PEPTIDES FOR TREATMENT AND PREVENTION OF NONALCOHOLIC FATTY LIVER DISEASE
20200368314 ยท 2020-11-26
Inventors
Cpc classification
C12N9/1205
CHEMISTRY; METALLURGY
A61K38/16
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
International classification
A61K38/16
HUMAN NECESSITIES
A61P1/16
HUMAN NECESSITIES
Abstract
The present invention relates to peptides for the treatment or prevention of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma.
Claims
1-15. (canceled)
16. A method of treating a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma comprising the administration of a peptide to a subject having a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma, wherein: the peptide modifies the expression levels of the FATPs expression in adipose tissue; the peptide sequence is a segment of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 25 consecutive residues of a protein kinase C (PKC); the peptide contains at least one methionine, one proline and one arginine; the peptide has a length of: a) at least 8 amino acids and less than 40 amino acids; b) a length of at least 10 amino acids and less than 30 amino acids; or c) a length of at least 12 amino acids and less than 25 amino acids; and the peptide may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof within said sequence of a segment of a PKC.
17. The method according to claim 16, wherein the peptide adopts an alpha helical conformation.
18. The method according to claim 16, wherein the peptide is modified by a chemical cross-linking process.
19. The method according to claim 16, wherein the peptide is a sequence according to one of the following formulae:
M-(X).sub.m-P-(X).sub.n-R;
M-(X).sub.m-R-(X).sub.n-P;
P-(X).sub.m-M-(X).sub.n-R;
P-(X).sub.m-R-(X).sub.n-M;
R-(X).sub.m-P-(X).sub.n-M; or
R-(X).sub.m-M-(X).sub.n-P, wherein m and n are integers from 1 to 20, m+n is less than 30 and X is any amino acid.
20. The method according to claim 19, wherein the peptide is a sequence according to one of the following formulae:
M-(X).sub.m-R-(X).sub.n-P;
P-(X).sub.m-R-(X).sub.n-M;
R-(X).sub.m-M-(X).sub.n-P; or
M-(X).sub.m-P-(X).sub.n-R, wherein m and n are integers from 1 to 20, m+n is less than 30 and X is any amino acid.
21. The method according to claim 19, wherein m+n is less than 20 and m and n are an integer from 2 to 15.
22. The method according to claim 16, wherein said PKC is selected from the group consisting of an alpha-PKC (PKC), a beta-PKC (PKC), I PKC, II PKC, delta-PKC, theta-PKC, eta-PKC and epsilon-PKC.
23. The method according to claim 22, wherein said PKC is an PKC comprising SEQ ID No 1.
24. The method according to claim 16, wherein the peptide is selected from the group consisting of: TABLE-US-00017 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo4) RLYFVMEYVNGGDLMYHIQQVGKFKEP; (SEQIDNo5) MYHIQQVGKFKEPQAVFYAAEISIGLFFLHKR; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM; (SEQIDNo7) MDGVTTRTFCGTP; and (SEQIDNo8) MTKHPAKR; and optionally it comprises 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
25. The method according to claim 24, wherein the peptide is selected from the group consisting of: TABLE-US-00018 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo7) MDGVTTRTFCGTP; and (SEQIDNo8) MTKHPAKR; and optionally it comprises 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
26. The method according to claim 16, wherein the peptide is selected from the group consisting of: TABLE-US-00019 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; (SEQIDNo10) MCKEHMMDGVTTRTFCGTPD; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG; and optionally it comprises 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
27. The method according to claim 16, wherein the peptide is selected from the group consisting of: TABLE-US-00020 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; (SEQIDNo10) MCKEHMMDGVTTRTFCGTPD; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG; wherein the residues which are bold and underlined carry the stapling.
28. The method according to claim 16, wherein the disease is selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), and hepatic steatosis (fatty liver).
29. The method according to claim 28, wherein the disease is hepatic steatosis (fatty liver) or non-alcoholic steatohepatitis (NASH).
30. The method according to claim 29, wherein the disease is non-alcoholic steatohepatitis (NASH).
31. The method according to claim 16, said peptide decreasing FATP2 expression in adipose tissue.
32. The method according to claim 21, wherein m and n are an integer from 2 to 7.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023]
[0024]
[0025]
[0026]
[0027] n=4 animals per group, GAPDH was used as reference gene. There are 6 isoforms of FATP (FATP1-6 also known as SLC27A1-SLC27A6).
[0028]
[0029] Scramble less refers to the combination of the two peptides with the same amino acid residues as in the stapled forms but randomly rearranged with a maintained alpha helix structure: Scrambled peptide sequence A and Scrambled peptide sequence B. Staple refers to a combination of two stapled peptides: Stapled peptide sequence A and Stapled peptide sequence B.
[0030]
[0034]
[0037]
[0038] Mean values of both AST and ALT measured by ELISA approach in plasma of mice with the indicated treatment. n=4 samples per group.
[0039] PATAD stapled peptide sequence A is effective in reducing circulating levels of AST and ALT.
[0040]
[0041] Lipids are transported bound to albumin and therefore plasma content of free albumin was measured as a readout of the effect of PATAD stapled peptide sequence A on circulating lipid profile 3 months after PATAD injection. N=5 mice per group.
[0042]
[0043] DIO male mice were treated with either PATAD alone (1 injection) or with metformin (a daily dose of 300 mk/kg through oral gavage) or a combination of both and oral glucose tolerance test was performed at the given indicated time points (
DETAILED DESCRIPTION OF THE INVENTION
[0044] Surprisingly, the inventors provide a peptide or a combination of peptides which specifically decreases the expression of FATP2 (Fatty acid transport protein 2) in adipose tissue (
[0045] Accordingly, the invention relates to [0046] a peptide for use in the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma; [0047] the use of a peptide for the manufacture of a medicine for the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma; [0048] a method for the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma in a subject, comprising administering a therapeutically effective amount of a peptide.
Definitions
[0049] ALMS1, Alstrm syndrome protein 1, is a protein encoded by the ALMS1 gene. Mutations in the ALMS1 gene have been found to be causative for Alstrm syndrome. It is described in several databases, namely UniProt ID No Q8TCU4; Gene ID No 7840, HGNG ID No 428. Reference sequences are disclosed in Genbank under NM_015120.4 for mRNA and NP_055935.4 for protein.
[0050] The terms Protein kinase C and PKC (EC 2.7.11.13) are equivalent and refers to a family of protein kinase enzymes that are involved in controlling the function of other proteins through the phosphorylation of hydroxyl groups of serine and threonine amino acid residues on these proteins. PKC are typically activated by signals such as increases in the concentration of diacylglycerol (DAG) or calcium ions (Ca2+). PKC play important roles in several signal transduction cascades.
[0051] The PKC family comprises at least fifteen isozymes in humans, divided into three main subfamilies, conventional (or classical) PKCs, novel PKCs, and atypical PKCs.
[0052] Conventional (c)PKCs comprises the isoforms , I, II, and . These PKCs require Ca.sup.2+, DAG, and a phospholipid such as phosphatidylserine for activation.
[0053] Novel (n)PKCs include the , , , and isoforms. These PKCs require DAG, but do not require Ca2.sup.+ for activation.
[0054] Atypical (a)PKCs include the , .Math., and isoforms. These PKCs require neither Ca2+ nor diacylglycerol for activation.
[0055] Protein kinase C alpha type, also called PKC, PKC-A or PKC-alpha, belongs to a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. It is described in several databases, namely UniProt ID No P17252, Gene ID No 9393, HGNG ID No 5578. Reference sequences are disclosed in Genbank under NM_02737.2 for mRNA and NP_002728.1 for protein. The protein sequence of human PKC is disclosed in SEQ ID No 1.
[0056] consists of, consists essentially of or substantially comprises: The description herein of any aspect or embodiment of the invention using terms such as reference to an element or elements is intended to provide support for a similar aspect or embodiment of the invention that consists of, consists essentially of or substantially comprises that particular element or elements, unless otherwise stated or clearly contradicted by context. For instance, a peptide or protein described herein as comprising a particular sequence should be understood as also describing a peptide or protein consisting of that sequence, unless otherwise stated or clearly contradicted by context. By consists essentially of is intended that the peptide or protein consists of that sequence, but it may also include 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 substitutions, additions, deletions or a mixture thereof, preferably 1, 2, 3, 4, or 5 substitutions, additions, deletions or a mixture thereof. In particular, by essentially consist in, it may be intended that the peptide may include 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 additional amino acids at the N and/or C-terminal end, preferably 1, 2, 3, 4, or 5 additional amino acids, and/or 1, 2 or 3 substitutions, deletions, additions, or a mixture thereof.
[0057] As used herein, the term substitution refers to the exchange of a single amino-acid by another in a peptide sequence.
[0058] As used herein, the term deletion refers to the removal of a single amino-acid in a peptide sequence.
[0059] As used herein, the term insertion or addition are equivalent and refer to the addition of a single amino-acid in a peptide sequence.
[0060] By substitutions, additions, deletions is intended a substitution, addition, deletion of one amino acid. Then, when it is referred to 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 substitutions, additions, deletions or a mixture thereof, 1, 2, 3, 4, or 5 substitutions, additions, deletions or a mixture thereof or 1, 2 or 3 substitutions, deletions, additions, or a mixture thereof, it means respectively 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 modification(s) of an amino acid selected from substitutions, additions, deletions and a mixture thereof, 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitutions, additions, deletions or a mixture thereof or 1, 2 or 3 modification(s) of an amino acid selected from substitutions, deletions, additions, or a mixture thereof.
[0061] In the peptide sequences disclosed herein, the amino acids are represented by their one letter code according to the following nomenclature: A: alanine; C: cysteine; D: aspartic acid; E: glutamic acid; F: phenylalanine; G: glycine; H: histidine; I: isoleucine; K: lysine; L: leucine; M: methionine; N: asparagine; P: proline; Q: glutamine; R: arginine; S: serine; T: threonine; V: valine; W: tryptophane and Y: tyrosine.
[0062] As used herein, the terms sequence identity or identity refers to an exact amino acid to amino acid correspondence of two peptides. Percent of identity can be determined by a direct comparison of the sequence information between two molecules by aligning the sequences, counting the exact number of matches between the two aligned sequences, dividing by the length of the shorter sequence, and multiplying the result by 100.
[0063] The sequence identity can be determined by alignment of two peptide sequences using global or local alignment algorithms, depending on the length of the two sequences. Sequences of similar lengths are preferably aligned using a global alignment algorithms (e.g. Needleman Wunsch) which aligns the sequences optimally over the entire length, while sequences of substantially different lengths are preferably aligned using a local alignment algorithm (e.g. Smith Waterman). Sequences may then be referred to as substantially identical or essentially similar when they (when optimally aligned by for example the programs GAP or BESTFIT using default parameters) share at least a certain minimal percentage of sequence identity. GAP uses the Needleman and Wunsch global alignment algorithm to align two sequences over their entire length (full length), maximizing the number of matches and minimizing the number of gaps. A global alignment is suitably used to determine sequence identity when the two sequences have similar lengths.
[0064] By increased, increase or enhance is intended to refer to a measurement increased by at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% when compared to the measurement measured in absence of the tested molecule in the same conditions. By decreased or decrease is intended to refer to a measurement decreased by at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% when compared to the measurement measured in absence of the tested molecule in the same conditions.
[0065] As used herein, the term treatment, treat or treating refers to any act intended to ameliorate the health status of patients, such as cure, alleviate or delay of the disease. It includes preventive as well as therapeutic treatment. For instance, it may refer to a delay or a blockade of the evolution from NAFLD to NASH, from NASH to NASH with fibrosis, from NASH to cirrhosis, from NASH or cirrhosis to hepatocellular carcinoma. The term treatment designates in particular the correction, retardation, or reduction of the hepatic steatosis. The term treatment also designates an improvement in the liver steatosis, in liver inflammation, in liver fibrosis, in liver enzymes (aminotransferases such as AST and ALT), and/or in fatty liver index (Bedgni et al, BMC Gastroenterol. 2006 Nov. 2; 6:33). In particular, the treatment lowers or decreases or delays the in the liver steatosis, in liver inflammation, in liver fibrosis, in liver enzymes (aminotransferases such as AST and ALT), and/or in fatty liver index.
[0066] As used herein, the term effective amount refers to a quantity of a peptide of the present disclosure or of a pharmaceutical composition of the present disclosure which treats or delays the progression or onset of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma.
[0067] As used herein, the terms active principle, active ingredient and active pharmaceutical ingredient are equivalent and refers to a component of a pharmaceutical composition having a therapeutic effect.
[0068] As used herein, the term therapeutic effect refers to an effect induced by an active ingredient, such as a peptide of the present disclosure, or by a pharmaceutical composition according to the present disclosure, capable to treat or to delay the progression or onset of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma.
[0069] As used herein, the term excipient or pharmaceutically acceptable carrier refers to any ingredient except active ingredients that is present in a pharmaceutical composition. Its addition may be aimed to confer a particular consistency or other physical or gustative properties to the final product. An excipient or pharmaceutically acceptable carrier must be devoid of any interaction, in particular chemical, with the actives ingredients.
[0070] As used herein, the terms subject, individual or patient are interchangeable and refer to an animal, preferably to a mammal, even more preferably to a human, including adult, child, newborn and human at the prenatal stage.
[0071] In the present document, the term about refers to a range of values of 10% of the specified value. For example, about 50 comprise values of 10% of 50, i.e. values in the range between 45 and 55. Preferably, the term about refers to a range of values of 5% of the specified value.
[0072] As used herein, nonalcoholic fatty liver disease and NAFLD refer to a disease defined by the presence of macrovascular steatosis in the presence of less than 20 gm of alcohol ingestion per day. NAFLD is the most common liver disease in the United States, and is commonly associated with insulin resistance/type 2 diabetes mellitus and obesity. NAFLD is manifested by steatosis, steatohepatitis, cirrhosis, and sometimes hepatocellular carcinoma. For a review of NAFLD, see Tolman and Dalpiaz (2007) Ther. Clin. Risk. Manag., 3(6): 1153-1163 the entire contents of which are incorporated herein by reference.
[0073] As used herein, the terms steatosis, hepatic steatosis, and fatty liver refer to the accumulation of triglycerides and other fats in the liver cells.
[0074] As used herein, the term Nonalcoholic steatohepatitis or NASH refers to liver inflammation and damage caused by a buildup of fat in the liver. NASH is part of a group of conditions called nonalcoholic fatty liver disease (NAFLD). NASH resembles alcoholic liver disease, but occurs in people who drink little or no alcohol. The major feature in NASH is fat in the liver, along with inflammation and damage. Most people with NASH feel well and are not aware that they have a liver problem. Nevertheless, NASH can be severe and can lead to cirrhosis, in which the liver is permanently damaged and scarred and no longer able to work properly. NASH is usually first suspected in a person who is found to have elevations in liver tests that are included in routine blood test panels, such as alanine aminotransferase (ALT) or aspartate aminotransferase (AST). When further evaluation shows no apparent reason for liver disease (such as medications, viral hepatitis, or excessive use of alcohol) and when x rays or imaging studies of the liver show fat, NASH is suspected. The only means of proving a diagnosis of NASH and separating it from simple fatty liver is a liver biopsy.
[0075] As used herein, the term cirrhosis, defined histologically, is a diffuse hepatic process characterized by fibrosis and conversion of the normal liver architecture into structurally abnormal nodules.
[0076] NAFLD may be differentiated from NASH by the NAFLD Activity Score (NAS), the sum of the histopathology scores of a liver biopsy for steatosis (0 to 3), lobular inflammation (0 to 2), and hepatocellular ballooning (0 to 2). A NAS of <3 corresponds to NAFLD, 3-4 corresponds to borderline NASH, and >5 corresponds to NASH. The biopsy is also scored for fibrosis (0 to 4).
Peptides
[0077] The peptide(s) according to the present disclosure is capable of decreasing the expression of FATP2 in adipose tissue.
[0078] The peptide(s) according to the present disclosure is capable of decreasing the phenomenon of steatosis in the liver.
[0079] The peptide according to the present disclosure comprises at least one methionine, one proline and one arginine.
[0080] In one aspect, the peptide of the present disclosure has an alpha helix structure. As used herein, the terms alpha helix -helix, classic Pauling-Corey-Branson -helix and 3.613-helix are equivalent and refer to each other. The term alpha helix refers to a common motif in the secondary structure of proteins which is a right hand-coiled or spiral conformation (helix) in which every backbone NH group donates a hydrogen bond to the backbone CO group of the amino acid located three or four residues earlier along the protein sequence. An alpha helix has an average number of residues per helical turn of about 3.6 residues and 13 atoms are involved in the ring formed by the hydrogen bond.
[0081] In a particular embodiment, the peptide of the present disclosure has an alpha helix structure and/or has a sequence which is predictive of an alpha helix structure. Methods to determine the structure of a peptide are well known from the man skilled in the art, such as Circular Dichroism or NMR. Likewise, methods to predict an alpha helix structure of a peptide are well known from the man skilled in the art such as STRIDE (Frishman D., Argos P., Proteins, vol. 23, no 4, 1995, p. 566-579); DEFINE (Richards F. M., Kundrot C. E., Proteins, vol. 3, no 2, 1988, p. 71-84); DSSP (Touw et al. Nucleic Acids Research 2015; 43: D364-D368; Kabsch & Sander. Biopolymers. 1983, 22, 2577-2637).
[0082] In another particular embodiment, the peptide according to the present disclosure is designed or modified in order to maintain it in an alpha helical conformation. As known in the art, this can be achieved via a variety of methods, including modification of the amino acid sequence with substitution of amino acids not critical for biological effects, use of non-natural amino acids, peptide cyclization, and modifications to the peptide backbone or addition of chemical links between amino acids in the peptide chain. Such modifications can be made to peptides, for example, to increase their thermal and protease stability.
[0083] In particular, the peptide of the present disclosure is modified by a chemical cross-link. For instance, the peptide can be a stapled peptide. In one embodiment, the peptide of the present disclosure is stapled. The term stapled peptide or stitched peptide, as used herein, refers to an artificially modified peptide in which the peptide secondary structure is stabilized with one or more artificial molecular crosslinks (bridges) that connect adjacent turns of -helices in the peptide. The methods for preparing stapled peptides are well known in the art, for instance in Verdine & Hilinski (2012, Methods Enzymol, 503, 3-33), WO10033617 and WO10011313, the disclosure of which is incorporated herein by reference.
[0084] In one embodiment, the crosslinks of the stapled peptide of the present disclosure are i+3, and/or i+4, and/or i+7 crosslinks. In a peptide, a i+3 crosslink is a crosslink between an amino acid, the i amino acid, and another amino acid present at a distance of 3 amino acid residues from the i amino acid. In a peptide, a i+4 crosslink is a crosslink between an amino acid, the i amino acid, and another amino acid present at a distance of 4 amino acid residues from the i amino acid. In a peptide, a i+7 crosslink is a crosslink between an amino acid, the i amino acid, and another amino acid present at a distance of 7 amino acid residues from the i amino acid.
[0085] In a particular embodiment, the peptide according to the present disclosure is a cyclic peptide. As used herein, the term cyclic peptide or circular peptide are equivalent and refers to a peptide in which the N-terminus and the C-terminus, or the N-terminus and the side chain of another amino acid, preferably the C-terminal amino acid, or the C-terminus and the side chain of another amino acid, preferably the N-terminal amino acid, or the side chain of an amino acid and the side chain of another amino acid, preferably the N-terminal amino acid and the C-terminal amino acid, are linked with a covalent bond that generates a ring structure. As used herein, the term N-terminus, amino-terminus, NH2-terminus, N-terminal end and amine-terminus are equivalent and refer to the free amine group (NH2) present on the first amino acid of the peptide. As used herein, the term C-terminus, carboxyl-terminus, carboxy-terminus, C-terminal end, and COOH-terminus are equivalent and refer to the free carboxyl group (COOH) present on the last amino acid of the peptide.
[0086] The peptide may comprise a sequence according to one of the following formulae: M-(X)m-P-(X)n-R or M-(X)m-R-(X)n-P or P-(X)m-M-(X)n-R or P-(X)m-R-(X)n-M or R-(X)m-P-(X)n-M or R-(X)m-M-(X)n-P, preferably M-(X)m-R-(X)n-P or P-(X)m-R-(X)n-M or R-(X)m-M-(X)n-P or M-(X)m-P-(X)n-R, with X is any amino acid, m and n are integers from 1 to 30, and m+n is less than 50.
[0087] In these sequences, m and n are integers comprised between 1 and 30, preferably between 1 and 20, more preferably between 2 and 15, still preferably between 2 and 10, even more preferably between 2 and 7. Alternatively, m and n can be integers comprised between 3 and 5.
[0088] In these sequences, m+n is less than 50, preferably less than 30, more preferably less than 20. Alternatively, m+n can be less than 15.
[0089] In one embodiment, m and n are integers from 1 to 20 and m+n is less than 30.
[0090] In these sequences, X can be any amino acid, including M, R or P. Alternatively, X can be any amino acid except M, R and P.
[0091] In particular, X can be an amino acid favorable to an -helix secondary structure. For instance, such an amino acid can be selected from the group consisting of A, R, D, N, C, G, Q, E, H, L, K, M, F, S, W and Y, preferably from the group consisting of A, D, N, C, G, Q, E, H, L, K, F, S, W and Y.
[0092] The peptide according to the present disclosure has a length of less than 120 amino acids. In one embodiment, the peptide according to the present disclosure has a length of less than 80 amino acids, more preferably less than 60 amino acids, still preferably less than 40 amino acids, and even more preferably less than 30 amino acids. In a particular embodiment, the peptide according to the present disclosure has a length of less than 25 amino acids. In another particular embodiment, the peptide according to the present disclosure has a length of less than 20 amino acids, preferably of less than 15 amino acids. Preferably, the peptide has a minimum length greater than 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids. For instance, the peptide has a length of at least 8 amino acids and less than 40 amino acids, preferably a length of at least 10 amino acids and less than 30 amino acids; more preferably of at least 12 amino acids and less than 25 amino acids.
[0093] In one embodiment, the peptide according to the present disclosure is capable of decreasing the expression of FATP2 in adipose tissue.
[0094] FATP2 is also called Solute Carrier Family 27 Member 2 (SLC27A2). This protein is disclosed in the database UniProtKB under 014975. The gene is described in UniGene database under Hs.11729. Sequences of reference can be found in NCBI under NP_003636.2 and NM_003645.3 for the isoform 1 and under NP_001153101.1 and NM_001159629.1. for the isoform 2.
[0095] By decreased or decrease is intended to refer to an expression decreased by at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% when compared to the expression measured in absence of the peptide in the same conditions. The expression can be measured either at the protein level (e.g., with antibodies) or at the mRNA level.
[0096] The expression can be measured at the protein level by any available method such as immuno-histochemistry, semi-quantitative Western-blot or by protein or antibody arrays. Antibodies directed to FATP2 are commercially available, for instance from Origene, ref TA350424 or TA333990; or Santa Cruz Biotechnology, ref sc-393906.
[0097] The expression can also be measured at the mRNA level by any available method. Preferably, the expression level of FATP2 is determined by measuring the quantity of the mRNA transcripts by quantitative RT-PCR, real time quantitative RT-PCR, Nanostring technology PCR or by high-throughput sequencing technology such as RNA-Seq or sequencing technologies using microfluidic systems. More specifically, the expression is measured by the method specified in the Example section.
[0098] The effect on the FATP2 expression caused by the peptide in the adipose tissue is preferably specific to FATP2. In particular, the peptide has no or less effect on the expression of the other FATPs, i.e. FATP1, FATP3, FATP4, FATP5 and FATP6, in the adipose tissue.
[0099] In one embodiment, the peptide according to the present disclosure is capable of decreases the liver steatosis, the amount of fat in liver, the size of fat droplets in liver, and/or the fatty liver index.
[0100] In a particular embodiment, the peptide according to the present disclosure presents two, three, four or all following features: [0101] it modifies the expression levels of the FATPs expression in adipose tissue, preferentially it decreases the FATP2 expression in adipose tissue; [0102] it decreases the liver steatosis, the amount of fat in liver, the size of fat droplets in liver, and/or the fatty liver index; [0103] it comprises at least one methionine, one proline and one arginine; [0104] it has a length of at least 8 amino acids and less than 40 amino acids, preferably a length of at least 10 amino acids and less than 30 amino acids, more preferably of at least 12 amino acids and less than 25 amino acids; [0105] it adopts a secondary structure which is a helix, preferably an alpha helix; [0106] it is modified by a cross-link.
[0107] In a more specific embodiment, the peptide according to the present disclosure presents the following features: [0108] it decreases the liver steatosis, the amount of fat in liver, the size of fat droplets in liver, and/or the fatty liver index; [0109] it comprises at least one methionine, one proline and one arginine; [0110] it has a length of at least 8 amino acids and less than 40 amino acids, preferably a length of at least 10 amino acids and less than 30 amino acids, more preferably of at least 12 amino acids and less than 25 amino acids; [0111] it adopts a secondary structure which is a helix, preferably an alpha helix.
[0112] In another more specific embodiment, the peptide according to the present disclosure presents the following features: [0113] it decreases the FATP2 expression in adipose tissue; [0114] it comprises at least one methionine, one proline and one arginine; [0115] it has a length of at least 8 amino acids and less than 40 amino acids, preferably a length of at least 10 amino acids and less than 30 amino acids, more preferably of at least 12 amino acids and less than 25 amino acids; [0116] it adopts a secondary structure which is a helix, preferably an alpha helix.
[0117] In another particular embodiment, the peptide sequence according to the present disclosure comprises, consists essentially in or consists in the sequence of a segment of a PKC (Protein Kinase C), preferably a segment of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 25 consecutive residues of the kinase domain of a PKC (Protein Kinase C). In one embodiment, the PKC is selected from conventional PKC, novel PKC and atypical PKC. In a particular embodiment, the PKC is selected from conventional PKC. Still preferably, the PKC is selected from the group consisting of a, 1, 11, and PKCs. Yet preferably, the PKC is selected from the group consisting of , 1, and 11 PKCs. In a more specific embodiment, the PKC is an PKC, preferably a human PKC, more preferably a human PKC of SEQ ID No 1.
[0118] In one embodiment, said sequence of a segment of a PKC belongs to the sequence between positions 336 and 672 of SEQ ID No 1. For instance, the sequence of a segment of a PKC may belong to the sequences between positions 336 and 432 of SEQ ID No 1, between positions 434 and 544 of SEQ ID No 1, or between positions 568 and 596 of SEQ ID No 1.
[0119] In one embodiment, the sequence of a segment of a PKC does not include the following residues: F114, D116, C118, L121, N138, Q142, 1145, P148, G433, E545, S562, S566, F597, D601, W602, K604, E606, G620, T631, V664, and 1667 of SEQ ID No 1, preferably G433, E545, S562, S567, F597, D601, W602, K604, E606, G620, T631, V664, and 1667 of SEQ ID No 1.
[0120] Preferably, said sequence of a segment of a PKC corresponds to at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% of the sequence of the peptide. In a particular embodiment, the peptide sequence according to the present disclosure consist in the sequence of a segment of SEQ ID No 1.
[0121] Preferably, said at least one methionine and/or one proline and/or one arginine are included in the sequence of a segment of a PKC. More preferably, said at least one methionine and one proline and one arginine are comprised in the sequence of a segment of a PKC.
[0122] The peptide according to the present disclosure may comprise substitutions, deletions and/or additions.
[0123] Preferably, the peptide comprises no more than 20, preferably no more than 15, more preferably no more than 10, modification(s) of an amino acid selected from substitutions, deletions, additions, and a mixture thereof. In a particularly preferred embodiment, the peptide may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof, preferably 1, 2, 3, 4, or 5, more preferably 1, 2 or 3. The substitution(s), deletion(s), addition(s) are not introduced at the positions of said at least one methionine, one proline, and one arginine.
[0124] In an alternative embodiment, the peptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99% of identity with the sequence of a segment of a PKC, preferably of SEQ ID No 1. In one embodiment, the part of the sequence of the peptide corresponding to SEQ ID No 1 has at least 70%, 75%, 80%, 85%, 90%, 95%, of identity with the sequence of a segment of SEQ ID No 1.
[0125] In another particular embodiment, the sequence of the peptide according to the present disclosure may comprise, consist essentially in or consist in a sequence selected from the group consisting of:
TABLE-US-00001 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo4) RLYFVMEYVNGGDLMYHIQQVGKFKEP; (SEQIDNo5) MYHIQQVGKFKEPQAVFYAAEISIGLFFLHKR; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM; (SEQIDNo7) MDGVTTRTFCGTP; (SEQIDNo8) MTKHPAKR; and (SEQIDNo12) RKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKP. (SEQIDNo13) RVLALLDKPPFLTQLHSCFQTVDRLYFVM; and (SEQIDNo14) RTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEM
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, it may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. More preferably, it may comprise 1, 2, or 3 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, the substitution(s), deletion(s), addition(s) are such that the at least one M, P and R are conserved. More preferably, the substitution(s), deletion(s), addition(s) are such that M, P and R are conserved. In addition, the number of substitution(s), deletion(s), addition(s) is chosen in order to keep at least 50%, 60% 70%, 75%, 80%, 85%, 90%, 95% of identity with the sequence of a segment of SEQ ID No 1.
[0126] In one aspect, the sequence of the peptide according to the present disclosure comprises, consists essentially in or consists in a sequence selected from the group consisting of:
TABLE-US-00002 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo4) RLYFVMEYVNGGDLMYHIQQVGKFKEP; (SEQIDNo5) MYHIQQVGKFKEPQAVFYAAEISIGLFFLHKR; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM; (SEQIDNo7) MDGVTTRTFCGTP; and (SEQIDNo8) MTKHPAKR;
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, it may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. More preferably, it may comprise 1, 2, or 3 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, the substitution(s), deletion(s), addition(s) are such that the at least one M, P and R are conserved. More preferably, the substitution(s), deletion(s), addition(s) are such that M, P and R are conserved. In addition, the number of substitution(s), deletion(s), addition(s) is chosen in order to keep at least 50%, 60% 70%, 75%, 80%, 85%, 90%, 95% of identity with the sequence of a segment of SEQ ID No 1.
[0127] In another aspect, the sequence of the peptide according to the present disclosure comprises, consists essentially in or consists in a sequence selected from the group consisting of:
TABLE-US-00003 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM (SEQIDNo7) MDGVTTRTFCGTP; (SEQIDNo8) MTKHPAKR;
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, it may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. More preferably, it may comprise 1, 2, or 3 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, the substitution(s), deletion(s), addition(s) are such that the at least one M, P and R are conserved. More preferably, the substitution(s), deletion(s), addition(s) are such that M, P and R are conserved. In addition, the number of substitution(s), deletion(s), addition(s) is chosen in order to keep at least 50%, 60% 70%, 75%, 80%, 85%, 90%, 95% of identity with the sequence of a segment of SEQ ID No 1.
[0128] In a particular aspect, the sequence of the peptide according to the present disclosure comprises, consists essentially in or consists in a sequence selected from the group consisting of:
TABLE-US-00004 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo7) MDGVTTRTFCGTP; (SEQIDNo8) MTKHPAKR;
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, it may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. More preferably, it may comprise 1, 2, or 3 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, the substitution(s), deletion(s), addition(s) are such that the at least one M, P and R are conserved. More preferably, the substitution(s), deletion(s), addition(s) are such that M, P and R are conserved. In addition, the number of substitution(s), deletion(s), addition(s) is chosen in order to keep at least 50%, 60% 70%, 75%, 80%, 85%, 90%, 95% of identity with the sequence of a segment of SEQ ID No 1.
[0129] Alternatively, the sequence of the peptide according to the present disclosure comprises, consists essentially in or consists in a sequence selected from the group consisting of:
TABLE-US-00005 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; (SEQIDNo10) MCKEHMMDGVTTRTFCGTPD; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG;
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, it may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. More preferably, it may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. Preferably, the substitution(s), deletion(s), addition(s) are such that the at least one M, P and R are conserved. More preferably, the substitution(s), deletion(s), addition(s) are such that M, P and R are conserved. In addition, the number of substitution(s), deletion(s), addition(s) is chosen in order to keep at least 50%, 60% 70%, 75%, 80%, 85%, 90%, 95% of identity with the sequence of a segment of SEQ ID No 1.
[0130] In a particular aspect, the peptide comprises, consists essentially in or consists in a sequence selected from the group consisting of:
TABLE-US-00006 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; (SEQIDNo10) MCKEHMMDGVTTRTFCGTPD; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG;
wherein the residues which are bold and underlined carry the stapling.
[0131] Optionally the peptide according to the present disclosure further comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof in the above listed sequences. Preferably, it may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. More preferably, it may comprise 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof. The substitution(s), deletion(s), addition(s) is chosen in order to conserve the at least one M, P and R and the two residues used for the stapling. More preferably, the substitution(s), deletion(s), addition(s) are such that M, P and R are conserved.
[0132] The peptide according to the present disclosure may further comprise a moiety facilitating its cellular uptake or entry, in particular a PTD (protein transduction domain). PTD generally comprises a certain amino acid sequence of 10 to 20 amino acids (Matsushita and Matsui, (2005), J Mol Med 83, 324-328; Vives et al, Biochimic et Biophysica Acta, 2008, 1786, 126-138). PTD is mainly composed of basic amino acids such as arginine or lysine, and representative examples of the PTD include arginine rich peptides such as poly R.sub.8 (RRRRRRRR (SEQ ID No 15)) or (RRPRRPRRPRRPRRP (SEQ ID No 16)), antennapedia or penetratin peptide such as (RQIKIWFQNRRMKWKK (SEQ ID No 17)) or HIV-Tat (YGRKKRRQRRR (SEQ ID No 18)).
[0133] The peptide according to the present disclosure can be made of natural amino acids and/or unnatural amino acids, preferably at least one methionine, one proline, and one arginine are natural amino acids. The term unnatural amino acids is defined as an analog or derivative of a natural amino acid (i.e., Alanine, Valine, Glycine, Leucine, Isoleucine, Lysine, Arginine, Glutamic acid, Glutamine, Aspartic acid, Asparagine, Histidine, Tyrosine, Phenylalanine, Tryptophan, Serine, Proline, Threonine, Cysteine, Methionine). They present a modified side chain, e.g. shorter, longer or with different functional groups. Isomers D and L are contemplated, in particular because isomers D are not sensible to proteases. In addition, modifications in some or all peptide bounds are also contemplated in order to increase the proteolysis resistance, in particular by (CONH) by (CH.sub.2NH), (NHCO), (CH.sub.2O), (CH.sub.2S), (CH.sub.2CH.sub.2), (COCH.sub.2), (CHOHCH.sub.2), (NN), and/or (CHCH). The peptide can present a carboxylic C terminal end (COO.sup.) and an amide one (CONH.sub.2). The peptide can also be D-retro-inverso sequence of a peptide as disclosed herein. The N terminal can be modified, especially with an acetyl radical.
[0134] Optionally, the peptide can be PEGylated in order to increase its stability. Further optionally the peptide can be formulated in non-aqueous protic solvent solutions such as propylene glycol and polyethylene glycol. The peptide may also be packaged into poly lactic co-glycolic acid microsphere depot formulation. Many sustained-release delivery systems exist, and many of these are appropriate for use in the present disclosure. For example, polymer-based slow-release compositions based upon degradable polymers such as PLGA, poly-lactate or poly-glycolate are suitable, as are lipid-based depot compositions, such as those described in WO2005/117830 and/or WO2006/075124, the complete disclosures of which are being hereby incorporated by reference. The formulation of active agents into biodegradable polymer depot formulations is well established and well known in the art, and the peptides of the present disclosure may thus be formulated with these using known methods. Preferably, the composition of the present disclosure is capable of releasing the peptide at a functional concentration for at least 1 month.
[0135] In an additional aspect, the peptide according to the present disclosure decreases the phenomenon of steatosis in the liver. The phenomenon of steatosis in the liver can be assessed by any method known from the man skilled in the art. In particular, it is assessed by the method described in the example section. For instance, the steatosis can be measured by imaging or biopsy. Peptides that decrease the phenomenon of steatosis in the liver can be conveniently screened for using any technology known in the art. In particular, a method for assessing the steatosis in the liver can comprise any method suitable for measuring the fat in the liver, the size of the lipid droplets in the liver and/or measuring the fatty liver index (Bedgni et al, BMC Gastroenterol. 2006 Nov. 2; 6:33).
[0136] By a peptide is intended to refer to a peptide as disclosed above or a combination of different peptides as disclosed above. For instance, 2, 3, 4, 5 or 6 different peptides can be used, preferably 2 or 3, more preferably 2.
[0137] In one embodiment, the combination of peptides comprises 2 or 3, preferably 2, peptides selected from the group consisting of:
TABLE-US-00007 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo4) RLYFVMEYVNGGDLMYHIQQVGKFKEP; (SEQIDNo5) MYHIQQVGKFKEPQAVFYAAEISIGLFFLHKR; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM; (SEQIDNo7) MDGVTTRTFCGTP; (SEQIDNo8) MTKHPAKR; and (SEQIDNo12) RKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKP. (SEQIDNo13) RVLALLDKPPFLTQLHSCFQTVDRLYFVM; and (SEQIDNo14) RTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEM
[0138] and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
[0139] In one embodiment, the combination of peptides comprises 2 or 3, preferably 2, peptides selected from the group consisting of:
TABLE-US-00008 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo4) RLYFVMEYVNGGDLMYHIQQVGKFKEP; (SEQIDNo5) MYHIQQVGKFKEPQAVFYAAEISIGLFFLHKR; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM; (SEQIDNo7) MDGVTTRTFCGTP; and (SEQIDNo8) MTKHPAKR;
[0140] and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
[0141] In one embodiment, the combination of peptides comprises 2 or 3, preferably 2, peptides selected from the group consisting of:
TABLE-US-00009 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo3) PFLTQLHSCFQTVDRLYFVM; (SEQIDNo6) PQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVM (SEQIDNo7) MDGVTTRTFCGTP; (SEQIDNo8) MTKHPAKR;
[0142] and optionally it comprises 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
[0143] In one embodiment, the combination of peptides comprises 2 or 3, preferably 2, peptides selected from the group consisting of:
TABLE-US-00010 (SEQIDNo2) MVEKRVLALLDKP; (SEQIDNo7) MDGVTTRTFCGTP; (SEQIDNo8) MTKHPAKR;
[0144] and optionally it comprises 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
[0145] In one embodiment, the combination of peptides comprises 2 or 3, preferably 2, peptides selected from the group consisting of:
TABLE-US-00011 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; (SEQIDNo10) MCKEHMMDGVTTRTFCGTPD; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG;
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof, preferably 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof, more preferably, 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
[0146] In one particular embodiment, the combination of peptides comprises the peptides:
TABLE-US-00012 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG;
and optionally it comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof, preferably 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof, more preferably, 1, 2, 3, 4, or 5 modification(s) of an amino acid selected from substitution(s), deletion(s), addition(s), and a mixture thereof.
[0147] In one embodiment, the combination of peptides comprises 2 or 3, preferably 2, peptides selected from the group consisting of:
[0148] selected from the group consisting of:
TABLE-US-00013 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; (SEQIDNo10) MCKEHMMDGVTTRTFCGTPD; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG;
wherein the residues which are bold and underlined carry the stapling.
[0149] In one particular embodiment, the combination of peptides comprises the peptides:
TABLE-US-00014 (SEQIDNo9) VECTMVEKRVLALLDKPPFLTQLHS; and (SEQIDNo11) SICKGLMTKHPAKRLGCGPEG;
wherein the residues which are bold and underlined carry the stapling.
Combinations
[0150] The peptide(s) according to the present disclosure can be used in combination with one or more additional active drugs, for instance an anti-diabetic drug, a hypolipidemic agent, an anti-obesity agent, an anti-hypertensive agent, an anti-steatotic drug and an agonist of peroxisome proliferator-activator receptors. Accordingly, the present invention relates to: [0151] a peptide as disclosed herein for use in the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma in combination with one or more additional active drugs, in particular as disclosed herein; [0152] a pharmaceutical composition comprising a peptide as disclosed herein and one or more additional active drugs, in particular as disclosed herein, for use in the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma; [0153] a product, combined preparation or kit comprising a peptide according to the present disclosure and one or more additional active drugs, in particular as disclosed herein, for simultaneous, separate or sequential use in the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma; [0154] the use of a peptide for the manufacture of a medicine for the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma in combination with one or more additional active drugs, in particular as disclosed herein; [0155] the use of a peptide as disclosed herein and one or more additional active drugs, in particular as disclosed herein, for the manufacture of a medicine for the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma in combination with one or more additional active drugs, in particular as disclosed herein; [0156] a method for the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma in a subject, comprising administering a therapeutically effective amount of a peptide as disclosed herein and a therapeutically effective amount of one or more additional active drugs, in particular as disclosed herein; [0157] a method for the treatment or prevention of a disease selected from the group consisting of nonalcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), hepatic steatosis (fatty liver), liver fibrosis, liver inflammation, cirrhosis, or hepatocellular carcinoma in a subject, comprising administering a therapeutically effective amount of a pharmaceutical composition comprising a peptide as disclosed herein and one or more additional active drugs, in particular as disclosed herein.
[0158] In particular, a therapeutic or sub-therapeutic effective amount of one or more additional active drugs can be used. By sub-therapeutic is intended to refer to an amount that can be for instance 90, 80, 70, 60, 50, 40, 30, 20 or 10% of the conventional therapeutic dosage (in particular for the same indication and the same administration route).
[0159] The anti-diabetic drug can be for instance insulin, insulin derivatives and mimetics; insulin secretagogues such as the sulfonylureas (e.g., chlorpropamide, tolazamide, acetohexamide, tolbutamide, glyburide, glimepiride, glipizide); gliflozins such as canagliflozin, emplagliflozin and dapagliflozin; glyburide and Amaryl; liraglutide (NN2211); insulinotropic sulfonylurea receptor ligands such as meglitinides, e.g. nateglinide and repaglinide; thiazolidinediones (e.g., rosiglitazone (AVANDIA), troglitazone (REZULIN), pioglitazone (ACTOS), balaglitazone, rivoglitazone, netoglitazone, troglitazone, englitazone, ciglitazone, adaglitazone, darglitazone that enhance insulin action (e.g., by insulin sensitization), thus promoting glucose utilization in peripheral tissues; protein tyrosine phosphatase-IB (PTP-1B) inhibitors such as PTP-112; Cholesteryl ester transfer protein (CETP) inhibitors such as torcetrapib, GSK3 (glycogen synthase kinase-3) inhibitors such as SB-517955, SB-4195052, SB-216763, NN-57-05441 and NN-57-05445; RXR ligands such as GW-0791 and AGN-194204; sodium-dependent glucose cotransporter inhibitors such as T-1095; glycogen phosphorylase A inhibitors such as BAY R3401; biguanides such as metformin and other agents that act by promoting glucose utilization, reducing hepatic glucose production and/or diminishing intestinal glucose output; alpha-glucosidase inhibitors such as acarbose and migiitoi) and other agents that slow down carbohydrate digestion and consequently absorption from the gut and reduce postprandial hyperglycemia; GLP-1 (glucagon like peptide-1), GLP-1 analogs such as Exendin-4 and GLP-1 mimetics; and DPPIV (dipeptidyl peptidase IV) inhibitors such as vildagliptin. It can also be an anti-diabetic drug described in Expert Opin Investig Drugs 2003, 12(4): 623-633,
[0160] The hypolipidemic agent can be for instance 3-hydroxy-3-methyl-glutaryl coenzyme A (HMG-CoA) reductase inhibitors, e.g. lovastatin, pitavastatin, simvastatin, pravastatin, cerivastatin, mevastatin, velostatin, fluvastatin, dalvastatin, atorvastatin, rosuvastatin and rivastatin; squalene synthase inhibitors; FXR (farnesoid X receptor) and LXR (liver X receptor) ligands such as obeticholic acid; bile acid sequenstrants, such as cholestyramine and colesevelam; fibrates; nicotinic acid and aspirin; aramchol, a transmembrane G protein-coupled receptor (TGR) 5 agonist.
[0161] The anti-obesity agent can be for instance orlistat, rimonabant, phentermine, topiramate, qnexa, and locaserin.
[0162] The anti-hypertensive agent can be for instance loop diuretics such as ethacrynic acid, furosemide and torsemide; angiotensin converting enzyme (ACE) inhibitors such as benazepril, captopril, enalapril, fosinopril, lisinopril, moexipril, perinodopril, quinapril, ramipril and trandolapril; inhibitors of the Na-K-ATPase membrane pump such as digoxin; neutralendopeptidase (NEP) inhibitors such as sacubitril; ACE/NEP inhibitors such as omapatrilat, sampatrilat and fasidotril; angiotensin II antagonists such as candesartan, eprosartan, irbesartan, losartan, telmisartan and valsartan, in particular valsartan; combinantions of NEP inhibitors and angiotensin II antagonists such as sacubitril and valsartan (i.e. Entresto); renin inhibitors such as ditekiren, zankiren, terlakiren, aliskiren, RO 66-1132 and RO-66-1168; beta-adrenergic receptor blockers such as acebutolol, atenolol, betaxolol, bisoprolol, metoprolol, nadolol, propranolol, sotalol and timolol; inotropic agents such as digoxin, dobutamine and milrinone; calcium channel blockers such as amlodipine, bepridil, diltiazem, felodipine, nicardipine, nimodipine, nifedipine, nisoldipine and verapamil; aldosterone receptor antagonists; and aldosterone synthase inhibitors.
[0163] The agonist of peroxisome proliferator-activator receptors can be for instance fenofibrate, pioglitazone, rosiglitazone, tesaglitazar, BMS-298585, L-796449, the compounds specifically described in the patent application WO 2004/103995 i.e. compounds of examples 1 to 35 or compounds specifically listed in claim 21, or the compounds specifically described in the patent application WO 03/043985 i.e. compounds of examples 1 to 7 or compounds specifically listed in claim 19 and especially (R)-1-{4-[5-methyl-2-(4-trifluoromethyl-phenyl)-oxazol-4-ylmethoxy]-benzenesulfonyl}-2,3-dihydro-1H-indole-2-carboxylic or a salt thereof.
[0164] Other drugs of interest can be for instance cenicriviroc, simtuzumab, selonsertib, emricasan
[0165] In a particular embodiment, the one or more additional active drugs used in combination with the peptide can be selected among: a GLP-1 analog such as liraglutide, obeticholic acid, a gliflozin, simtuzumab (GS 6624), cenicriviroc, aramchol, a Galectin 3 inhibitor such as GR-MD-02, a TGR5 agonist and a dual FXR/TGR5 agonist such as INT-777 or INT-767, and emricasan.
[0166] The form of the pharmaceutical compositions, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
[0167] The pharmaceutical or therapeutic compositions of the present disclosure can be formulated for a topical, oral, parenteral, intranasal, intravenous, intramuscular, subcutaneous or intraocular administration and the like.
[0168] The peptide used in the pharmaceutical composition of the present disclosure is present in a therapeutically effective amount.
[0169] The pharmaceutical composition comprising the peptide is formulated in accordance with standard pharmaceutical practice (Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York) known by a person skilled in the art.
[0170] In one aspect, the present invention provides a stable formulation for parenteral injection of the pharmaceutical composition according to the present disclosure comprising a peptide or a salt thereof, wherein the peptide has been dried and then is reconstituted in a solvent prior to use. The peptide (or, in embodiments where the formulation comprises two or more peptides, each of the peptides) is mixed with a non-volatile buffer and dried to a dry peptide powder. Suitable buffers include, but are not limited to, glycine buffers, citrate buffers, phosphate buffers, and mixtures thereof. In one embodiment, the buffer is a glycine buffer. In another embodiment, the buffer is a mixture of citrate buffer and phosphate buffer. In some embodiments, wherein the formulation comprises two or more peptides, the first and second buffer are the same. In some embodiments, wherein the formulation comprises two or more peptides, the first and the second buffer are different. Alternatively, the pharmaceutical composition according to the present disclosure may be stored in an aqueous state. The solution may contain, if desired, further additives or excipients, which must be compatible with the active principle and, if they are not removed during the freeze-drying stage, they must also be compatible with the route of administration. For parenteral administration, the composition may be injected intradermally, subcutaneously, intramuscularly, or intravenously. Preferably, the composition or peptide is injected or to be injected subcutaneously, in particular in the fat tissue.
[0171] It may preferably be placed with a mini-osmotic pump or other controlled delivery device implanted into the body. Preferably, it may be mixed with other compounds to make a depot slow release formulation. A preferred route of administration is subcutaneous injection, for instance by using a disposable or multiunit dispensing device, similar to an insulin pen.
[0172] In one embodiment, the peptide of the present disclosure may be mixed with other compounds to make a depot slow release formulation. This may then be injected subcutaneously to form a slow release depot.
[0173] For oral administration, the composition can be formulated into conventional oral dosage forms such as tablets, capsules, powders, granules and liquid preparations such as syrups, elixirs, and concentrated drops. Non-toxic solid carriers or diluents may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like. For compressed tablets, binders, which are agents which impart cohesive qualities to powdered materials, are also necessary. For example, starch, gelatine, sugars such as lactose or dextrose, and natural or synthetic gums can be used as binders. Disintegrants are also necessary in the tablets to facilitate break-up of the tablet. Disintegrants include starches, clays, celluloses, algins, gums and crosslinked polymers. Moreover, lubricants and glidants are also included in the tablets to prevent adhesion to the tablet material to surfaces in the manufacturing process and to improve the flow characteristics of the powder material during manufacture. Colloidal silicon dioxide is most commonly used as a glidant and compounds such as talc or stearic acids are most commonly used as lubricants.
[0174] For transdermal administration, the composition can be formulated into ointment, cream or gel form and appropriate penetrants or detergents could be used to facilitate permeation, such as dimethyl sulfoxide, dimethyl acetamide and dimethylformamide.
[0175] For transmucosal administration, nasal sprays, intrapulmonary inhalation, rectal or vaginal suppositories can be used. In one embodiment, the invention may be administered by the intrapulmonary route using either a dry powder or liquid formulation administered using an intrapulmonary drug delivery device according to methods known in the art. The active compound can be incorporated into any of the known suppository bases by methods known in the art. Examples of such bases include cocoa butter, polyethylene glycols (carbowaxes), polyethylene sorbitan monostearate, and mixtures of these with other compatible materials to modify the melting point or dissolution rate.
[0176] Pharmaceutical compositions according to the present disclosure may be formulated to release the active drug substantially immediately upon administration or at any predetermined time or time period after administration.
[0177] Pharmaceutical compositions according to the present disclosure can comprise one or more peptides of the present disclosure associated with pharmaceutically acceptable excipients and/or carriers. These excipients and/or carriers are chosen according to the form of administration as described above.
[0178] In a particular embodiment, the pharmaceutical composition according to the present disclosure comprises between 10 ng and 10 g of the peptide of the present disclosure. In one embodiment, pharmaceutical composition according to the present disclosure comprises between 0.01 mg and 1 g of the peptide of the present disclosure.
[0179] All the references cited in this application, including scientific articles and summaries, published patent applications, granted patents or any other reference, are entirely incorporated herein by reference, which includes all the results, tables, figures and texts of theses references.
[0180] Although having different meanings, the terms comprising, having, consisting in and containing can be replaced one for the other in the entire application.
[0181] Further aspects and advantages of the present disclosure will be described in the following examples, which should be regarded as illustrative and not limiting.
EXAMPLES
Example 1: PATAD's Long-Lasting Effect in Preventing Hyperglycemia in Wild Type Mice
[0182] These are results obtained from series of glucose tolerance test (GTT) and data from two time points namely 30 minutes and 120 minutes were used to generate these curves for both control and PATAD treated diet induced obese (DIO) and diabetic wild type male C57/B6 mice (control). These data show the long lasting action of the peptide-based PATAD (3 months post injection of a unique subcutaneous injection).
Example 2: Effect of Adipose Tissue Targeted PATAD Treatment on Expression Levels of Key Fatty Acids Transporters and Receptors
[0183] As PATAD subcutaneous injection relates to restoration of glucose absorption in the adipose tissue, the inventors measured the expression levels of all 6 isoforms for the FATPs (1-6) (Fatty acid transport protein 1-6) and the 4 isoforms of the FFAR (Free Fatty Acid Receptor) to assess any effect on these genes.
[0184] Interestingly, PATAD injections induced a very specific and drastic decrease in FAPT2 in the adipose tissue allowing to correlate the effect of PATAD treatment directly on the FATP2 expression drop (
Example 3: Protective Effect on Liver after 3 Months of a Single Injection of Adipose Tissue Targeted PATAD Treatment
[0185] Mice presented in
[0186] A similar effect has been observed with the PATAD stapled peptide sequence A alone (
Example 4: PATAD Stapled Peptide Sequence A is Effective in Reducing FATP2 Expression Level in the Adipose Tissue and in Increasing Circulating Levels of GLP-1 11 Days Post Adipose Tissue Injection
[0187] Mice were injected with a single dose of either scramble peptide or PATAD stapled peptide sequence A. 11 days post injection, the mice were euthanized, and plasma was obtained and used for determination of circulating GLP1 from mice with the indicated treatment. PATAD stapled peptide sequence A decreased FATP2 expression in the adipose tissue (
Example 5: Effect of PATAD Stapled Peptide Sequence A Treatment in the Adipose Tissue on Circulating Levels of Albumin
[0188] A decreased circulating free albumin concentration has been observed when the mice were treated with PATAD stapled peptide sequence A indicating an increase in the levels of circulating lipids (
Example 6: Effect of Either PATAD or Metformin or a Combination of Both PATAD and Metformin on Glucose Tolerance Demonstrating that Both Types of Treatment can be Combined to Improve Liver Function Through Improvement of Glucose Tolerance
[0189] DIO male mice were treated with either PATAD alone (1 injection) or with metformin (a daily dose of 300 mk/kg through oral gavage) or a combination of both and oral glucose tolerance test was performed at the given indicated time points (
Materials & Methods
Mice Husbandry
[0190] For this study, mice were on a C57/BL6 genetic background. All animals were housed in a temperature and humidity controlled facility, with a 12 h-light/12 h-dark cycle fed during the whole phase mice will be fed with a 60% high fat diet from Research Diets (D12492), and tap water will be provided ad libitum. Mice were fed and tested regularly for glucose tolerance test for their glucose tolerance and once they were glucose intolerant they were used for treatment.
Peptide Sequences and Synthesis
[0191] PATAD is the name given to a series of peptides derived from the PKC alpha isoform that are biologically active with the ability to trigger glucose absorption specifically in the adipose tissue.
TABLE-US-00015 StapledpeptidesequenceA: (SEQIDNO:19) VECTM-[2-(4-pentenyl)alanine]-EKRVLA-[2- (4-pentenyl)alanine]-LDKPPFLTQLHS StapledpeptidesequenceB: (SEQIDNO:20) S-[2-(4-pentenyl)alanine]-CKGLMT-[2- (4-pentenyl)alanine]-HPAKRLGCGPEG ScrambledpeptidesequenceA: (SEQIDNO:21) KEVPVDTCHLTLMLLFRSVALKQHPE ScrambledpeptidesequenceB: (SEQIDNO:22) SAECKGRHGTPPGKLMICKGL
[0192] The stapled and scrambled peptides were purchased from Anaspec, USA with a 95% purity.
[0193] All peptides were initially dissolved in DMSO and then diluted in sterile saline solution at a concentration of 10 ng/L. 2.5 L of each peptide (stapled or scrambled) were mixed and then injected directly in the subcutaneaous adipose tissue in each mouse.
Dosage Regimen of the Peptides
[0194] Control mice was injected with the Scramble controls (retroperitoneal fat/subcutaneous injection: one injection at D0) and the indicated tests performed. Treated mice were injected with the mixture of two PATAD stapled peptides following the same procedure with the PATAD peptide A and B test item or with the PATAD stapled peptide sequence A (retroperitoneal fat/subcutaneous injection: one injection at D0) and the indicated tests performed.
RNA Extraction, cDNA Synthesis, q-PCR and Taqman
[0195] Total RNA was prepared from the different tissues and cells using a RiboPure kit (Catalog #: AM1924; Ambion) followed by a DNAse treatment with the TURBO DNA-Free (Catalog #: AM 1907; Ambion). RNA integrity was assessed by gel electrophoresis and RNA concentration by Eppendorf Biophotometer Plus with the Hellma Tray Cell (Catalog #: 105.810-uvs; Hellma). Reverse transcription of 1 g total RNA to cDNA was performed using the BioRadiScript cDNA synthesis kit (Catalog #: 170-8891; BioRad). Real-time quantitative polymerase chain reaction amplification was performed in a BioRad CFX96 Real-Time System using the iQ SYBR Green Supermix (Catalog #: 170-8886; BioRAd) and primer sets optimized for tested targets for SYBR Green-based real-time PCR for the real-time PCR. Taqman analysis was carried out with the specific gene assay with the Taqman Fast Advanced Master Mix (Catalog #: 4444557; Applied Biosystems). The normalized fold expression of the target gene was calculated using the comparative cycle threshold (C.sub.t) method by normalizing target mRNA C.sub.t to those for GAPDH using the CFX Manager Software Version 1.5 and was verified using the Lin-Reg program (Ruijter et al., 2009). All primer pairs were purchased from Biorad.
[0196] Primer specifications are found in the table below:
TABLE-US-00016 SEQ Frag- Gene ID ment name Primername Sequences NO: size Fatp1 Mu_Slc27a1-RT-ex3F TGCTTTGGTT 23 156bp TCTGGGACTT Mu_Slc27a1-RT-ex4R GCTCTAGCCG 24 AACACGAATC Fatp2 Mu_Slc27a2-RT-ex4F TGGACAAAGTA 25 165bp GACGGAGTGTC Mu_Slc27a2-RT-ex5R TAGCAAGGCC 26 TGTCCCATAC Fatp3 Mu_Slc27a3-RT-ex9F TGAGAACTTG 27 171bp CCACCGTATG Mu_Slc27a3-RT-ex1OR GGCAGGTAGG 28 CCCCTATATC Fatp4 Mu_Slc27a4-RT-ex2F GTTTCATCCG 29 184bp GGTCTTCATC Mu_Slc27a4-RT-ex3R GTGTCTGTGC 30 CCTCGAAAAT Fatp5 Mu_Slc27a5-RT-ex4F AAGTTCTCTG 31 191bp CCTCCCGATT Mu_Slc27a5-RT-ex5R CAAAGCGTTG 32 CTGGAAGTTT Fatp6 Mu_Slc27a6-RT-ex1F TCGATTCCCT 33 204bp CCTACACTGC Mu_Slc27a6-RT-ex2R TTGGTGGTACT 34 GGCTCATCA
AdipoRed Staining of Liver Sections G-36,DNA
[0197] Livers were isolated and briefly washed in PBS buffer (pH 7.4). after weighing the dried liver, for the liver to body weight ratio, a sliced sample of the liver were then placed in 4% paraformaldehyde (in 0.1M sodium phosphate buffer, pH 7.2) for 15 min, washed in PBS and incubated in AdipoRed dye (1/25; Lonza, Switzerland) with 30 M DAPI (Sigma-Aldrich, USA) for 15 minutes. After 3 washes with PBS samples were mounted on slides and pictures were taken using Zeiss microscope.
Biochemical Assay
AST and ALT ELISA Measurements
[0198] Plasma samples from the indicated mice were used to determine plasma content of either AST (aspartate aminotransferase) or ASL (alanine aminotransferase) both robust indicators of liver damage were measured using commercially purchased ELISA kits. These parameters were determined according to manufacturer's procedure.
[0199] SEB214Mu (96 Tests): Enzyme-linked Immunosorbent Assay Kit For Aspartate Aminotransferase (AST), Cloud Clone Corp
[0200] SEA207Mu (96 Tests): Enzyme-linked Immunosorbent Assay Kit For Alanine Aminotransferase (ALT), Cloud Clone Corp
[0201] For GLP-1 measurement, a commercially available kit was used. RayBio Human/Mouse/Rat GLP-1 Enzyme Immunoassay Kit, EIA-GLP1, RayBiotech were used with the indicated procedures from the manufacturer. For the plasma albumin level determination, a commercially available kit was used.
Glucose Tolerance Test
[0202] PATAD stapled peptide sequence A was initially dissolved in DMSO and then diluted in sterile saline solution at a concentration of 10 ng/L. 2.5 L of peptide were injected directly in each mouse. Mice (C57B6/6J) were injected with PATAD stapled peptide sequence A by retroperitoneal fat/subcutaneous injection two times: one injection at D1 and a second injection at the same site at D7. Mice treated with metformin received through oral gavage 300 mg/kg orally QD for 10 days. Mice receiving both PATAD and metformin received both the PATAD injections and metformin oral gavage for the indicated period of time. The experimental setup used was a cross-over experimental set-up where the reference values for each mouse were the values prior to beginning of treatment.