COMPOSITIONS AND METHODS FOR TREATMENT DURING NON-ACUTE PERIODS FOLLOWING CNS NEUROLOGICAL INJURY
20200368318 ยท 2020-11-26
Inventors
Cpc classification
A61P25/28
HUMAN NECESSITIES
A61K38/1883
HUMAN NECESSITIES
A61P9/10
HUMAN NECESSITIES
International classification
Abstract
This invention relates to treatment of neuroinjury in a post-acute window or in a chronic period following neuroinjury.
Claims
1. A method for administering a polypeptide comprising an epidermal growth factor-like (EGF-like) domain to a mammal, said method comprising: administering a polypeptide comprising an epidermal growth factor-like (EGF-like) domain following neuroinjury in said mammal; and, initiating the administering at least two days after the neuroinjury.
2. A method of claim 1, wherein said initiating step begins at a three days after the neuroinjury.
3. The method of claim 1, wherein said initiating step begins at least seven days after the neuroinjury.
4. A method of claim 1 wherein the EGF-like domain is encoded by the neuregulin (NRC)-1 gene, (NRG)-2 gene, (NRG)-3 gene, (NRC)-4 gene.
5. The method of claim 1, wherein said polypeptide is OGF2.
6. The method of claim 1, wherein said mammal is a human
7. A method for administering a polypeptide comprising an epidermal growth factor-like (EGF-like) domain to a mammal, said method comprising: administering a polypeptide comprising an epidermal growth factor-like (EGF-like) domain following neuroinjury in said mammal; initiating the administering at within six hours after the neuroinjury; and, continuing the administering step into a time period more than six hours post injury.
8. The method of claim 7, wherein the continuing step comprises continuing the administering step into a time period more than 48 hours post injury.
9. The method of claim 7, wherein the continuing step comprises continuing the administering step into a time period more than 72 hours post injury.
10. A method of claim 7 wherein the EGF-like domain is encoded by the neuregulin (NRG)-1 gene, (NRG)-2 gene, (NRG)-3 gene, (NRG)-4 gene.
11. The method of claim 7, wherein said polypeptide is GGF2.
12. The method of claim 7, wherein said mammal is a human.
13. A method for administering a polypeptide comprising an epidermal growth factor-like (EGF-like) domain following an ischemic central nervous system neuroinjury in a mammal, said method comprising: administering the peptide following neuroinjury in said mammal; and, initiating the administering after the mammal has achieved a complete post-injury ischemic lesion cell death volume.
14. A method of claim 13, wherein the EGF-like domain is encoded by the neuregulin (NRG)-1 gene, (NRG)-2 gene, (NRG)-3 gene, (NRG)-4 gene.
15. The method of claim 13, wherein said polypeptide is GGF2.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056] (EGFL) domain 4. The nucleic acid sequence is designated SEQ ID NO: 23 and the amino acid sequence is designated SEQ ID NO: 24.
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
DETAILED DESCRIPTION OF THE INVENTION
[0068] As indicated herein, the non-palliative treatment of ischemic stroke has heretofore been confined to therapeutics administered in the acute phase following a stroke.
[0069] Immediate cell death due, at least in part, to oxygen deprivation is observed during the acute phase. Furthermore, as shown in
[0070] The semi-acute phase, from approximately six hours to two days (or three days by some definitions) post-neuroinjury, is characterized by continued free radical release, glutamate dumping, calcium and sodium release, oxygen deprivation of the occluded region, and immediate localized cell death. To date, there are no known clinically approved agents for use in humans during the semi-acute phase following a stroke.
[0071] As depicted in
[0072] As indicated by the scientific literature, various compounds appear to exhibit efficacy in the acute and semi-acute periods. However, after the 24, 36 or 48 hour marks post-CNS neuroinjury, potential therapies progressively lose the ability to treat the injury. In fact, some of the therapeutics modalities, such as tPA, that have an effect in the acute period begin to have serious, life-threatening contraindications as time occurs post-injury.
[0073] Days, weeks or months after an ischemic event, during the chronic phase post-stroke, therapies must be aimed at promoting neurorecovery. The promotion of neurorecovery following a traumatic event such as stroke in the central nervous system involves distinctly different physiologic phenomena and therapeutic strategy than employed in the pre-chronic window. The pre-chronic treatments generally involve agents that aim to restore blood flow and reduce acute cell death. In contrast, a therapeutic agent that can be efficaciously administered at 48 hours or more, or 72 hours or more post-injury is differentiated from acute phase therapeutics by its ability to restore function without altering the size of the ischemic lesion. In one embodiment, treatment in accordance with the invention begins after essentially complete post-injury death of an ischemic CNS lesion; by essentially complete post-injury death of an ischemic CNS lesion is intended that the CNS cell death that is directly consequent to the ischemic event will have transpired, other cell death due to age or therapy (whether or not the therapy is designed to address the ischemia) is not within the scope of this definition.
[0074] As shown herein, the present inventors demonstrated that neuregulins are effective in restoring neurological function during the chronic phase of a neurotraumatic injury. In one embodiment, the neurotraumatic injury is an ischemic stroke. As described herein, the present inventors have made the surprising discovery that neuregulin is effective when dosing is initiated during the chronic phase following an ischemic event. Even more surprising is the discovery that neuregulin is effective even when dosing is initiated as late as 7 days after the ischemic event.
[0075] The present data shows that the favorable outcomes achieved have not come about by the same mechanisms found to be effective in immediate post-ischemic treatment. Neuregulin treatment during chronic phase following stroke does not alter the size of the ischemic lesion (see Table 1). This clearly demonstrates that the acute and semi-acute phases of the pathophysiology are complete at these phases, and neuregulin administered during the chronic phase is promoting neurorecovery, rather than establishing reperfusion and protecting neurons.
TABLE-US-00001 TABLE 1 Infarct Volume (%) bFGF 21.3 3.3 NRG 1.0 g/kg 26.8 3.0 GGF2 6.5 g/kg 27.1 3.7 GGF2 100 g/kg 26.3 3.5 Vehicle 25.0 3.5
Compositions of the Invention:
[0076] As indicated above, neuregulins are polypeptides encoded by the NRG-1, NRG-2, NRG-3 or NRG-4 genes and possess EGF-like domains that allow them to bind to and activate ErbB receptors. Holmes et al. (Science 256:1205-1210, 1992) have shown that the EGF-like domain alone is sufficient to bind and activate the p 1 85erbB2 receptor. Accordingly, any polypeptide product encoded by the NRG-1, NRG-2, NRG-3 or NRG-4 gene, or any neuregulin-like polypeptide, e.g., a polypeptide having an EGF-like domain encoded by a neuregulin gene or cDNA (e.g., an EGF-like domain containing the NRG-1 peptide subdomains C-CID or C-C/D, as described in U.S. Pat. Nos. 5,530,109, 5,716,930, and 7,037,888; or an EGF-like domain as disclosed in WO 97/09425) may be used in the methods of the invention. A composition of the invention may be in unit dosage form. Kits comprising compositions of the invention and/or instructions in accordance with the invention are within the scope of the present invention as well.
[0077] Compositions of the invention may be administered to patients with a pharmaceutically-acceptable diluent, carrier, or excipient. Conventional pharmaceutical practice is employed to provide formulations or compositions to administer such compositions to patients or experimental animals. Although intravenous administration is preferred, any appropriate route of administration may be employed, for example, parenteral, subcutaneous, intramuscular, intracranial, intraorbital, ophthalmic, intraventricular, intracapsular, intraspinal, intracistemal, intraperitoneal, intranasal, aerosol, oral, or transdermal (e.g., by applying an adhesive patch carrying a formulation capable of crossing the dermis and entering the bloodstream) or topical administration.
[0078] Therapeutic formulations may be in the form of liquid solutions or suspensions; for oral administration, formulations may be in the form of tablets or capsules; and for intranasal formulations, in the form of powders, nasal drops, or aerosols. Methods well known in the art for making formulations are found in, for example, Remington's Pharmaceutical Sciences. Formulations for parenteral administration may, for example, contain excipients, sterile water, or saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes. Other potentially useful parenteral delivery systems for administering molecules of the invention include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes. Formulations for inhalation may contain excipients, for example, lactose, or may be aqueous solutions containing, for example, polyoxyethylene-9-lauryl ether, glycocholate and deoxycholate, or may be oily solutions for administration in the form of nasal drops, or as a gel.
[0079] As a further aspect of the invention there is provided the present compounds for use as a pharmaceutical especially in the treatment or prevention of the aforementioned conditions and diseases. Also provided herein is the use of the present compounds in the manufacture of a medicament for the treatment or prevention of one of the aforementioned conditions and diseases.
[0080] With respect to intravenous injections, dose levels are generally in a range from one value in the following list to a higher value in the list: about 0.001 mg/kg, about 0.01 mg/kg, about 0.1 mg/kg, about 1 mg/kg, and about 10 mg/kg. The dosing periodicity is generally in regular time intervals of from about every 24, 48, 72, or 96 hours. In an alternative embodiment, the dosing periodicity is generally in regular time intervals of from about every 1, 2, 3, 4, 5, 6, 7, days. In an alternative embodiment, the dosing periodicity is generally in regular time intervals of from about every 1, 2, 3, 4, or 5 weeks. After a period of such dosing, less frequent dosing such as monthly, every three months, every four months, or yearly can be employed.
[0081] Transdermal doses are selected to provide essentially identical, similar or lower physiologic levels (plasma, tissue, CSF) than are achieved using injection doses.
[0082] The compounds of the invention can be administered as the sole active agent or they can be administered in combination with other agents, including other compounds that may be found to demonstrate the same or a similar therapeutic activity and that are determined to be safe and efficacious for such combined administration. Other such compounds contemplated for use in the treatment of acute or semi-acute neuroinjury include hematopoietic factors (e.g., G-CSF and/or GM-CSF); substances that have thrombolytic activities, e.g., tPA, streptokinase, urokinase, and/or Ancrod; antiplatelet agents such as acetylsalicylic acid (aspirin), clopidogrel (Plavix), aspirin combined with extended release dipyridamole (Aggrenox); anticoagulants such as warfarin (Coumadin) or Heparin; and/or substances that interfere with apoptotic signaling (e.g. inhibitors of caspases) or progesterone. It is understood, however, that the above compounds are administered for preventive purposes in advance of stroke (e.g., for antiplatelet agents or anticoagulants), or during the acute phase following stroke (tPA).
[0083] In order to evaluate the motor, sensory or cognitive deficits that are effectively treated in accordance with the present invention, several tools are available in the art. Well known indicia for monitoring treatment efficacy include Mini-Mental State Examination (MMSE), Modified Mini-Mental State Examination (3MS), Functional Impairment Measure (FIM, Barthel Test, Fugl-Meyer Motor Score, Wolf Motor Function Test, Jebsen-Taylor hand function test, Nottingham Health Profile Part 1 and Motor Assessment Scale (MAS), Sodring Motor Evaluation Scale (SMES), the Berg Balance Scale (BBS) and Barthel Activities of Daily Living (ADL), and other clinical tests such as measures of affect, speech, swallowing, cognition, motor coordination, strength, sensation and autonomic function, as well as survival rates and hospitalization rates may be used to assess disease progression.
[0084] Following injury, disease, infection or other disruption of the nervous system, the brain, spinal cord or peripheral nerves do not function properly due to any combination of gross destruction, apoptosis, disrupted pathways and synapses, inflammation, altered chemical environment, changes in cell metabolism and changes in cellular transcription and translation. As used herein, the term neurorecovery is used to refer to the process by which the nervous system restores its functioning towards a normal state. This process may occur by correction, circumvention, reversal or elimination of any of the causes noted above.
[0085] Furthermore, it is now believed that significant neurorecovery can occur through a process known as plasticity whereby the nervous system forms new connections to compensate or adapt to other changes. Injuries of the CNS cause disruption of local and long-range connections resulting in disrupted function and disability. Plasticity is an event where new connections are formed between existing neurons. Plasticity has been shown to be a mechanism of neurorecovery in CNS systems including the visual system (Pizzorusso et al.,) and the spinal cord (Fawcett JW (2009) Brain 132:1417-1418.). In plasticity, new synapses are formed or existing synapses are strengthened, weakened or removed to allow existing structures and systems to compensate for those that have been destroyed or disrupted in the injury. Other forms of plasticity may include altering the neurochemistry of existing cells to changes the direct synaptic signaling and paracrine signaling. Plasticity may also take the form of altering receptor levels to make neurons and other cells more or less sensitive to direct synaptic or paracrine signaling. These processes are well accepted as mechanism of learning and memory.
[0086] The discussion of documents, acts, materials, devices, articles and the like is included in this specification solely for the purpose of providing a context for the present invention. It is not suggested or represented that any or all of these matters formed part of the prior art base or were common general knowledge in the field relevant to the present invention before the priority date of each claim of this application.
[0087] While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the appended claims. The following Examples will assist those skilled in the art to better understand the invention and its principles and advantages. It is intended that these Examples be illustrative of the invention and not limit the scope thereof.
EXAMPLES
Example 1
Materials and Methods
[0088] Animal Preparation:
[0089] Fifty (50), adult, male Sprague-Dawley were used for the study (10 extra animals were ordered). All rats were housed and handled for behavioral assessment for seven (7) days prior to surgery for acclimation purposes. At the end of the handling period, rats were randomized and assigned to different groups. Rats were given a unique identification number by tail marking. Ten extra rats were also handled.
[0090] Surgical Preparation:
[0091] Middle Cerebral Artery Occlusion (MCAO), Tamura Model:
[0092] This surgical injury model in the rat is a well accepted model of stroke in the field (Tamura et al, 1981, J Cereb Blood Flow Metab. 1(1):53-60; Tamura et al, 1981, J Cereb Blood Flow Metab. 1(1):61-9). Focal cerebral infarcts were made by permanent occlusion of the proximal right middle cerebral artery (MCA) using a modification of the method of Tamura et al. Male Sprague-Dawley rats (300-400 g at the time of surgery) were anesthetized with 2-3% halothane in the mixture of N.sub.2O:O.sub.2 (2:1), and were maintained with 1-1.5% halothane in the mixture of N.sub.2O:O.sub.2 (2:1). The temporalis muscle was bisected and reflected through an incision made midway between the eye and the eardrum canal. The proximal MCA was exposed through a subtemporal craniectomy without removing the zygomatic arch and without transecting the facial nerve. The artery was then occluded by microbipolar coagulation from just proximal to the olfactory tract to the inferior cerebral vein, and was transected. Body temperature was maintained at 37.5 C.0.5 C. throughout the entire procedure. Cefazolin (40 mg/kg; Baxter, Lot 06014.1, Exp. January 2009) was given intraperitoneally(i.p.) one day before MCAO and just after MCAO to prevent infections. Burprenorphine (NDC 12496-0757-1, Lot #700Y02, exp: Jan. 1, 2010) s.c. (0.05-0.1 mg/kg) was given before the MCAO surgery as analgesia.
[0093] Compound Preparation and Dosing:
[0094] GGF2 and NRG-1 (NRG-EGF):
[0095] Stock solutions were prepared at Acorda Therapeutics and stored at 0-5 C. Doses were made up as described below:
[0096] Cloning, Expression and Purification of NRG-1 [NRG1b2 EGF Domain (156Q)]
[0097] DNA: NRG1b2 egf domain was cloned from human brain cDNA and cloned into pet 15b vector (Novagen cat #69661-3) using Ndel and BamH1 restriction sites. The resulting protein is a 6.92 kda+3kDa His tag (=9.35 kDa).
[0098] DNA sequence of NRG1b2 egf pet 15 clone
[0099] The underlined sequences are the cloning sites (Nde1 and BamH1)
TABLE-US-00002 (SEQIDNO:1) CATATGAGCCATCTTGTAAAATGTGCGGAGA AGGAGAAAACTTTCTGTGTGAATGGAGGGG AGTGCTTCATGGTGAAAGACCTTTCAAACC CCTCGAGATACTTGTGCAAGTGCCCAAATG AGTTTACTGGTGATCGCTGCCAAAACTACG TAATGGCCAGCTTCTACAAGGCGGAGGAGC TGTACCAGTAAGGATCC.
[0100] The final translated protein from pet15b vector is shown below. The egf domain is underlined.
TABLE-US-00003 (SEQIDNO:2) 102030 MGSSHHHHHHSSGLVPRGSHMSHLVKCAEK 4050 EKTFCVNGGECFMVKDLSNPSRYLCKCPNE 607080 FTGDRCQNYVMASFYKAEELYQ
Theoretical pI/Mw: 7.69/9349.58
[0101] Protein Expression
[0102] The clone was transformed into B121 cells for protein expression using the Overnight Express Autoinduction System (Novagen) in LB media at 25 C. for 24 hours. Expression is primarily in insoluble inclusion bodies.
[0103] Protein Refolding: Adapted from Novagen Protein Refolding Kit, 70123-3.
[0104] Protein Purification: Protein is loaded onto an anion exchange column DEAE at 2.5 ml/min. The NRG-1 fragment remains in the flow through, whereas the contaminants bind and elute at a higher salt. The loading and washing buffer is 50 mM Tris pH7.9 and elution buffer is 50 mM Tris pH7.9 with 1M NaCl. The flow through is pooled and concentrated with Centriprep YM-3 from Millipore.
[0105] Western blotting: Protein expression is assessed by western blotting. Resulting band runs at around 10 kD.
[0106] A 4-20% criterion gel (Biorad) was used for protein resolution followed by transfer onto Protran nitrocellulose paper (0.1 um pore size from Schliecher and Schull). The blot is blocked in 5% milk in TBS-T (0.1%). Primary antibody (Anti EGF Human NRG1-alpha/HRG1-alpha Affinity Purified Polyclonal Ab Cat #AF-296-NA from R&D systems) 1:1000 dilution in 5% milk in TBS-T-1 hour at RT (also works at 4 C. overnight). Rabbit anti goat HRP secondary antibody was used at 1:10,000 dilution in 5% milk in TBS-T for 1 hour at RT. All washes were performed in TBS-T.
[0107] Purification Protocol for NRG-1
[0108] The cultures are grown at 25 C. in Overnight Express Autoinduction System 1 from Novagen (cat #71300-4). There is very little soluble NRG-1 present. The culture is spun down and the pellets are extracted, solubilized and re-folded to acquire the NRG-1 before purification can take place.
[0109] Materials for Extraction, Solubilization and Re-Folding:
[0110] 10 Wash Buffer: 200 mM Tris-HCl, pH 7.5, 100 mM EDTA, 10% Triton X-100
[0111] 10 Solubilization Buffer: 500 mM CAPS, pH 11.0
[0112] 50 Dialysis Buffer: 1M Tris-HCl, pH 8.5
[0113] 30% N-laurylsarcosineadd as powder (Sigma 61739-5G)
[0114] 1M DTT
[0115] Reduced glutathione (Novagen 3541)
[0116] Oxidized glutathione (Novagen 3542)
[0117] A. Cell Lysis and Preparation of Inclusion Bodies
[0118] Thaw and re-suspend cell pellet in 30 mls 1 wash buffer. Mix as needed for full re-suspension.
[0119] dd protease inhibitors (25 ul of 10 per 50 mls), DNase (200 ul of 1 mg/ml per 50 ml) and MgC12 (500 ul of 1 M per 50 mls) to suspension,
[0120] Lyse the cells by sonication. [0121] a. Cool the cells on ice throughout this step. [0122] b. Using the square tip, sonicate for 30 seconds on level 6, 10 times until suspension become less viscous. Let suspension cool on ice for 60 seconds between each sonication. Keep volume no higher than 40 mls in 50 ml conical tube when sonicating.
[0123] When complete, transfer each suspension to 250 ml angled neck centrifuge bottles for use with F-16/250 rotor.
[0124] Collect the inclusion bodies by centrifugation at 10000g for 12 minutes.
[0125] Remove the supernatant (save a sample for analysis of soluble protein) and thoroughly re-suspend the pellet in 30 mls of 1 Wash Buffer.
[0126] Repeat centrifugation as in Step 4 and save the pellet.
[0127] Again, thoroughly re-suspend the pellet in 30 mls of 1 Wash Buffer.
[0128] Collect the inclusion bodies by centrifugation at 10000g for 10 minutes. Decant the supernatant and remove the last traces of liquid by tapping the inverted tube on a paper towel.
[0129] B. Solubilization and Refolding
[0130] From the wet weight of inclusion bodies to be processed, calculate the amount of 1 Solubilization Buffer necessary to re-suspend the inclusion bodies at a concentration of 10-15 mg/ml. If the calculated volume is greater than 250 ml, use 250 ml.
[0131] At room temperature, prepare the calculated volume of 1 Solubilization Buffer supplemented with 0.3% N-laurylsarcosine (up to 2% may be used if needed in further optimization) (300 mg/100 mL buffer) and 1 mM DTT.
[0132] Add the calculated amount of 1 Solubilization Buffer from step 2 to the inclusion bodies and gently mix. Large debris can be broken up by repeated pipetting.
[0133] Incubate in refrigerator shaker at 25 C., 50-100 rpm for 4-5 hours.
[0134] Clarify by centrifugation at 10000g for 10 minutes at room temperature.
[0135] C. Dialysis Protocol for Protein Refolding
[0136] Prepare the required volume of buffer for dialysis of solubilized protein. The dialysis should be performed with at least 2 buffer changes of greater than 50 times the volume of the sample.
[0137] Dilute the 50 Dialysis Buffer to 1 at the desired volume and supplement with 0.1 mM DTT.
[0138] Dialyze for at least 4 hours at 4 C. Change the buffer and continue. Dialyze for an additional 4 or more hours.
[0139] Prepare additional dialysis buffer as determined in step 1, but omit DTT.
[0140] Continue the dialysis through two additional changes (min. 4 hr each), with the dialysis buffer lacking DTT.
[0141] D. Redox Refolding Buffer to Promote Disulfide Bond Formation
[0142] Prepare a dialysis buffer containing 1 mM reduced glutathione (1.2 g/4 L) and 0.2 mM oxidized glutathione (0.48 g/4 L) in 1 Dialysis Buffer. The volume should be 25 times greater than the volume of the solubilized protein sample. Chill to 4 C.
[0143] Dialyze the refolded protein from step 1 overnight at 4 C.
[0144] Purification
[0145] All procedures are done at 4 C.
[0146] Chemicals:
[0147] Trizma Hydrochloride (Sigma T5941-500G)
[0148] Sodium Chloride 5M Solution (Sigma 56546-4L)
[0149] Sodium Hydroxide 10N (JT Baker 5674-02)
[0150] E. Purification on the DEAE HiPrep 16/10 Anion Column-20 mls (GE Healthcare)
[0151] Buffer A: 50 mM Tris-HCL pH8.0
[0152] Buffer B: 50 mM Tris-HCL with 1M NaCI pH 8.0
[0153] Equilibration of column: Buffer A-5 CV, Buffer B-5 CV, Buffer A-10 CV
[0154] Load 50 ml of sample per run on 20 ml column at 2.0 mUmin (NRG-1) is in the flow through).
[0155] Wash 20 ml column with 5 CV of buffer A
[0156] 20 ml column with gradient to 100% B with 5 CV. This is to elute off contaminants.
[0157] Clean with 10 CV of 100% Buffer B.
[0158] Equilibrate with 15 CV of Buffer A
[0159] Analyze fractions with a SDS-page silver stain
[0160] Pool fractions with NRG-1 (10 kDa)
[0161] F. Concentration of NRG-1
[0162] Concentrate with Millipore Centriprep 3000 MWCO 15 ml concentrator (Ultracel YM-3, 4320)
[0163] Use Modified Lowry Protein Assay to determine concentration.
[0164] G. His-Tag Removal
[0165] Removal of the His-Tag is done with A Thrombin Cleavage Capture Kit from Novagen (Cat #69022-3). Based on previous testing the best conditions are room temp for 4 hours with Thrombin at 0.005 U of enzyme per l for every 10 g of NRG-1 protein. After four hours of incubation, add 160 of Streptavidin Agarose slurry per unit of Thrombin enzyme. Rock sample for 30 min at room temp. Recover the NRG-1 through spin-filtration or sterile filtering (depending on volume). Complete cleavage is determined with an EGF and Anti-His western.
[0166] H. Storage in Final Buffer
[0167] Stored in 1 PBS with 0.2% BSA at 4 C.
[0168] Expression and Purification of GGF2
[0169] For the cloning and background information for GGF2, see U.S. Pat. No. 5,530,109. The cell line is described in U.S. Pat. No. 6,051,401. The entire content of each of U.S. Pat. Nos. 5,530,109 and 6,051,401 is incorporated herein by reference in its entirety.
[0170] CHO-(Alpha2HSG)-GGF cell line: This cell line was designed to produce sufficient quantities of fetuin (human alpha2HSG) to support high production rates of rhGGF2 in serum free conditions.
[0171] Cho (dhfr) cells were transfected with the expression vector (pSV-AHSG) shown in
[0172] Stable and high producing cell lines were derived under standard protocols using methotrexate (100 nM, 200 nM, 400 nM, 1 M) at 4-6 weeks intervals. The cells were gradually weaned from serum containing media. Clones were isolated by standard limiting dilution methodologies. Details of the media requirements are found in the above mentioned reports.
[0173] To enhance transcription, the GGF2 coding sequence was placed after the EBV BMLF-1 intervening sequence (MIS). See
TABLE-US-00004 MISSequence (SEQIDNO:3) CGAT[AACTAGCAGCATTTCCTCCAACGAGGATCCCGCAG (GTAAGAAGCTACACCGGCCAGTGGCCGGGGCC CGATAACTAGCAGCATTTCCTCCAACGAGGATCCCGCAG(GTAAGAAGCTACACC GGCCAGTGGCCGGGGCC GTGGAGCCGGGGGCATCCGCTGCCTGAGACAGAGGTGCTCAAGGCAGTCTCCAC CTITTGTCTCCCCTCTGCAG)AGAGCCACATTCTGGAA]GTT GGF2codingsequence (SEQIDNO:4) atgagatggcqacgcgccccgcgccgctccgggcgtccc 301ggcccccgggcccagcgccccggctccgccgcccgctcgtcgccgccgctgccgctgctg 361ccactactgctgctgctggggaccgcggccctggcgccgggggcggcggccggcaacgag 421gcggctcccgcgggggcctcggtgtgctactcgtccccgcccagcgtgggatcggtgcag 481gagctagctcagcgcgccgcggtggtgatcgagggaaaggtgcacccgcagcggcggcag 541cagggggcactcgacaggaaggcggcggcggcggcgggcgaggcaggggcgtggggcggc 601gatcgcgagccgccagccgcgggcccacgggcgctggggccgcccgccgaggagccgctg 661ctcgccgccaacgggaccgtgccctcttggcccaccgccccggtgcccagcgccggcgag 721cccggggaggaggcgccctatctggtgaaggtgcaccaggtgtgggcggtgaaagccggg 781ggcttgaagaaggactcgctgctcaccgtgcgcctggggacctggggccaccccgccttc 841ccctcctgcgggaggctcaaggaggacagcaggtacatcttcttcatggagcccgacgcc 901aacagcaccagccgcgcgccggccgccttccgagcctctttcccccctctggagacgggc 961cggaacctcaagaaggaggtcagccgggtgctgtgcaagcggtgcgccttgcctccccaa 1021ttgaaagagatgaaaagccaggaatcggctgcaggttccaaactagtccttcggtgtgaa 1081accagttctgaatactcctctctcagattcaagtggttcaagaatgggaatgaattgaat 1141cgaaaaaacaaaccacaaaatatcaagatacaaaaaaagccagggaagtcagaacttcgc 1201attaacaaagcatcactggctgattctggagagtatatgtgcaaagtgatcagcaaatta 1261ggaaatgacagtgcctctgccaatatcaccatcgtggaatcaaacgctacatctacatcc 1321accactgggacaagccatcttgtaaaatgtgcggagaaggagaaaactttctgtgtgaat 1381ggaggggagtgcttcatggtgaaagacctttcaaacccctcgagatacttgtgcaagtgc 1441ccaaatgagtttactggtgatcgctgccaaaactacgtaatggccagcttctacagtacg 1501tccactccctttctgtctctgcctgaatag. GGF2ProteinSequence (SEQIDNO:5) MRWRRAPRRSGRPGPRAQRPGSAARSSPPLPLLPLLLLLGTAALPGAAAGNEAA PAGASVCYSSPPSVGSVQELAQRAAVVIEGKVHPQRRQQGALDRKAAAAAGEAGAW GGDREPPAAGPRALGPPAEEPLLAANGTVPSWPTAPVPSAGEPGEEAPYLVKVHQVWA VKAGGLKKDSLLTVRLGTWGHPAFPSCGRLKEDSRYIFFMEPDANSTSRAPAAFRASFP PLETGRNLKKEVSRVLCKRCALPPQLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWE KNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVE SNATSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQN YVMASFYSTSTPFLSLPE.
[0174] GGF2 production: One vial of GGF2 at 2.210.sup.6 cells/mL was thawed into 100 mls of Acorda Medium 1 (see Table 2) and expanded until reaching sufficient numbers to seed production vessels. Cells were inoculated into the production media Acorda Medium 2 (see Table 3) at 1.010.sup.5 cells/mL in two liter vented roller bottles. Roller bottles are maintained at 37 C. for 5 days and then reduced to 27 C. for 26 days. The roller bottles are monitored for cell count and general appearance but they are not fed. Once viability is below 10% the cells are spun out and conditioned media harvested and sterile filtered.
TABLE-US-00005 TABLE 2 Medium 1 Item Vendor Catalog Number Final concentration CD-CHO Invitrogen 10743-029 -remove 50 ml, then add components below FeSO.sub.4EDTA Sigma F-0518 1x (10 ml/L) L-Glutamine Cellgro 25-005-CI 4 mM (20 ml/L) Recombinant Sigma 1-9278 290 U/L (1 ml/L) Human Insulin Non-essential Cellgro 25-025-CI 1x (10 ml/L) amino acid Peptone Type 4 Sigma P0521 Powder - Made 20X Soybean-HySoy in CD-CHO (50 mI/L) Gentamicin Invitrogen 15750-078 100 g (2 ml/L)
TABLE-US-00006 TABLE 3 Medium 2 Item Vendor Catalog Number Final concentration CD-CHO Invitrogen 10743-029 50% (50 ml first) HyQ SFX-CHO HyClone SH30187.02 50% (50 ml first) FeSO.sub.4EDTA Sigma F-0518 1x (10 ml/L) L-Glutamine Cellgro 25-005-CI 4 mM (20 ml/L) Recombinant Sigma 1-9278 290 U/L (1 ml/L) Human Insulin Non-essential Cellgro 25-025-C1 1x (10 ml/L) amino acid Peptone Type 4 Sigma P0521 Powder - Made 20X in Soybean-HySoy CD-CHO (50 ml/L) Gentamicin Invitrogen 15750-078 100 pg (2 ml/L)
[0175] Purification Protocol for GGF2
[0176] All procedures are done at 4 C.
[0177] Chemicals: [0178] Sodium Acetate [0179] Glacial Acetic Acid (for pH adjustment) [0180] 10N NaOH (for pH adjustment) [0181] NaCl [0182] Sodium Sulfate [0183] L-Arginine (JT Baker cat #: 2066-06) [0184] Mannitol (JT Baker cat #: 2553-01) [0185] Starting material: Conditioned media supernatant. Adjust pH to 6.5.
[0186] Step 1:
[0187] Capture-Cation Exchange Chromatography [0188] HiPrep SP 16/10 (Amersham Biosciences) [0189] Column equilibration: Buffer A-SCV, buffer B-SCV, buffer 15%B-5 CV [0190] Buffer A: 20 mM NaAcetate, pH 6.0 [0191] Buffer B: 20 mM NaAcetate, pH 6.0, 1M NaCl
[0192] Load sample at 2ml/min with a continuous load overnight if possible. Binding is better with continuous loading.
[0193] Maximum capacity for a starting sample: 5 mg GGF2/ml media [0194] Flow rate: 3 ml/min [0195] First wash: 15%B, 10 CV [0196] Second wash: 35% B, 10 CV [0197] GGF2 elution: 60%B, 8 CV [0198] Column wash: 100%B, 8 CV
TABLE-US-00007 Buffers: Composition Conductivity Use 15% B 20 mM NaAcetate, pH 6.0, Preequilibration 150 mM NaCl First wash 35% B 20 mM NaAcetate, pH 6.0, Second wash 350 mM NaCl 60% B 20 mM NaAcetate, pH 6.0, GGF2 elution 600 mM NaCl 100% B 20 mM NaAcetate, pH 6.0, 88 mS/cm Column wash 1000 mM NaCl
[0199] Step 2:
Refinement-Gel Filtration Chromatography
[0200] Sephacryl 5200 26/60 [0201] Elution buffer: 20 mM NaAcetate, 100 mM Sodium Sulfate, 1% mannitol, 10 mM L-Arginine, pH 6.5 [0202] Buffer conductivity: [0203] Sample: SP GGF2 elution pool concentrated up toAU280 1.0 [0204] Flow rate: 1.3 ml/min [0205] Peak elution: at 0.36 CV from injection start
[0206] Step 3: DNA and endotoxin removal-filtration through Intercept Q membrane.
[0207] Preequilibration buffer: 20 mM NaAcetate, 100 mM Sodium Sulfate, 1% Mannitol,
[0208] 10 mM L-Arginine, pH 6.5
[0209] Collect flow through
[0210] Step 4: Final formulation and sample preparation [0211] Add additional 90 mM L-Arginine to the sample [0212] Concentrate [0213] Sterile Filter
[0214] The vehicle/control article used herein is 0.2% Bovine Serum Albumin (BSA), 0.1 M Sodium Phosphate, pH 7.6 or 0.1 M sodium phosphate, pH 7.6 as indicated.
[0215] Basic FGF:
[0216] The bFGF (PeproTech Inc., 100-18B, Lot 1206CY08 G2407) was reconstituted as directed by PeproTech to a stock solution of 0.1 mg/ml and stored at 20 C. before use. On the day of the injection, 100 g/ml of BSA (Roche Diagnostics, Lot 12403328 exp. Mar. 31, 2008) solution was made as diluent, to make a final bFGF concentration of 20 g/ml (1 g/50 ul). This material was only used in study 1.
[0217] Randomization and Blinding: Five animals were operated on per day. The investigator doing the surgery and behavioral assessments was blinded to treatment assignment of each animal (except the bFGF treated group) until all of the data were collected.
[0218] Behavioral Tests:
[0219] Sensorimotor functional activities were evaluated using forelimb and hindlimb placing, and body swing behavioral tests. These tests were performed one (1) day before surgery, one (1) day after surgery and at three (3), seven (7), fourteen (14) and twenty-one (21) days after MCAO.
[0220] 1. Limb Placing
[0221] Limb placing tests were divided into both forelimb and hindlimb tests. For the forelimb placing test, the examiner held the rat close to a tabletop and scored the rat's ability to place the forelimb on the tabletop in response to whisker, visual, tactile, or proprioceptive stimulation. Similarly, for the hindlimb placing test, the examiner assessed the rat's ability to place the hindlimb on the tabletop in response to tactile and proprioceptive stimulation. Separate sub-scores were obtained for each mode of sensory input (halfpoint designations possible), and added to give total scores (for the forelimb placing test: 0=normal, 12=maximally impaired; for the hindlimb placing test: 0=normal; 6=maximally impaired).
[0222] 2. Body Swing Test
[0223] The rat was held approximately one inch from the base of its tail. It was then elevated to an inch above a surface of a table. The rat was held in the vertical axis, defined as no more than 10 to either the left or the right side. A swing was recorded whenever the rat moved its head out of the vertical axis to either side. The rat must return to the verticalposition for the next swing to be counted. Thirty (30) total swings were counted. A normal rat typically has an equal number of swings to either side. Following focal ischemia, the rat tends to swing to the contralateral (left) side.
[0224] On all the days of the behavioral tests, animals were tested before drug administration. Time points are designated with the day of surgery (Day 0) as a reference.
[0225] Sacrifice and Infarct Volume:
[0226] Following behavioral evaluations at twenty one (21) days after MCAO, rats were deeply anesthetized with Ketamine (50-100 mg/kg) and Xylazine (5-10 mg/kg) mixture, intraperitoneally. Animals were perfused transcardially with normal saline (with heparin, 2 unit/ml) followed by 10% formalin. Brains were then removed and stored in 10% formalin. Fixed brains were then embedded with paraffin, and 5 micron coronal sections were cut using a microtome. Sections were then stained with hematoxylin and eosin (H&E). Seven sections (+4.7, +2.7, +0.7, 1.3, 3.3, 5.3 and 7.3, compared to bregma respectively) from each brain were photographed by a digital camera, and the infarct area on each slice was determined by NIH Image (Image J) using the indirect method (area of the intact contralateral [left] hemispherearea of intact regions of the ipsilateral [right] hemisphere) to correct for brain edema. Infarct areas were then summed among slices and multiplied by slice thickness to give total infarct volume, which was expressed as a percentage of intact contralateral hemispheric volume.
Example 2
Effect Of GGF2 (an NRG-1) In Enhancing Neurological Recovery In A Model Of Permanent Middle Cerebral Artery Occlusion (MCAO) In RatsTreatment Initiated During The Acute Phase And Continuing Thereafter
[0227] Effects of GGF2 and NRG-1: Functional recovery following MCA occlusion (MCAO) in rats
[0228] Study 1 Experimental groups (n=10):
[0229] NRG-1, 1.0 /kg, 1 ml/kg intravenous; 1 hr after, & once per day (q24) for 10 days after MCAO
[0230] GGF2, 6.5 g/kg, 1 ml/kg intravenous; 1 hr after, & q24 for 10 days after MCAO
[0231] GGF2, 100 g/kg, 1 ml/kg intravenous; 1 hr after, & q24 for 10 days after MCAO
[0232] bFGF, intracistemal, 1 g/50 l; Day 1 and Day 3 (positive control) after MCAO
[0233] Vehicle, 1 ml/kg intravenous; 1 hr after, & q24 for 10 days after MCAO (Vehicle=0.2% BSA/0.1 M sodium phosphate pH 7.6)
[0234] All data are expressed as meanS.E.M. Behavioral and body weight data were analyzed by repeated measures of ANOVA (treatment X time), unless otherwise specified. Positive F-values for overall ANOVAs including all groups enabled pairwise ANOVAs between groups. Infarct volume data were analyzed by one-way ANOVA.
[0235] Results:
[0236] Forelimb Placing Test:
[0237] Recovery in the GGF2, 100 g/kg group was superior to the vehicle group (p<0.001). Recovery in the bFGF group was superior to the vehicle group (p<0.05). There was no significant difference in recovery of the GGF2, 6.5 g/kg or NRG, 1.0 g/kg groups compared to the vehicle group. See
[0238] Hindlimb Placing Test:
[0239] Recovery in the bFGF and GGF2, 100 g/kg group was significantly better than the vehicle group (p<0.001) on all behavioral testing days. Recovery in the GGF2, 6.5 g/kg group and NRG, 1.0 g/kg group was significantly improved compared to vehicle on behavioral testing Days 7 and 14 but this effect was not maintained to the 21 day end point. See
Body Swing Test:
[0240] Recovery in the bFGF group and GGF2, 100 g/kg group was significantly improved compared to vehicle (p<0.05) at the behavioral testing Day 21 end point. There was no significant difference in recovery of the NRG, 1.0 g/kg group, or the GGF2, 6.5 g/kg group compared to the vehicle group. See
Weight Changes:
[0241] There were no significant differences among the groups. Infarct Volume: There were no significant differences among the groups. See Table 1 above.
[0242] Summary:
[0243] These results demonstrate that GGF2 is acting in a dose responsive manner and promotes functional recovery in this model of permanent stroke. The hindlimb data using the lower dose of neuregulin shows that continued treatment can lead to continued improvements.
Example 3
Effect of Timing of Administration (Post-Injury Delay) of Dosing of GGF2 in Enhancing Neurological Recovery in a Permanent Middle Cerebral Artery Occlusion (MCAO) in Rats including Chronic Period Dosing
[0244] Effects of GGF2 on functional recovery following MCAO in rats Experimental groups (n =10):
[0245] GGF2, 0.1 mg/kg, (1 ml/kg) intravenous; 10 daily injections, starting at Day 1 after MCAO
[0246] GGF2, 0.1 mg/kg, (1 ml/kg) intravenous; 10 daily injections, starting at Day 3 after MCAO
[0247] GGF2, 0.1 mg/kg, (1 ml/kg) intravenous; 10 daily injections, starting at Day 7 after MCAO
[0248] Vehicle, 1 ml/kg intravenous; 10 daily injections, starting at Day 1 after MCAO
[0249] (Vehicle=0.1 M sodium phosphate pH 7.6)
[0250] Animals start to receive GGF2 or vehicle intravenously at Day 1, Day 3 or Day 7 for 10 days after MCAO. All solutions were made fresh every day.
[0251] Results:
[0252] Forelimb Placing:
[0253] Recovery in the Day 1 GGF2 treatment group significantly improved compared to the vehicle group at all time points of testing after treatment (on Day 3 (p<0.0001), on Day 7 (p<0.005), on Day 14 (p<0.0001) and on Day 21 (p<0.0001)). The Day 3 GGF2 treatment group demonstrated significant improvements compared to vehicle on day 7 (p<0.05) and day 21 (p<0.05) The Day 7 GGF2 treatment group demonstrated a clear deflection in the slope of recovery compared to vehicle from Day 7 (start of treatment) to Day 14, this difference became significant by Day 21 (p<0.05). These data indicated that treatment as late as three and even 7 days after injury can produce significant improvements in neurological function. More prolonged treatment may be beneficial and result in greater and more sustained effects. See
Hindlimb Placing:
[0254] Recovery in the Day 1 GGF2 treatment group was significantly improved compared to the vehicle group at all time points of testing after treatment (on Day 3 (p<0.05) and on Days 7, 14 and 21 (p<0.0001)). The Day 3 GGF2 treatment group demonstrated improvements that were significantly better than vehicle on testing Day 7 (p<0.001) and Day 14 (p<0.05, day after treatment ended), and were trending toward significance on Day 21 (p<0.065). The Day 7 GGF2 treatment group was significantly improved compared to vehicle at the testing Day 21 end point of the study (p<0.05).
[0255] Body swing: Recovery in the Day 1 GGF2 treatment group was significantly better than the vehicle group (p<0.001). There was a trend toward recovery in the Day 3 GGF2 group and Day 7 GGF2 group, compared to the vehicle group
[0256] There were no significant differences in body weights between the groups.
[0257] Infarct Volume: There were no significant differences among all groups as shown in Table 4. Table 4:
TABLE-US-00008 Group % Infarct volume Day 1 Vehicle 32.89 2.63 GGF2 Day 1 27.62 2.48 GGF2 Day 3 33.31 3.84 GGF2 Day 7 27.30 2.87
Summary:
[0258] By the Day 21 study endpoint it was found that treatment initiated on Day I, Day 3 or Day 7 post MCAO resulted in significant improvements in forelimb function compared to vehicle treated animals. Treatment initiated on Day 1, Day 3 or Day 7 post MCAO resulted in significant improvements in hindlimb function compared to vehicle treatment during specific behavioral testing points that correlated with treatment time, indicating that continued treatment may prove beneficial Functional recovery with interventions given at this later time points post injury eliminates the possibility that the effect is due to acute neuroprotection. Indeed, this data coupled with the lack of a significant change in infarct volume demonstrates that the improvements are due to the promotion of neurorecovery with GGF2 treatment. This shows that a long temporal window exists (post-acute and post-semi acute) during which time GGF2 may be administered as an effective therapeutic for the chronic phase of stroke
[0259] It is, noteworthy that the significant (under ANOVA statistics) improvements observed following GGF2 administration at 3 and 7 days post-MCAO represent a dramatic expansion in the therapeutic window offered by previously available strategies for treatment of acute phase stroke. For the first time in the art, the data presented herein demonstrated that GGF2 administration is efficacious even during the chronic phase of stroke. The data presented herein further suggest that GGF2 contributes to neurorecovery following neuroinjury.
Example 4
Treatment of Ischemic Stroke
[0260] A patient presents to a medical facility with signs and symptoms of an ischemic stroke. The patient is revascularized with tPA or other therapy to restore blood flow. Although blood flow has been restored, some level of brain injury has occurred. Three days after the injury the patient is assessed neurologically and shown to have measurable sensory and/or motor deficits. Beginning on day four, after day two and after day 3, this patient would is treated with neuregulin at a dose between 0.01 and 1.0 mg/kg per dose, intravenously for 10 days to 3 months. The patient successfully regains sensory and motor function without the concomitant use of Occupational or Physical Therapy. This recovery is better than would have been clinically predicted without neuregulin therapy. This recovery is better than would have been clinically predicted without use of Occupational or Physical Therapy.
Example 5
Treatment Of Stroke And Resulting Paralysis of the Right Hand
[0261] A patient presents to the Emergency Department with paralysis of the right hand. Following evaluation and imaging it is determined that the patient has suffered an ischemic stroke. The patient receives tPA according to approved methods, and blood flow is restored through the thrombosis. However, a week after tPA treatment, the patient has residual paralysis of the right hand as measured by standard neurological measures of hand motor activity. This patient is treated with neuregulin (0.01 to 1.0 mg/kg, IV) once per week for 4 weeks. Improvement in hand function is measured periodically by a neurologist or other physician with standard neurological testing including dynamometer and other strength testing. The patient successfully regains sensory and motor function in their right hand without the concomitant use of Occupational or Physical Therapy. This recovery is better than would have been clinically predicted without neuregulin therapy. This recovery is better than would have been clinically predicted without use of Occupational or Physical Therapy.
Example 6
Treatment of Ischemic Stroke
[0262] A patient presents to a medical facility with signs and symptoms of an ischemic stroke. They are found to have paralysis of their left side. The patient does not arrive in time for revascularization therapy with. Upon clinical evaluation it is found that some brain injury has occurred. Three days after the injury the patient is assessed neurologically and shown to have measurable sensory and motor deficits. This patient is treated with neuregulin at a dose between 0.01 and 1.0 mg/kg per dose, intravenously each day for four weeks; thereafter they receive weekly doses for six months. They also receive physical therapy. Improvement is noticed as early as the second week of treatment; recovery continues throughout the period of neuregulin therapy. The patient successfully regains sensory and motor function of their left side. This recovery is seen as excellent; and is much better than would have been clinically predicted without with the use of Physical Therapy alone.
Example 7
Treatment of Ischemic Stroke
[0263] A patient presents to the Emergency Department with paralysis of the left hand. The patient reports that the problem with their hand began over a week ago. Following evaluation and imaging it is determined that the patient has suffered an ischemic stroke. The patient does not receive tPA. Upon neurological exam it is found that The patient has residual paralysis of the left hand as measured by standard neurological measures of hand motor activity; the patient has a sensory deficit as well. The patient refuses to participate in physical or occupational therapy. This patient treated with neuregulin (0.01 to 1.0 mg/kg, IV) once per week for 12 weeks. Improvement in hand function is measured periodically by a neurologist or other physician with the standard neurological testing including dynamometer and other strength testing. Improvement is noticed as early as the second week of treatment; recovery continues throughout the period of neuregulin therapy. The patient successfully regains sensory and motor function in their left hand without the concomitant use of Occupational or Physical Therapy. This recovery is better than would have been clinically predicted without neuregulin therapy. This recovery is better than would have been clinically predicted without use of Occupational or Physical Therapy.
Example 8
Traumatic Brain Injury
[0264] A patient presents to a medical facility following a traumatic event with signs and symptoms of a head injury and resultant brain injury. Some level of brain injury has occurred as assessed by imaging and neurological testing including Glasgow Coma Scale and more detailed neurocognitive testing. Five days after the injury, the patient is assessed neurologically and shown to have measurable sensory and motor deficits. This patient is treated with neuregulin at a dose between 0.01 and 1.0 mg/kg per dose, intravenously for 3 months. Initially the patient is not willing to participate in physical therapy. Improvement in brain function is noticed as early as the first week of treatment; recovery continues throughout the period of neuregulin therapy. This recovery is better than would have been clinically predicted without neuregulin therapy. Beginning at three months the patient begins to receive neuregulin once per week, and they also begin to receive physical therapy. The concomitant therapies continue for up until one year from the day of original injury. On the anniversary of the patient's injury their recover is extraordinary. Clinically is it far better than would have been anticipated in the absence of any therapy and is also better than would have been expected from the use of physical therapy.
Example 9
Treatment of Cerebral Hemorrhage
[0265] A patient presents to a medical facility with signs and symptoms consistent with an ischemic stroke or cerebral hemorrhage. The patient is stabilized. Upon neurological assessment it is found that some level of brain injury has occurred. One week after the injury the patient is again assessed neurologically and shown to have measurable sensory and/or motor deficits. This patient is treated with neuregulin at a dose between 0.01 and 1.0 mg/kg daily, intravenously for 10 days, followed by administration of this dose weekly for 2 months, at which point all treatment is discontinued. Improvement in brain function is noticed as early as the first week of treatment; recovery continues throughout the period of neuregulin therapy. Upon cessation of neuregulin therapy the patients recover is deemed clinically excellent. The patient returns for evaluation six months and then 12 months from the date of the initial injury; at each assessment the patient's recovery is deemed clinically excellent.
Example 10
NRG Treatment of Injury including Treatment in Semi-Acute and Chronic Periods
[0266] For a comprehensive trial, inclusion criteria include: adults, male and female, with clinical evidence of neuronjury.
[0267] Indications Explored:
[0268] Ischemic stroke with thrombolytics,
[0269] Ischemic stroke without thrombolytics,
[0270] Hemorrhagic stroke,
[0271] Closed head traumatic brain injury,
[0272] Penetrating traumatic brain injury
[0273] Dose Ranges Explored:
[0274] 0.001mg/kg to 10.0 mg/kg per dose
[0275] Dose Frequencies Explored:
[0276] daily
[0277] on alternate days
[0278] every fourth day
[0279] once per week
[0280] once every other week
[0281] once per month
[0282] Mixed Periodicity Regimens: [0283] daily for one or two weeks and then weekly, biweekly, or monthly for the remainder of the study [0284] on alternate days for one or two weeks and then weekly, biweekly or monthly thereafter
[0285] Initiation of Treatment Explored:
[0286] As soon as possible after injury
[0287] Within 6, 12, 24 and 48 hours after injury
[0288] After 72 hours following injury
[0289] 7, 14, 30, 60, 90, 120 days following injury
[0290] Treatment Duration Explored:
[0291] treatment for 1, 2, 4, 10, 30 weeks.
[0292] treatment for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months
[0293] Function Explored:
[0294] hand motor function, face motor function, speech
[0295] cognitive function survival
[0296] time to return to work
[0297] Recovery is measured by standard neurological measures.
[0298] Adverse Events are mild and well-tolerated.
[0299] Results: Patients treated with neuregulin show statistically greater improvement in mental, sensory or muscle function as measured by methodologies known in the art, as compared to those patients treated with placebo.
[0300] In alternative embodiments combinations less than all of the above parameters are explored.
Example 11
NRG Treatment of Ischemic Stroke with Unilateral Hand Weakness and/or Paralysis (Without Thrombolysis)
[0301] Inclusion criteria include: adults, male and female, evidence of stroke based on loss of consciousness, disorientation, speech difficulty, facial or limb paralysis. Ischemic stroke confirmed with radiographic imaging.
[0302] Patients are selected for those with unilateral hand weakness and/or paralysis that are not candidates for tPA (or other thrombolytic) or who did not previously receive tPA for any reason. Consents are obtained from the patients and/or someone with authority to sign for the patients.
[0303] Patients are enrolled and randomized to receive neuregulin or placebo starting as soon as they present to a medical facility including hospital or physician's office, diagnosis, imaging is obtained.
[0304] For this trial, treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0305] Recovery is measured by standard neurological measures of hand motor activity every other week for the duration of the study.
[0306] Adverse Events are mild and well-tolerated.
[0307] Results: Patients treated with neuregulin show statistically greater improvement in hand function as measured by methodologies known in the art, as compared to those patients treated with placebo.
Example 12
NRG Treatment of Unilateral Facial Paralysis Without Thrombolytics
[0308] Patients are selected for those with unilateral facial paralysis who did not or cannot receive thrombolytics. Function is assessed by methodologies known in the art, on alternate weeks during the 3 month dosing period. Consents are obtained from the patients and/or someone with authority to sign for the patients.
[0309] Patients are enrolled and randomized to receive neuregulin or placebo. Treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0310] Adverse Events are mild and well-tolerated.
[0311] Results: Patients treated with neuregulin show statistically greater improvement in facial movement than those patients treated with placebo.
Example 13
NRG Treatment of Aphasia or Dysarthria Without Thrombolytics
[0312] Patients are selected for those with aphasia or dysarthria who did not or cannot receive thrombolytics. Function is assessed by methodologies known in the art. on alternate weeks during the 3 month dosing period. Consents are obtained from the patients and/or someone with authority to sign for the patients.
[0313] Patients are enrolled and randomized to receive neuregulin or placebo. Treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0314] Adverse Events are mild and well-tolerated.
[0315] Results: Patients treated with neuregulin show statistically greater improvement in speech capability than those patients treated with placebo.
Example 14
NRG Treatment of Ischemic Stroke (with Thrombolysis)
[0316] Inclusion criteria include: adults, male and female, evidence of stroke based on loss of consciousness, disorientation, speech difficulty, facial or limb paralysis. Ischemic stroke is confirmed with radiographic imaging.
[0317] Patients are selected for those with unilateral hand weakness and/or paralysis that and are successfully treated with tPA or other thrombolytic. Consents are obtained from the patients and/or someone with authority to sign for the patients
[0318] Patients are enrolled and randomized to receive neuregulin or placebo starting as soon as they present to a medical facility, diagnosis, and imaging is completed.
[0319] Treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0320] Recovery is measured by standard neurological measures of hand motor activity every other week for the duration of the study.
[0321] Adverse Events are generally mild and well tolerated.
[0322] Results: Patients treated with neuregulin show statistically greater improvement in hand function as measured by methodologies known in the art as compared to those patients treated with placebo.
Example 15
NRG Treatment of Patients with Unilateral Facial Paralysis (With Thrombolytics)
[0323] Inclusion criteria include: adults, male and female, evidence of stroke based on loss of consciousness, disorientation, speech difficulty, facial or limb paralysis. Ischemic stroke is confirmed with radiographic imaging. Patients are selected for those with aphasia or dysarthria and did receive thrombolytics.
[0324] Treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0325] Function is assessed by methodologies known in the art, on alternate weeks during the 3 month dosing period.
[0326] Adverse Events are mild and well-tolerated.
[0327] Results: Patients treated with neuregulin show statistically greater improvement in speech capability than those patients treated with placebo.
Example 16
NRG Treatment of Patients with Traumatic Brain Injury
[0328] Inclusion criteria include: adults, male and female, evidence of traumatic brain injury with loss of consciousness, disorientation, speech difficulty, facial or limb paralysis with evidence or history of trauma. Patients with evidence of penetrating injury are excluded. Consents are obtained from the patients and/or someone with authority to sign for the patients.
[0329] Patients are enrolled and randomized to receive neuregulin or placebo starting as soon as they present to a medical facility including hospital or physician's office, diagnosis, imaging and consent is obtained.
[0330] For this trial treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0331] Functional recovery is assessed by methodologies known in the art.
[0332] Adverse Events are mild and well-tolerated.
[0333] Results: Patients treated with neuregulin show statistically greater improvement than those patients treated with placebo.
Example 17
NRG Treatment Of Patients With Penetrating Brain Injury
[0334] Inclusion criteria include: adults, male and female, evidence of traumatic brain injury with loss of consciousness, disorientation, speech difficulty, facial or limb paralysis with evidence or history of trauma. Consents are obtained from the patients and/or someone with authority to sign for the patients.
[0335] Patients are stabilized surgically or through other measures. Diagnosis and imaging are obtained.
[0336] Patients are enrolled and randomized to receive neuregulin or placebo starting as soon as they present to a medical facility including hospital or physician's office.
[0337] Treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0338] Functional recovery is assessed by methodologies known in the art.
[0339] Adverse Events are mild and well-tolerated.
[0340] Results: Patients treated with neuregulin show statistically greater improvement in speech capability than those patients treated with placebo.
Example 18
NRG Treatment of Patients with Hemorrhagic Stroke
[0341] Inclusion criteria include: adults, male and female, evidence of stroke based on loss of consciousness, disorientation, speech difficulty, facial or limb paralysis. Hemorrhagic stroke confirmed with radiographic imaging. Consents are obtained from the patients and/or someone with authority to sign for the patients.
[0342] Patients are selected for those with unilateral hand weakness
[0343] Patients are enrolled and randomized to receive neuregulin or placebo starting as soon as they present to a medical facility including hospital or physician's office, diagnosis, imaging and consent is obtained.
[0344] Treatment is initiated between 1 hour and 7 days after injury. Treatment is continued for 3 months with dosing on alternate days for 1 week and then weekly for the remainder of the treatment period. Patients are dosed with 0.0001 to 1.0 mg per kg, IV, IM or SC.
[0345] Recovery is measured by standard neurological measures of hand motor activity every other week for the duration of the study.
[0346] Adverse Events are mild and well-tolerated.
[0347] Results: Patients treated with neuregulin show statistically greater improvement in hand function as measured by methodologies known in the art as compared to those patients treated with placebo.
Example 19
Kits
[0348] Kits comprise an exemplary embodiment of the invention. The kit can comprise an outer receptacle or container configured to receive one or more inner receptacles/containers, utensils and/or instructions. The utensil can comprise item(s) to administer the drug, such as a patch, inhalation apparatus, syringe or needle. A composition of the invention can be comprised within a receptacle of the invention. A receptacle of the invention can contain sufficient quantity of a composition of the invention to be useful for multiple doses, or may be in unit or single dose form. Kits of the invention generally comprise instructions for administration in accordance with the present invention. Any mode of administration set forth or supported herein can constitute some portion of the instructions. In one embodiment the instructions indicate that the composition of the invention is to be taken one or more than one times during the semi-acute post-injury period. In one embodiment the instructions indicate that the composition of the invention is to be taken one or more than one times during the chronic post-injury period. The instructions may be affixed to any container/receptacle of the invention. Alternatively, the instructions can be printed on or embossed in or formed as a component of a receptacle of the invention.
[0349] Several publications and patent documents are referenced in this application in order to more fully describe the state of the art to which this invention pertains. All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each independent publication or patent application was specifically and individually indicated to be incorporated by reference.