al. (Nucleic Acids Res. 25:3389-3402, 1997). When utilizing BLAST and GappedBLAST programs the default parameters of the respective programs (e.g., XBLAST and NBLAST) are used to obtain nucleotide sequences homologous to a nucleic acid molecule of the invention.
(55) Identity or identical means nucleic acid sequence (or amino acid sequence) similarity and has an art recognized meaning. Sequences with identity share identical or similar amino acids (or nucleic acids). Sequence identity is the percentage of amino acids identical to those in the antibody's original amino acid sequence, determined after the sequences are aligned and gaps are appropriately introduced to maximize the sequence identity as necessary. Thus, a candidate sequence sharing 85% amino acid sequence identity with a reference sequence requires that, following alignment of the candidate sequence with the reference sequence, 85% of the amino acids in the candidate sequence are identical to the corresponding amino acids in the reference sequence, and/or constitute conservative amino acid changes.
(56) miR-130 appears to be vertebrate-specific miRNA and has now been predicted or experimentally confirmed in a range of vertebrate species (MIPF0000034). Mature microRNAs are processed from the precursor stem-loop by the Dicer enzyme. In this case, the mature sequence is excised from the 3 arm of the hairpin. It has been found that miR-130 is upregulated in a type of cancer called hepatocellular carcinoma.
(57) Methods of identifying and subsequently isolating differentiated cells from their undifferentiated counterparts can be carried out by methods available to an art worker. Cells that have been induced to differentiate can be identified by selectively culturing cells under conditions whereby differentiated cells outnumber undifferentiated cells. These conditions include, for example, extending the amount of time that cells are grown in culture, such that survival of a desired cell type is encouraged. Many primary cells achieve senescence, and fail to divide, or die, after a period of time. Other conditions comprise modulating the type and concentration of serum, or culturing the cells in the presence or absence of growth factors and/or cytokines that induce differentiation to another cell type. Differentiation can also be advantageously achieved by modulation of serum concentrations, or withdrawal of serum from the culture. Other methods of inducing differentiation can include, but are not limited to, modulating the acidity of the culture medium, as well as the oxygen and carbon dioxide levels during culture.
(58) Similarly, differentiated cells can be identified by morphological changes and characteristics that are not present on their undifferentiated counterparts, such as cell size, the number of cellular processes (i.e., formation of dendrites and/or branches), and the complexity of intracellular organelle distribution. Also contemplated are methods of identifying differentiated cells by their expression of specific cell-surface markers such as cellular receptors and transmembrane proteins. Monoclonal antibodies against these cell-surface markers can be used to identify differentiated cells. Detection of these cells can be achieved through fluorescence activated cell sorting (FACS), and/or enzyme-linked immunosorbent assay (ELISA). From the standpoint of transcriptional upregulation of specific genes, differentiated cells often display levels of gene expression that are different from undifferentiated cells. Reverse-transcription polymerase chain reaction (RT-PCR) can also be used to monitor changes in gene expression in response to differentiation. In addition, whole genome analysis using microarray technology can be used to identify differentiated cells.
(59) Accordingly, once differentiated cells are identified, they can be separated from their undifferentiated counterparts, if necessary. The methods of identification detailed above also provide methods of separation, such as FACS, preferential cell culture methods, ELISA, magnetic beads, and combinations thereof. One embodiment of the invention envisions the use of FACS to identify and separate cells based on cell-surface antigen expression.
(60) Administration/Treatment
(61) Endothelial cells of the invention can be used in cell replacement therapies. Endothelial cells can be administered to a tissue of interest in a subject to supplement functioning cells or replace cells, which have lost function. Alternatively, methods of providing differentiated cells are also contemplated, wherein the endothelial cells are differentiated in the presence of differentiation factors, isolated, and administered into or upon the body of a subject.
(62) For the purposes described herein, either autologous, allogeneic or xenogeneic cells can be administered to a patient, either in undifferentiated, terminally differentiated or in a partially differentiated form, genetically altered or unaltered, by direct introduction to a site of interest, e.g., on or around the surface of an acceptable matrix, or systemically, in combination with a pharmaceutically acceptable carrier so as to repair, replace or promote the growth of existing and/or new blood vessels.
(63) Disease states could benefit from endothelial cells and methods of the invention include, but are not limited to, cardiovascular disease, wound healing, and/or repopulation or engineering vasculature in vitro and/or in vivo.
(64) Exogenous factors (e.g., cytokines, differentiation factors and other factors) can be administered prior to, after or concomitantly with the endothelial cells of the invention. For example, a form of concomitant administration would comprise combining a factor of interest in the culture media and/or pharmaceutically acceptable carrier prior to administration. Doses for administrations are variable, may include an initial administration followed by subsequent administrations; but nonetheless, can be ascertained by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
(65) Endothelial cells of the invention or their progeny can be administered via localized injection, including catheter administration, systemic injection, localized injection, parenteral administration, or intrauterine injection into an embryo.
(66) A method to potentially increase cell survival, when introducing the cells into a subject in need thereof, is to incorporate endothelial cells into a biopolymer or synthetic polymer. Depending on the subject's condition, the site of injection might prove inhospitable for cell seeding and growth because of scarring or other impediments. Examples of biopolymer include, but are not limited to, cells mixed with fibronectin, fibrin, fibrinogen, thrombin, collagen, and proteoglycans. This could be constructed with or without included cytokines, growth factors, differentiation factors or nucleic acid expression constructs. Additionally, these could be in suspension, but residence time at sites subjected to flow would be nominal. Another alternative is a three-dimensional gel with cells entrapped within the interstices of the cell biopolymer admixture. Again, differentiation factors, growth factors or cytokines could be included within the cells. These could be deployed by injection via various routes described herein.
(67) A parameter involved in the therapeutic use of endothelial cells is the quantity of cells necessary to achieve an optimal effect. In current human studies of autologous mononuclear bone marrow cells, empirical doses ranging from 1 to 410.sup.7 cells have been used with encouraging results. However, different scenarios may require optimization of the amount of cells injected into a tissue of interest. Thus, the quantity of cells to be administered will vary for the subject being treated. In one embodiment, between 10.sup.4 to 10.sup.8, more preferably 10.sup.5 to 10.sup.7, and most preferably 310.sup.7 progenitor cells and optionally, 50 to 500 g/kg per day of a cytokine can be administered to a human subject. However, the precise determination of what would be considered an effective dose may be based on factors individual to each patient, including their size, age, size tissue damage, and amount of time since the damage occurred. Therefore, dosages can be readily ascertained by those skilled in the art from this disclosure and the knowledge in the art.
(68) Another parameter involved in the use of endothelial cells is the purity of the population. Those skilled in the art can readily determine the percentage of endothelial cells in a population using various well-known methods, such as fluorescence activated cell sorting (FACS). Preferable ranges of purity in populations comprising endothelial cells are about 1 to about 5%, about 5 to about 10%, about 10 to about 15%, about 15 to about 20%, about 20 to about 25%, about 25 to about 30%, about 30 to about 35%, about 35 to about 40%, about 40 to about 45%, about 45 to about 50%, about 50 to about 55%, about 55 to about 60%, about 60 to about 65%, about 65 to about 70%, about 70 to about 75%, about 75 to about 80%, about 80 to about 85%, about 85 to about 90%, about 90% to about 95% or about 95 to about 100%. Purity of the cells can be determined according to the cell surface marker profile within a population. Dosages can be readily adjusted by those skilled in the art (e.g., a decrease in purity may require an increase in dosage).
(69) The skilled artisan can readily determine the amount of cells and optional additives, vehicles, and/or carrier in compositions to be administered in methods of the invention. Typically, any additives (in addition to the active cell(s) and/or cytokine(s)) are present in an amount of 0.001 to 50% (weight) solution in phosphate buffered saline, and the active ingredient is present in the order of micrograms to milligrams, such as about 0.0001 to about 5 wt %, preferably about 0.0001 to about 1 wt %, most preferably about 0.0001 to about 0.05 wt % or about 0.001 to about 20 wt %, preferably about 0.01 to about 10 wt %, and most preferably about 0.05 to about 5 wt %. Of course, for any composition to be administered to an animal or human, and for any particular method of administration, it is preferred to determine the toxicity, such as by determining the lethal dose (LD) and LD50 in a suitable animal model e.g., rodent such as mouse; and, the dosage of the composition(s), concentration of components therein and timing of administering the composition(s), which elicit a suitable response. Such determinations do not require undue experimentation from the knowledge of the skilled artisan, this disclosure and the documents cited herein. And, the time for sequential administrations can be ascertained without undue experimentation.
(70) When administering a therapeutic composition of the present invention, it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion) However, the cells can be administered to a subject by a variety of methods available to the art, including but not limited to localized injection, catheter administration, systemic injection, intraperitoneal injection parenteral administration, oral administration, intracranial injection, intra-arterial injection, intravenous injection, intraventricular infusion, intraplacental injection, intrauterine injection, surgical intramyocardial injection, transendocardial injection transvascular injection, intracoronary injection, transvascular injection, intramuscular injection, surgical injection into a tissue of interest or via direct application to tissue surfaces (e.g., during surgery or on a wound). The pharmaceutical formulations suitable for injection include sterile aqueous solutions and dispersions. The carrier can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof.
(71) Additionally, various additives which enhance the stability, sterility, and isotonicity of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. In many cases, it will be desirable to include isotonic agents, for example, sugars, sodium chloride, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin. According to the present invention, however, any vehicle, diluent, or additive used would have to be compatible with the cells.
(72) Sterile injectable solutions can be prepared by incorporating the cells utilized in practicing the present invention in the required amount of the appropriate solvent with various amounts of the other ingredients, as desired. Examples of compositions comprising progenitor cells of the invention include liquid preparations for administration, including suspensions; and, preparations for intramuscular or intravenous administration (e.g., injectable administration), such as sterile suspensions or emulsions. Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting or emulsifying agents, pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts, such as REMINGTON'S PHARMACEUTICAL SCIENCE, 17th edition, 1985, which is incorporated herein by reference, may be consulted to prepare suitable preparations, without undue experimentation.
(73) Compositions of the invention are conveniently provided as liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions or viscous compositions, which may be buffered to a selected pH. Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
(74) The choice of suitable carriers and other additives will depend on the exact route of administration and the nature of the particular dosage form, e.g., liquid dosage form (e.g., whether the composition is to be formulated into a solution, a suspension, gel or another liquid form, such as a time release form or liquid-filled form).
(75) Solutions, suspensions and gels normally contain a major amount of water (e.g., purified, sterilized water) in addition to the cells. Minor amounts of other ingredients such as pH adjusters (e.g., a base such as NaOH), emulsifiers or dispersing agents, buffering agents, preservatives, wetting agents and jelling agents (e.g., methylcellulose), may also be present. The compositions can be isotonic, i.e., they can have the same osmotic pressure as blood and lacrimal fluid.
(76) The desired isotonicity of the compositions of this invention may be accomplished using sodium chloride, or other pharmaceutically acceptable agents such as dextrose, boric acid, sodium tartrate, propylene glycol or other inorganic or organic solutes.
(77) Viscosity of the compositions, if desired, can be maintained at the selected level using a pharmaceutically acceptable thickening agent. Methylcellulose is readily and economically available and is easy to work with. Other suitable thickening agents include, for example, xanthan gum, carboxymethyl cellulose, hydroxypropyl cellulose, carbomer, and the like. The concentration of the thickener will depend upon the agent selected. The point is to use an amount, which will achieve the selected viscosity. Viscous compositions are normally prepared from solutions by the addition of such thickening agents.
(78) A pharmaceutically acceptable preservative or cell stabilizer can be employed to increase the life of the compositions. If preservatives are used, it is well within the purview of the skilled artisan to select compositions that will not affect the viability or efficacy of the endodermal progenitor cells as described herein.
(79) Those skilled in the art will recognize that the components of the compositions should be selected to be chemically inert. This will present no problem to those skilled in chemical and pharmaceutical principles, or problems can be readily avoided by reference to standard texts or by simple experiments (not involving undue experimentation), from this disclosure and the documents cited herein.
(80) Compositions can be administered in dosages and by techniques well known to those skilled in the medical and veterinary arts taking into consideration such factors as the age, sex, weight, and condition of the particular patient, and the composition form used for administration (e.g., solid vs. liquid). Dosages for humans or other mammals can be determined without undue experimentation by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
(81) Suitable regimes for initial administration and further doses or for sequential administrations also are variable and may include an initial administration followed by subsequent administrations; but nonetheless, can be ascertained by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
(82) Endothelial cells of the invention can be used for many diverse clinical and pre-clinical applications, which can include, but are not limited to, use in toxicological or genomic screening methods, determination of levels of enzymes and coagulation factors, as well as treatment of the diseases disclosed herein. Endothelial cells of the invention can provide a variety of differentiated cultured cell types for high-throughput toxicological or genomic screening. The cells can be cultured in, for example, 96-well or other multi-well culture plates to provide a system for high-throughput screening of, for example, target cytokines, chemokines, growth factors, or pharmaceutical compositions in pharmacogenomics or pharmacogenetics.
(83) The invention also envisions a tissue-engineered organ, or portion, or specific section thereof, a tissue engineered device comprising a tissue of interest and optionally, cytokines, growth factors, or differentiation factors that induce differentiation into a desired cell type, wherein the endothelial cells are used to generate tissue/vasculature.
(84) The following examples are provided in order to demonstrate and further illustrate certain embodiments and aspects of the present invention and is not to be construed as limiting the scope thereof.
Examples
(85) Materials and Methods
(86) Generation of Dicer Conditional Null Mice and Morphological Analysis
(87) Dicer.sup.L/L mice (strain: B6.Cg-Dicer.sup.tmlBdh/J) (Harfe et al., 2005) were intercrossed with Mesp1-Cre (Saga et al., 1999), Flk1-Cre (Shalaby et al., 1995) and Etv2-Cre (Rasmussen et al., 2011) mice to generate Mesp1.sup.Cre/+; Dicer.sup.L/+, Flk1.sup.Cre/+; Dicer.sup.L/+ and Etv2.sup.Cre/+; Dicer.sup.L/+ mice and subsequently crossed with Dicer.sup.L/L mice to generate conditional Dicer knockouts.
(88) Generation of Doxycycline-Inducible miR-130a Mouse ESC Line, Inducible Pdgfra ESC Lines, ES/EB Culture Conditions and FACS Analysis
(89) ESC culture conditions ES/EB differentiation and the generation of the Dox-inducible miR-130a ESCs were performed as previously reported (Iacovino et al., 2011).
(90) ESC Culture and ES/EB Differentiation
(91) The wild-type mouse E14 ES cell line was maintained in Knockout Medium (Invitrogen) supplemented with 15% FBS (Benchmark), 1000 U/ml LIF (Millipore), glutamine (Hyclone), 0.1 mM non-essential amino acids (NEAA) and 0.1 mM -mercaptoethanol (Sigma) in gelatin-coated tissue-culture plates. The ES cells were differentiated into embryoid bodies (EBs) by the hanging drop method using mesodermal differentiation media containing IMDM (Invitrogen), 15% FBS, penicillin/streptomycin, 2 mM GlutaMAX, 50 mg/ml Fe-saturated transferrin (R & D Systems), 0.1 mM monothioglycerol (Sigma), and 50 mg/ml ascorbic acid (Sigma). Cryosectioning and immunohistochemical analyses were performed using a standard protocol with anti-TnT (1:200, Sigma) and anti-CD31 (1:200, BD Pharmingen) sera.
(92) Flow Cytometry Analysis and Sorting
(93) FACS analysis was performed using a BD FACSAriaII (BD Biosciences, San Diego, Calif., USA). Stage specific embryos were separated from yolk sacs, and digested with 0.25% trypsin (Hyclone) to obtain a single cell suspension. Cells were incubated with antibody cocktails for 30 minutes at 4 C., washed, and resuspended in PBS with 2% FBS. Cocktails of antibodies including Flk1-APC (eBiosciences 17-5821), Pdgfra-PE (eBiosciences 12-1401). CD31-APC (eBiosciences 25-0311), CD41-PECy7 (eBiosciences 25-0411), CD45-PE (BD Pharmingen 553081), CD31-PE (BD Pharmigen). VE-cadherin (BD Pharmigen) were used in this study. For the FACS analysis of EYFP+ cells, embryos were digested and cells were sorted based on EYFP fluorescence. For EBs, single-cell suspensions were incubated with the desired antibody combinations, washed and resuspended in FACS buffer (PBS/1% FBS). Cells were analyzed or sorted using FACSAria (BD Biosciences). FACS data were quantified using data obtained from four independent experiments.
(94) RNA Isolation and Quantitative Gene Expression Analysis
(95) Total RNA was isolated from embryos and EBs at various time-periods using miRVANA RNA isolation kit (Ambion), and cDNA was synthesized using superscript cDNA synthesis kit (Invitrogen). Quantitative RT-PCR was performed using ABI Taqman probe sets. Probes used in these studies include the following: VIC-labeled GAPDH:4352339E, FAM-labeled U6 snRNA: 001973; hsa-miR-130a: 000454; Flk1:mm00440099_m1, PECAM: mm01246167_m1, Tie2: mm01256892_m1, Tnnt2:mm00441922_m1, c-kit: mm00445212_m1, Lmo2: mm00493153_m1, CD41:mm00439741_m1, and Dicer: Mm00521722_m1.
(96) Electrophoretic Mobility Shift Assay (EMSA)
(97) Experimental details for performing EMSA were previously described (Koyano-Nakagawa et al., 2012). The oligonucleotides harboring the Etv2 binding motif in the miR-130a promoter region were; sense strand: 5-GAATATAGGCAGGAAATTGACCAGAT-3 (SEQ ID NO:6); and antisense strand: 5-ATCTGGTCAATTTCCTGCCTATATTC-3(SEQ ID NO:7).
(98) Cell Transfection and Luciferase Assays
(99) COS7 cells were transfected using Lipofectamine 2000 (Invitrogen) according to the manufacturer's protocols. For the luciferase transactivation assay, 0.510.sup.5 cells were cultured in 24-well plates and transfected at 90% confluency with 0.25 g/well of reporter construct together with increasing amounts of Etv2 constructs. pRL-TK (50 ng) was used as a control for transfection efficiency. Cells were analyzed at 24 hr posttransfection. Activities of firefly and Renilla luciferases were measured sequentially using the Dual-Luciferase Reporter Assay system (Promega) and a luminometer (Berthold Detection Systems, Sirius). For the miR-130a target assay, COS7 cells were transfected using Lipofectamine 2000 (Invitrogen) with 150 nM/well of miR-130a mimics/antagomir and 0.2 g/well of Pdgfra constructs. pRL-TK (20 ng) was used as a control for transfection efficiency. Transfected cells were harvested after 48 hr using the Dual-Luciferase Reporter Assay system (Promega). Luciferase activities were expressed in relative light units that were normalized to the transfection efficiency using the Renilla luciferase activity.
(100) CFC Assay Using miR-130a IESCs
(101) For the CFC assays, miR-130a iESCs were differentiated in the mesoderm-inducing condition and treated from Days 2-6 with doxycycline. For the lineage committed CFC assay, Flk.sup.+/Pdgfra.sup. (hemato-endothelial mesoderm) and Flk.sup.+/Pdgfra.sup.+ (unpatterned mesoderm and prospective cardiac mesoderm) were sorted at day 3.5 of EB differentiation without Dox. Sorted cells were reaggregated for an additional two days in the presence or absence of Dox. 50,000 dissociated cells from whole EBs or FACS sorted EBs were plated on a 35 mm culture dish with 1.5 ml of MethoCult (M3434, Stem Cell Technologies) according to the manufacturer's instructions. Hematopoietic colonies were identified and quantified after 10 days of incubation. These assays were performed in triplicate and independently repeated three times.
(102) Reaggregation Assay
(103) Reaggregation of the sorted cells was performed as described (Kouskoff et al., 2005). Briefly, 410.sup.5 FACS-sorted cells were plated in a low attachment 24-well plate (Costar) containing EB differentiation media in the absence or the presence of Dox. Reaggregated EBs were FACS analyzed at day 6 as previously described (Rasmussen et al., 2011). These assays were repeated at least three times and statistical analysis was performed using Student's t-test.
(104) ChiP Assay
(105) The DNA-protein complex was immunoprecipitated with anti-HA serum (Santa Cruz, sc-805) from cell lysates using inducible HA-Etv2 EBs at day 3 of differentiation. qPCR was performed to detect the target region using the indicated primers; Fwd: 5-GCTTTGGGTGAGGCTAAAACG-3 (SEQ ID NO:8); Rev: 5-CAGAACCCCTGTTCCCAGATG-3 (SEQ ID NO:9).
(106) miR-130a Antagomir Transfection
(107) Transfection of miR-130a antagomirs were performed as previously described (Zhang et al., 2014) with minor modifications. Briefly, ES cell suspensions were treated with 150 nM of control or miR-130a antagomirs together with RNAimax reagent (Invitrogen) in low-attachment 6-well plates (Costar). EBs were incubated with these oligonucleotides in a shaking culture and FACS assay was performed on d6 of EB differentiation.
(108) Generation of Inducible Pdgfra ES Cell Lines
(109) Lentiviruses expressing full-length of Pdgfra (ImageClone 5704645. Open Biosystems) were generated and infected into A2lox as well as miR-130a iES clones. Viral infected cells were FACS sorted for EGFP.sup.+ fluorescence after addition of Dox. Sorted GFP.sup.+ cells were amplified and experiments were performed as described in the results section.
(110) Zebrafish Morpholino and In Situ Hybridization Experiments
(111) The following antisense MO oligonucleotides were designed by and obtained from the Gene Tools LLC. miR-130a-MO: 5-CAATGCCCTTTTAACATTGCACTGC-3(SEQ ID NO:10) miR-130a mis-MO: 5-CAATaCCaTTTTAAaATTaCACTaC-3(SEQ ID NO:11) (lower case represents mismatch bases).
(112) Wild-type and transgenic zebrafish lines, Tg(fli1a:GFP) (Motoike et al., 2003) were maintained according to the IACUC, UMN approved protocols. Zebrafish embryos at the one-two cell stage were injected with 25 ng mismatch control or miR-130a morpholinos following a standard procedure (Akiyama et al., 2014). The following antisense MO oligonucleotides were designed by and obtained from the Gene Tools LLC. miR-130a-MO: 5-CAATGCCCTTTTAACATTGCACTGC-3 (SEQ ID NO:12) miR-130a mis-MO: 5-CAATaCCaTTTTAAaATTaCACTaC-3 (SEQ ID NO:13) (lower case represents mismatch bases). Whole mount in situ hybridization for Pdgfra was done using standard procedures as described previously (Ng et al., 2002). For the zebrafish in situ hybridization experiments, 25-30 embryos were examined for each set.
(113) Morphological Analysis
(114) For morphological analysis, embryos from time-mated females were harvested at specified stages. Embryos were fixed in 4% PFA overnight at 4 C. and imaged using the Zeiss Axio Observer Z1 inverted microscope.
(115) Statistical Analysis
(116) All experiments were repeated at least three times and the data represent the meanSEM. Statistical significance was determined using the Student's t-test and a p-value<0.05 was considered as a significant change.
(117) Results
(118) Etv2-Cre-Mediated Dicer Deletion Results in Altered Mesodermal Lineages and Embryonic Lethality
(119) Analysis of mesodermal transcripts during embryonic stem cell/embryoid body (ES/EB) differentiation indicated that Mesp1 was transiently, but robustly expressed at day (d) 3, with subsequent expression of both Flk1 and Etv2 at d4, marking the appearance of the mesodermal lineages (
(120) TABLE-US-00001 Table 1 (related to FIG. 1). Dicer functions are needed in mesodermal progenitors. Table showing embryonic lethality at distinct developmental stages of conditional knockout embryos obtained from Mesp1-Cre, Flk1-Cre and Etv2-Cre mediated Dicer deletions. Mesp1- Flk1- Etv2- Cre/Dicer.sup.L/L Cre/Dicer.sup.L/L Cre/Dicer.sup.L/L Stages (obs/exp) Total (obs/exp) Total (obs/exp) Total E8.5 6/6 22 5/4 16 12/12 47 E9.5 6/7 30 3/3 12 16/17 70 E12.5 1/9 36 2/6 25 10/25 98 P1 0/12 48 0/17 68 0/16 64
These results indicated a need for miRNAs in the endothelial lineage. Previous studies analyzing Tie2.sup.Cre/+; Dicer.sup.L/L or VE-Cad.sup.Cre/+; Dicer.sup.L/L conditional mutants revealed viable animals with no obvious vascular defects (Saurez et al., 2007). Based on the findings and these reports, it is believed that miRNAs induced during Flk1 and Etv2 expression are needed for endothelial development.
(121) Etv2 marks the earliest hemato-endothelial progenitors (Koyano-Nakagawa et al., 2012). Previous studies have demonstrated that Etv2-mutants have altered mesodermal populations (Rasmussen et al., 2011). To evaluate whether mesodermal derivatives were affected in Etv2.sup.Cre/+; Dicer.sup.L/L mutants, Etv2.sup.Cre/+; Dicer.sup.L/+ and Etv2-EYFP; Dicer.sup.L/L lines were crossed and FACS analysis performed at E7.5. Etv2-EYFP reporter has been shown to label the hemato-endothelial lineages during embryogenesis (Rasmussen et al., 2011). The analysis showed a significant increase in the number of the Flk1/Pdgfra+ cells in the Dicer conditional mutants (
(122) To identify a specific miRNA that regulates the hemato-endothelial lineages, Flk1.sup.+ cells from d4 EBs were FACS sorted and a robust enrichment of miR-130a in Flk1.sup.+ cells was observed relative to Flk1.sup. cells (
(123) miR-130a Modulates the Endothelial Lineage During Embryogenesis
(124) qPCR analysis using ES/EBs revealed that mature miR-130a transcripts were induced by d4 (hemato-endothelial specification stage) and remained high at d8 (endothelial maturation stage) of EB differentiation (
(125) To examine whether miR-130a induction affects other mesodermal-derived lineages, immunohistochemical analyses was performed for cardiac and endothelial markers in differentiating miR-130a iES/EBs. Dox-induction of miR-130a from d2-d6 resulted in a significant reduction of cardiac Troponin (cTnT) expression in d10 EBs with a corresponding increase of CD31 expression (
(126) miR-130a Targets Pdgfra Expression and Modulates Mesodermal Lineage Development
(127) To explore the mechanism by which miR-130a modulates endothelial lineage development, three miRNA target prediction tools including TargetScan 6.2, PicTar and miRANDA were employed to mine comnunon predicted targets. Among the multiple targets, Pdgfra was identified as a highly conserved target of miR-130a with a high percentile score using TargetScan 6.2 in both mouse and zebrafish genomes (data not shown). Multiple sequence alignment revealed a highly conserved miR-130a seed-sequence in the Pdgfra-3-UTR region (
(128) Next, it was examined whether down regulation of Pdgfra regulation is the mechanism by which miR-130a regulates endothelial lineages. Antibody-mediated inhibition of Pdgfra signaling resulted in a significant induction of CD31 and Tie2 transcripts, but had no effect on CD45 transcript levels (
(129) miR-130a Modulates Flk1.sup.+/Pdgfra.sup.+ Mesodermal Progenitors Towards Lateral Plate Mesodermal Lineage
(130) Previous studies have shown that Flk1.sup./Pdgfra.sup.+ (paraxial mesoderm) and Flk1.sup.+/Pdgfra.sup. (lateral plate mesoderm) cells arise from the Flk1.sup.+/Pdgfra.sup.+ cell population by modulating Pdgfra levels at early stages of ES/EB differentiation (Kataoka et al., 2011: Sakurai et al., 2006). Therefore, a shorter pulse (48 h) was performed and it was examined whether miR-130a promoted the endothelial lineage from mesodermal progenitors by suppressing Pdgfra expression. A 48 h Dox pulse between d2-d4 using miR-130a iES/EBs resulted in a markedly reduced percentage (54%4% to 35%2%) of the Flk1.sup./Pdgfra.sup.+, but not Flk1.sup.+/Pdgfra.sup.+ populations (
(131) Aggregation-reaggregation assays were performed to test the ability of miR-130a to modulate mesodermal precursors. Uninduced FACS sorted Flk1.sup.+/Pdgfra.sup. and Flk1.sup.+/Pdgfra.sup.+ cells from miR-130a iES/EBs (d3.5) were reaggregated for an additional 48 h in the absence or presence of Dox and were analyzed for mesodermal-derivatives at d6 using cell surface markers (
Discussion
(132) Defined herein is the role of the Etv2-miR-130a-Pdgfra network in the divergence of hemato-endothelial progenitors. Mechanistically, miR-130a promotes endothelial lineage development by modulating Pdgfra signaling. This is the first report of a miRNA that specifically promotes the endothelial lineage without affecting the hematopoietic lineage.
(133) miRNAs are regulators of transcript expression, however, only a limited number of miRNAs have specific developmental roles. For example, the miR-430/427/302 family controls mesendodermal fate specification and miR-1/miR-133 (muscle-specific miRNAs) can promote mesodermal formation during embryogenesis (Ivey et al., 2008; Rosa et al., 2009). The data herein reports a novel functional role for miR-130a that specifically promotes differentiation of the endothelial lineage.
(134) Previous reports suggest that Etv2 plays a major role for the progression of Flk1.sup.+/Pdgfra.sup.+ progenitors (primitive mesoderm) to the Flk1.sup.+/Pdgfra.sup. (vascular mesoderm) state (Kataoka et al., 2011). Based on the data, it is believed that the Etv2-miR-130a cascade down-regulates Pdgfra expression and promotes the transition of Flk1.sup.+/Pdgfra.sup.+ to the Flk1.sup.+/Pdgfra.sup.. It is further believed that miR-130a facilitates the segregation of bipotent progenitors towards the endothelial lineage without affecting the hematopoietic lineage. However, the involvement of functionally redundant miRNAs cannot be ruled out.
(135) Since mutation of Etv2 affects both hematopoietic and endothelial lineages (Koyano-Nakagawa et al., 2012), it was unexpected to discover that miR-130a targets Pdgfra and promotes only the endothelial lineage. However, these results are supported by the finding that fetal liver hematopoiesis was not affected in the Pdgfra conditional knockout embryos (Ding et al., 2013). The data herein together with others (Ding et al., 2013) support the notion that the endothelial, but not the hematopoietic lineage is sensitive to the level of Pdgfra. It is believed that as Flk1.sup.+/Pdgfra.sup.+ common mesodermal progenitors progress to the Flk1.sup.+/Pdgfra.sup. hemato-endothelial progenitors, miR-130a further down-regulates Pdgfra expression to direct cells towards the endothelial lineage (
(136) In summary, a novel role for miR-130a has been discovered in the modulation of early endothelial progenitors. While several factors including HoxA3, Runx1 and miR-142-3p have been shown to have a role in hematopoietic lineage segregation and hemangioblast specification (Iacovino et al., 2011; Nimmo et al., 2013), endothelial specific regulators have not been described. miR-130a is the first reported regulator of endothelial development from the hemato-endothelial progenitors (
Example 2
(137) Mus musculus ets variant 2 (Etv2) sequence information
(138) NCBI Reference Sequence for mEtv2 gene: NM_007959.2
(139) LOCUS:NM_007959 1050 bp mRNA linear ROD 15 Feb. 2015
(140) DEFINITION:Mus musculus ets variant 2 (Etv2), mRNA.
(141) ACCESSION:NM_007959 XM_909688
(142) VERSION:NM_007959.2 GI:119964691
(143) SOURCE:Mus musculus (house mouse)
(144) Ensembi information for mEtv2 gene: Etv2 ENSMUSG0000006311
(145) Description; ets variant 2 [Source:MGT Symbol; Acc:MGT:99253]
(146) Location; Chromosome 7: 30,633,616-30,635,852 reverse strand.
(147) INSDC coordinates;
(148) chromosome:GRCm38:CM0001000.2:30633616:30635852:1
(149) Name: Etv2 (MGI Symbol)
(150) CCDS: This gene is a member of the Mouse CCDS set: CCDS39888.1
(151) UniProtKB: Uniprot identifiers: P41163
(152) RcfSeq: RcfSeq Gene ID 14008
(153) mRNA sequence of mEtv2
(154) gene=Etv2
(155) gene_synonym=Etsrp71
(156) standard_name=BE102623
(157) _xref=UniSTS:244290
(158) TABLE-US-00002 (SEQIDNO:14) 1 agaaccgtcagaacaagcatccatggacctgtggaactgggatgaggcgtcactgcagga 61 agtgcctcctggggacaagctgacaggactgggagcggaatttggtttctatttccctga 121 agtggctctacaagaggacacaccgatcacaccaatgaacgtagaaggctgctggaaagg 181 gttcccagagctggactggaaccccgctttacctcacgaagacgtacctttccaggcgga 241 gcccgttgctcacccccttccgtggtcgcgagactggacagacctgggatgcaacacctc 301 ggacccgtggagctgtgcttcacagacgccaggccctgcccctcctggcacgagcccctc 361 ccccttcgtcggctttgaaggggcgaccggccagaatcctgccacctcggcaggaggggt 421 cccctcgtggtcgcaccctccagctgcctggagcactaccagctgggactgttctgtggg 481 ccccagtggcgccacctactgggacaatggcctgggcggggaagcgcatgaggactataa 541 aatgtcatggggcgggtctgccggttcggactacaccaccacgtggaatactgggctgca 601 ggactgcagcatccctttcgaggggcaccagagtccagcattcaccacgccctccaaatc 661 gaacaagcagtctgatagagccacattgactcgctactccaaaactaaccaccgaggtcc 721 cattcagctgtggcaattcctcctggagctgctccacgacggggctcgcagcagctgcat 781 ccgctggacgggcaatagccgcgagttccagctgtgcgaccccaaagaggtggcccggct 841 gtggggcgagcgcaagaggaagccgggaatgaattatgagaaactgagtcgaggtctacg 901 ttattattaccgccgcgacatcgtgctcaagagtggtgggcgcaagtacacataccgctt 961 cgggggacgtgtgcctgtcctcgcctatcaggatgatatggggcatctgccaggtgcaga 1021 aggccaataaaacaaaaaacaaaaacaaaa
Protein Sequence of Mouse Etv2
(159) TABLE-US-00003 (SEQIDNO:15) MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC WKGFPELDWNPALPHEDVPFQAEPVAHPLPWSRDWTDLGCNTSDPWSCAS QTPGPAPPGTSPSPFVGFEGATGQNPATSAGGVPSWSHPPAAWSTTSWDC SVGPSGATYWDNGLGGEAHEDYKMSWGGSAGSDYTTTWNTGLQDCSIPFE GHQSPAFTTPSKSNKQSDRATLTRYSKTNHRGPIQLWQFLLELLHDGARS SCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDI VLKSGGRKYTYRFGGRVPVLAYQDDMGHLPGAEGQ
Human ets variant 2 (Etv2) sequence information
NCBI information from Gene ID 2116
Official symbol: ETV2
Official Full Name: ets variant 2
Primary source: HGNC:HGNC:3491
See related; Ensembl:ENSi00000105672; HPRD: 16871; MIM:609358;
Vega:OTTHUMG00000150545
Organism; Homo sapiens
Also known as; ER71; ETSRP71
Ensembl information for human Etv2 Gene: ETV2 ENSCG00000105672
Description: ets variant 2 [Source:HGNC Symbol; Acc:HGNC:3491]
Synonym: ER71
Location: Chromosome 19: 35,641,745-35,644,871 forward strand.
INSDC coordinates: chromosome:GRCh38:CM000681.2:35641745:35644871:1
About this gene: This gene has 8 transcripts (splice variants), 30 orthologues, 12 paralogues, is a member of 2 Ensembl protein families and is associated with 23 phenotypes.
mRNA sequence of human ets variant 2 (ETV2), transcript variant 1
LOCUS: NM_014209 1510 bp
DEFINITION: Homo sapiens ets variant 2 (ETV2), transcript variant 1, mRNA.
ACCESSION: NM_014209 XM_290831
VERSION: NM_014209.3 GI:665821253
(160) TABLE-US-00004 (SEQIDNO:16) 1 ttcctgttgcagataagcccagcttagcccagctgaccccagaccctctcccctcactcc 61 ccccatgtcgcaggatcgagaccctgaggcagacagcccgttcaccaagccccccgcccc 121 gcccccatcaccccgtaaacttctcccagcctccgccctgccctcacccagcccgctgtt 181 ccccaagcctcgctccaagcccacgccacccctgcagcagggcagccccagaggccagca 241 cctatccccgaggctggggtcgaggctcggccccgcccctgcctctgcaacttgagcctg 301 gctgcgacccctgctctgacgtctcggaaaattcccccttgcccaggcccttgggggagg 361 gggtgcatggtatgaaatggggctgagacccccggctgggggcagaggaacccgccagag 421 aacattcagaaggccttcatcgcatccatggacctgtggaactgggatgaggcatcccca 481 caggaagtgcctccagggaacaagctggcagggcttgaaggagccaaattaggcttctgt 541 ttccctgatctggcactccaaggggacacgccgacagcgacagcagagacatgctggaaa 601 ggtacaagctcatccctggcaagcttcccacagctggactggggctccgcgttactgcac 661 ccagaagttccatggggggcggagcccgactctcaggctcttccgtggtccggggactgg 721 acagacatggcgtgcacagcctgggactcttggagcggcgcctcgcagaccctgggcccc 781 gcccctctcggcccgggccccatccccgccgccggctccgaaggcgccgcgggccagaac 841 tgcgtccccgtggcgggagaggccacctcgtggtcgcgcgcccaggccgccgggagcaac 901 accagctgggactgttctgtggggcccgacggcgatacctactggggcagtggcctgggc 961 ggggagccgcgcacggactgtaccatttcgtggggcgggcccgcgggcccggactgtacc 1021 acctcctggaacccggggctgcatgcgggtggcaccacctctttgaagcggtaccagagc 1081 tcagctctcaccgtttgctccgaaccgagcccgcagtcggaccgtgccagtttggctcga 1141 tgccccaaaactaaccaccgaggtcccattcagctgtggcagttcctcctggagctgctc 1201 cacgacggggcgcgtagcagctgcatccgttggactggcaacagccgcgagttccagctg 1261 tgcgaccccaaagaggtggctcggctgtggggcgagcgcaagagaaagccgggcatgaat 1321 tacgagaagctgagccggggccttcgctactactatcgccgcgacatcgtgcgcaagagc 1381 ggggggcgaaagtacacgtaccgcttcgggggccgcgtgcccagcctagcctatccggac 1441 tgtgcgggaggcggacggggagcagagacacaataaaaattcccggtcaaacctcaaaaa 1501 aaaaaaaaaa
Protein sequence of human ets variant 2 (ETV2), transcript variant 1
product=ETS translocation variant 2 isoform 1
protein_id=NP_055024.2
db_xref=GT:153791178
db_xref=CCDS:CCDS32995.2
db_xref=GeneID:2116
db_xref=HGNC:HGNC:3491
db_xref=MIM:609358
(161) TABLE-US-00005 (SEQIDNO:17) MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCW KGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWD SWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGS NTSWDCSVGPGDGTYWGSGLGGEPRTDCTISWGGPAGPDCITTSWNPGLH AGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLE LLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGL RYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ
Bibliography
(162) Bernstein. E., et al. (2003). Nat. Genet. 35, 215-217. Chen, Y., and Gorski, D. H. (2008). Blood 111, 1217-1226. De Val, S., et al. (2008). Cell 135, 1053-1064. Ding, G., et al. (2013). Dev. Dyn. 242, 254-268. Ferdous, A., et al. (2009). Proc. Natl. Acad. Sci. USA 106, 814-819. Harfe, B. D., et al. (2005). Proc. Natl. Acad. Sci. USA 102, 10898-10903. Huber, T, L., et al. (2004) Nature 432, 625-630. Iacovino, M., et al. (2011). Nat. Cell Biol. 13, 72-78. Ivey, K. N., and Srivastava, D. (2010). Cell Stem Cell 7, 36-41. Ivey, K. N., et al. (2008). Cell Stem Cell 2, 219-229. Kataoka, H., et al. (2011) Blood 118, 6975-6986. Kattman, S. J., et al. (2006). Dev. Cell 11, 723-732. Koyano-Nakagawa, N., et al. (2012). Stem Cells 30, 1611-1623. Kunath, T., et al. (2007) Development 134, 2895-2902. Loebel, D. A., et al. (2003) Dev. Biol. 264, 1-14. Naito, A. T., et al. (2006) Proc. Natl. Acad. Sci. USA 103, 19812-19817. Nimmo, R., et al. (2013) Dev. Cell 26, 237-249. Rasmussen. T. L., et al. (2011) Development 138, 4801-4812. Rosa, A, et al. (2009) Dev. Cell 16, 517-527. Shalaby, F., et al. (1995) Nature 376, 62-66. Saga, Y., et al. (1999) Development 126, 3437-3447. Sakurai, H., et al. (2006). Stem Cells 24, 575-586. Ueno, H. and Weissman, I. L. (2006) Dev. Cell 11, 519-533. Yang, W. J., et al. (2005). J. Biol. Chem. 280, 9330-9335. Akiyama, R., et al. (2014). Development 141, 1104-1109. Drukker, M., et al. (2012). Nat. Biotech. 30, 531-542. Kouskoff, V., et al. (2005). Proc. Nat. Acad. Sci. USA 102, 13170-13175. Motoike, T., et al. (2003). Genesis 35, 153-159. Ng, J. K., et al. (2002). Development 129, 5161-5170. Zhang, K., et al. (2014) J. Am. Coll. Cardiol. 63, 358-368.
(163) All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. In the event that the definition of a term incorporated by reference conflicts with a term defined herein, this specification shall control.