Methods for promoting neuronal outgrowth by insulin-like growth factor binding protein-like 1 (IGFBPL-1) in glaucoma or leber's optic neuropathy
10842849 ยท 2020-11-24
Assignee
Inventors
Cpc classification
A61K48/00
HUMAN NECESSITIES
A61K31/713
HUMAN NECESSITIES
A61K31/7004
HUMAN NECESSITIES
A61K31/7105
HUMAN NECESSITIES
A61K31/711
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K38/2278
HUMAN NECESSITIES
A61K31/00
HUMAN NECESSITIES
A61K31/708
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K38/2278
HUMAN NECESSITIES
C12N5/0621
CHEMISTRY; METALLURGY
A61K31/7088
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K31/708
HUMAN NECESSITIES
A61K31/7004
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K35/30
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
A61K38/30
HUMAN NECESSITIES
A61K31/352
HUMAN NECESSITIES
A61K38/30
HUMAN NECESSITIES
International classification
A61K45/06
HUMAN NECESSITIES
C07K14/00
CHEMISTRY; METALLURGY
A61K31/7004
HUMAN NECESSITIES
A61K31/7088
HUMAN NECESSITIES
A61K31/708
HUMAN NECESSITIES
A61K31/711
HUMAN NECESSITIES
A61K31/7105
HUMAN NECESSITIES
A61K31/00
HUMAN NECESSITIES
A61K31/713
HUMAN NECESSITIES
A61K38/30
HUMAN NECESSITIES
Abstract
Disclosed is a method of promoting neuronal growth by administering IGFBPL-1, or an agent that increases or stabilizes IGFBPL-1 activity to a subject in need thereof, e.g., a subject in need of treating optic nerve degeneration.
Claims
1. A method of promoting neurite outgrowth or nerve axon growth in a subject suffering from optic nerve damage or an injury associated with an optic nerve neuron, a retinal ganglion cell or a retinal neuron caused by glaucoma or Leber's optic neuropathy, said method comprising identifying a subject suffering from said optic nerve damage caused by glaucoma or Leber's optic neuropathy, contacting an optic nerve neuron, a retinal ganglion cell, or a retinal neuron via intravitreal administration with an effective amount of an agent that increases insulin-like growth factor binding protein-like 1 (IGFBPL-1) levels or activity, wherein said agent comprises a IGFBPL-1 protein, said IGFBPL-1 protein comprising the amino acid sequence of SEQ ID NO: 2, thereby promoting outgrowth of the neuron, and wherein said subject comprises a neuronal injury of said optic nerve neuron, said retinal ganglion cell, or said retinal neuron and wherein said neuronal injury is caused by glaucoma or Leber's optic neuropathy, and wherein said method promotes neurite outgrowth or nerve axon growth in said subject suffering from said optic nerve damage or said injury associated with the optic nerve neuron, a retinal ganglion cell or a retinal neuron caused by glaucoma or Leber's optic neuropathy.
2. The method of claim 1, wherein the optic nerve neuron is an injured neuron, and injury to the optic nerve neuron is the result of said glaucoma, wherein said glaucoma is angle-closure glaucoma, open-angle glaucoma, secondary glaucoma, or congenital glaucoma.
3. The method of claim 1, further comprising contacting the neuron with D-mannose.
4. The method of claim 1, further comprising contacting the neuron with a cAMP activator.
5. The method of claim 4, wherein cAMP activator is non-hydrolyzable cAMP analogues, adenylate cyclase activators, calcium ionophores, phosphodiesterase inhibitors, specific phosphodiesterase IV inhibitors, beta2-adrenoreceptor inhibitors or vasoactive intestinal peptide.
6. The method of claim 1, further comprising contacting the neuron with oncomodulin.
7. The method of claim 1, further comprising contacting the neuron with TGF-.
8. The method of claim 1, further comprising administering insulin-like growth factor 1 (IGF-1).
9. A method of reducing severity of a disorder or condition in a subject associated with injury to an optic nerve neuron, a retinal ganglion cell, or a retinal neuron comprising, identifying a subject suffering from optic nerve damage, and administering via intravitreal administration a therapeutically effective amount of an agent that increases IGFBPL-1 activity to the subject sufficient to promote nerve fiber outgrowth in the subject, wherein the agent is IGFBPL-1 protein, and wherein said subject comprises a neuronal injury of said optic nerve neuron, said retinal ganglion cell, or said retinal neuron and wherein said neuronal injury is caused by glaucoma or Leber's optic neuropathy.
10. A method of reducing severity of a neuronal injury in a subject comprising identifying a subject suffering from optic nerve damage, and administering via intravitreal administration a therapeutically effective amount of an agent that increases IGFBPL-1 activity to the subject sufficient to promote nerve fiber outgrowth in the subject, wherein the agent comprises IGFBPL-1 protein, and wherein said subject comprises a neuronal injury of an optic nerve neuron, an retinal ganglion cell, or an retinal neuron and wherein said neuronal injury is caused by glaucoma or Leber's optic neuropathy.
11. The method of claim 10, wherein said neuron comprises a break in an axon or dendrite.
12. The method of claim 9 or 10, further comprising administering IGF-1.
13. The method of claim 1, 9, or 10, wherein said subject is a post-natal or adult subject.
14. A method of promoting nerve axon growth in a subject, said method comprising identifying a subject suffering from optic nerve damage, contacting an optic nerve neuron, a retinal ganglion cell, or a retinal neuron via intravitreal administration with an effective amount of an agent that increases insulin-like growth factor binding protein-like 1 (IGFBPL-1) levels or activity, wherein said agent comprises a IGFPBL-1 protein, which IGFBPL-1 protein comprises the amino acid sequence of SEQ ID NO:2, thereby promoting nerve axon outgrowth of the optic nerve, wherein said subject comprises neuronal injury associated with caused by glaucoma or Leber's optic neuropathy.
15. The method of claim 14, further comprising administering IGF-1.
16. The method of claim 14, wherein said subject is a post-natal or adult subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
DETAILED DESCRIPTION OF THE INVENTION
(17) Retinal ganglion cell death and optic nerve degeneration caused by trauma, ischemia and diseases is currently an irreversible process that eventually leads to blindness. A number of cell-autonomous factors, such as Bcl-2, cAMP (cyclic adenosine 3,5-monophosphate) and CREB (cAMP response element-finding protein), PTEN (phosphatase and tensin homolog), suppressor of cytokine signaling 3 (SOCS3), KLF4 (Kruppel-ike factor 4a negative regulator) and IGF-1 play roles in the developmental loss of RGC axon regeneration. However, manipulating Bcl-2 and/or other intracellular regulators of axon growth, even when simultaneously overcoming environmental inhibition, only partially restores the growth capacity of RGC axons, hence limiting neuroprotection and repair after injury. Described herein is the identification of additional axon growth regulators. The results demonstrate that IGFBPL-1 has potent efficacy in promoting RGC survival and axon regeneration post-natally, and serves as a key regulator on axon growth capacity during pre-natal development.
(18) The invention is based on studies showing that expression of IGFBPL1 is restricted to the RGC layer in the retina with a transient high expression at E16-E18 and is largely down-regulated postnatally. Addition of IGFBPL1 alone or together with IGF-I in P0 RGC cultures significantly promoted axonal extension. Knock down IGFBPL1 signaling abolishes axonal growth activity in RGCs without significantly altering the survival and number of RGCs. The results presented herein demonstrate a utility for IGFBPL1 as an important regulator of RGC axonal growth during retinal development, functioning by facilitating the IGF-I signaling pathway and to promote RGC axon growth, protection, regeneration and/or repair. As described herein, IGF-1 compositions, or compounds that increase the activity or stability of IGF-1, are useful for treating ocular conditions or disease such as glaucoma, optic nerve injury, as well as central nervous system (CNS) pathologies such as traumatic brain-related injury, spinal cord injury, multiple sclerosis, Alzheimer's disease, and Parkinson's disease. In some embodiments, administration of IGFBPL1 results in increased axonal growth in the eye, optic nerve regeneration, and/or improvement in vision.
(19) Representative disease or conditions that benefit from this treatment include, e.g., neurodegenerative disorders in the brain and eye. Thus, the methods are used for neuroprotective and regenerative therapy for neural injury and neural development. Such disorders include optic nerve trauma, ischemia, optic neuritis, glaucoma, macular degeneration, retinitis pigmentosa; spinal cord injury, stroke, amyotrophic lateral sclerosis, Alzheimer's disease, Huntington's disease, Parkinson's disease.
(20) In general, ocular, CNS, and PNS disorders or injuries are identified using methods known in the art. For example, a subject with Alzheimer's disease is identified by observing symptoms such as difficulty performing tasks that take some thought, but used to come easily, such as balancing a checkbook, playing complex games (such as bridge); learning new information or routines; getting lost on familiar routes; language problems, such as trouble finding the name of familiar objects; losing interest in things previously enjoyed; flat mood; misplacing items; personality changes and loss of social skills. Alzheimer's disease is also described in Dubois et al., 2007 Lancet Neurol, August; 6(8):734-46, incorporated herein by reference.
(21) A subject with traumatic brain injury (TBI; e.g., blast-related TBI) is identified, e.g., by utilizing the Glasgow Coma Scale for Diagnosing Traumatic Brain Injury (i.e., evaluation of motor response, verbal response, and eye opening) and/or the Ranchos Los Amigos Scale for Diagnosing Traumatic Brain Injury (i.e., the varying levels of response and cognition). Each patient with TBI presents with different symptoms. Thus, the treatment for TBI varies based on the needs of the patient. Various treatments for traumatic brain injury include speech therapy, physical therapy, occupational therapy, and therapeutic recreation. TBI is also described in Kubal W S, 2012 Radiol Clin North Am, January; 50(1):15-41, incorporated herein by reference.
(22) A subject with glaucoma is identified by, e.g., measuring intraocular pressure, determining the presence of optic nerve damage, performing a visual field test to determine if the visual field is affected, and by measuring corneal thickness. To distinguish between open-angle glaucoma and angle-closure glaucoma, a physician may use a technique called gonioscopy in which a special lens is placed on the eye to inspect the drainage angle. Another test, tonography, measures how quickly fluid drains from the eye. Glaucoma is also described in Tamide et al., 2011 Can J Ophthalmol, February; 46(1):89-90, incorporated herein by reference.
(23) A subject with Huntington disease is identified by observing various symptoms (e.g., dementia, abnormal movements, abnormal reflexes, prancing and wide walk, and hesitant speech or poor enunciation), and is confirmed with a cranial computed tomography (CT) scan, a cranial magnetic resonance imaging scan, or a positron emission tomography scan of the brain. Huntington disease is also described in Novak et al., 2011 Int Rev Neurobiol, 98:297-323, incorporated herein by reference.
(24) Any agent that specifically increases the amount or activity of polypeptide can be used in the invention. Accordingly, in some cases, IGFBPL-1 polypeptide is used. Alternatively, a nucleic acid encoding an IGFBPL-1 polypeptide is used. The agent stabilizes an IGFPL-1 polypeptide or nucleic acid, or alternatively stabilizes a complex of a IGFBPL-1 and IGF-1 polypeptide.
(25) The agent is provided in composition as, e.g., a solid, a paste, an ointment, gel, a liquid, an aerosol, a mist, a polymer, a film, an emulsion, or a suspension. The composition is optionally administered topically. Preferably, the methods described herein do not include systemic administration or substantial dissemination to non-ocular tissue.
(26) In some cases, the composition further includes a compound selected from the group consisting of a physiological acceptable salt, poloxamer analogs with carbopol, carbopol/HPMC, carbopol-methyl cellulose, a mucolytic agent, carboxymethylcellulose (CMC), hyaluronic acid, cyclodextrin, and petroleum. An exemplary mucolytic agent is N-acetyl cysteine. Preferably, the composition further includes carboxymethylcellulose (CMC).
(27) Alternatively, or in addition, a composition of the above methods includes oligonucleotide containing a fragment of IGFBPL-1 mRNA Or cDNA, a morpholino antisense oligonucleotide, micron NA (miRNA), short hairpin RNA (shRNA), or short interfering RNA (siRNA) of a IGFBPL1 nucleic acid.
(28) The sequences of full length human IGFBPL-1 and IGF-1 are provided below. However, the invention also comprises polypeptides and nucleic acid fragments, so long as they exhibit the desired biological activity (i.e., neuronal outgrowth promoting activity) of the full length polypeptides and nucleic acid, respectively. A nucleic acid fragment of almost any length is employed. For example, illustrative polynucleotide segments with total lengths of about 10,000, about 5000, about 3000, about 2,000, about 1,000, about 500, about 200, about 100, about 50 base pairs in length (including all intermediate lengths) are included in many implementations of this invention. Similarly, a polypeptide fragment of almost any length is employed. For example, illustrative polypeptide segments with total lengths of about 10,000, about 5,000, about 3,000, about 2,000, about 1,000, about 5,000, about 1,000, about 500, about 200, about 100, or about 50 amino acids in length (including all intermediate lengths) are included in many implementations of this invention.
(29) The sequence of IGFBPL-1 (Insulin-like growth factor-binding protein-like 1 precursor sequence [Homo sapiens]) is provided below (SEQ ID NO: 1; Genbank Accession Number NM_001007563.1 (GI:56090547), incorporates herein by reference). The starting atg is underlined.
(30) TABLE-US-00001 1ccgccgctgtcccggagcaagccatgccgcgcttgtctctgctcttgccgctgctgcttc 61tgctgctgctgccgctgctgccgccgctgtccccgagccttgggatccgcgacgtgggcg 121gccggcgccccaagtgtggtccgtgccggccagagggctgcccggcgcctgcgccctgcc 181cggcgcccgggatctcggcgctcgacgagtgcggctgctgcgcccgctgcctgggagccg 241agggcgcgagctgcgggggccgcgccggcgggcgctgtggccccggcctggtatgcgcga 301gccaggccgctggggcagcgcccgagggcaccgggctctgcgtgtgcgcgcagcgcggca 361ccgtctgcggctccgacggtcgctcgtaccccagcgtctgcgcgctgcgcctgcgcgctc 421ggcacacgccccgcgcgcaccccggtcacctgcacaaggcgcgcgacggcccttgcgagt 481tcgctcctgtggtcgtcgttcctccccgaagtgttcacaacgtcaccggggcgcaggtgg 541gcctgtcctgtgaagtgagggctgtgcctaccccagtcatcacgtggagaaaggtcacga 601agtcccctgagggcacccaagcactggaggagctgcctggggaccatgtcaatatagctg 661tccaagtgcgagggggcccttctgaccatgaggccacggcctggattttgatcaaccccc 721tgcgaaaggaggatgagggtgtgtaccagtgccatgcagccaacatggtgggagaggctg 781agtcccacagcacagtgacggttctagatctgagtaaatacaggagcttccacttcccag 841ctcccgatgaccgcatgtgatggagaaatggtcttagaaacattgatcatgggatgatgg 901aaaagtcaaataacggatctttgtgcttcatgaagagttggaaaacctgtgtgtgtagat 961gaccccttttgtgtgtttttaaaaattagatgcaaactagatctgtatgcagatgtagtt 1021tttagcagggcaaacagtgagaaacggatttgcatgtggcttttttatacttttgaaatg 1081aattgttccatga
(31) The amino acid sequence of a polypeptide encoded by human IGFBPL-1 nucleic acid is provided below (SEQ ID NO: 2; GenBank Accession Number NP_001007564.1 (GI:56090548), incorporated herein by reference).
(32) TABLE-US-00002 MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAP APCPAPGISALDECGCCARCLGAEGASCGGRAGGRCGPGLVCASQAAGA APEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHPGHLHKAR DGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPE GTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHA ANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM
(33) The nucleic acid sequence of human Insulin Growtn Factor-1 (IGF-1) provided below (SEQ ID NO: 3; GenBank Accession Number X00173.1 (GI:33015), incorporated herein by reference). The starting atg is underlined.
(34) TABLE-US-00003 1cttcagaagcaatgggaaaaatcagcagtcttccaacccaattatttaagtgctgctttt 61gtgatttcttgaaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgc 121tgtgcctgctcaccttcaccagctctgccacggctggaccggagacgctctgcggggctg 181agctggtggatgctcttcagttcgtgtgtggagacaggggcttttatttcaacaagccca 241cagggtatggctccagcagtcggagggcgcctcagacaggtatcgtggatgagtgctgct 301tccggagctgtgatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagt 361cagctcgctctgtccgtgcccagcgccacaccgacatgcccaagacccagaaggaagtac 421atttgaagaacgcaagtagagggagtgcaggaaacaagaactacaggatgtaggaagacc 481ctcctgaggagtgaagagtgacatgccaccgcaggatcctttgctctgcacgagttacct 541gttaaactttggaacacctaccaaaaaataagtttgataacatttaaaagatgggcgttt 601cccccaatgaaatacacaagtaaacattccaacattgtctttaggagtgatttgcacctt 661gcaaaaatggtcctggagttggtagattgctgttgatcttttatcaataatgttctatag 721aaaag
(35) The amino acid sequence of a human IGF-1 polypeptide according to the invention is below: (SEQ ID NO: 4; GenBank Accession Number CAA24998.1 (GI:33016), incorporated herein by reference).
(36) TABLE-US-00004 MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAG PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAG NKNYRM
(37) The contacting of a neuronal cell with the agent that increases IGFBPL1 activity or levels to the neuron occurs either in vivo or in vitro. The neuron is contacted with an agent that increases IGFBPL1 activity or levels under conditions appropriate for growth and/or maintenance of the neuron (e.g. the environment of the neuron provides the appropriate nutrients, temperature, etc.). An effective amount is an amount which delivers sufficient an agent that increases IGFBPL1 activity or levels to the target neuron(s), neural progenitor cells, or stem cells to produce a detectable, amount of nerve fiber outgrowth or generate new neurons which extend new nerve fibers. Detection can be by physical examination of the neuron(s) or by functional analysis as described herein.
(38) Contacting in vitro is often carried out by including the agent in the media in which the cells or tissue are grown. Contacting in vivo is generally achieved by administration of an agent that increases IGFBL-1 activity or levels to a subject in which the target neuron(s) or cell(s) resides. One of skill in the art will recognize that the effective amount for in vivo contact may require a higher dose of administration to result in a sufficient amount of an agent that increases IGFBL-1 activity or levels reaching the target neuron.
(39) As the term is used herein, a target neuron is a neuron in which outgrowth is desired. The agent that increases IGFBL-1 activity or levels is directed toward, and ultimately contacts the target neuron, thereby producing outgrowth.
(40) As used herein, the term nerve fiber outgrowth refers to the process by which axons and/or dendrites grow out of a neuron. The outgrowth can result in a totally new axon, increased growth of an already extended axon, or the repair of a partially damaged axon. Outgrowth is typically evidenced by extension of an axonal process of at least 2 cell diameters in length.
(41) As used herein, the language inducing the outgrowth of nerve fibers is intended to include the capacity to stimulate outgrowth of nerves to various levels, e.g., to levels which allow for the treatment of targeted neuronal injuries.
(42) Types of Neurons
(43) The neurons are optionally mammalian neurons, for example, neurons from a primate (e.g., human neurons). Other examples of mammalian neurons include those from animals typically kept as pets (e.g., dogs, cats, birds, horses), farm animals (e.g., goats, pigs, cows, horses, sheep, poultry fowl), and exotic animals or zoo animals. Preferably, the neuron is not a rabbit neuron.
(44) One or more central nervous system (CNS) neurons are optionally contacted with an agent that increases IGFBL-1 activity or levels. In some cases, the CNS neuron is unresponsive to nerve growth factor (NGF). In some cases, the term CNS neuron is not intended to include support or protection cells such as astrocytes, oligodentrocytes, microglia, ependyma and the like, nor is it intended to include peripheral nervous system (e.g., somatic, autonomic, sympathetic or parasympathetic nervous system) neurons. Although, as described herein, these cells are also contacted with an agent that increases IGFBL-1 activity or levels.
(45) Alternatively, one or more peripheral nervous system neurons are contacted with an agent that increases IGFBL-1 activity or levels. As used herein, the term PNS (peripheral nervous system) neurons is intended to include the neurons commonly understood as categorized in the peripheral nervous system, including sensory neurons and motor neurons. In some cases, the term PNS neuron is not intended to include support or protection cells such as Schwann cells and macrophages, nor is it intended to include CNS nervous system neurons. Although, as described herein, these cells are also contacted with an agent that increases IGFBL-1 activity or levels.
(46) In some examples, the neuron which is contacted is injured prior to the contact (herein referred to as an injured neuron). For example, the neuron is an optic nerve neuron or a retinal neuron.
(47) Treatment Methods
(48) Methods for treatment/treating of a subject with an injured neuron is carried out by administration of an agent that increases IGFBL-1 activity or levels to the subject with the injured or diseased neuron. Administration is performed to promote contact of an effective amount of the administered an agent that increases IGFBL-1 activity or levels to the injured neuron within the subject. A therapeutically effective amount of an agent that increases IGFBL-1 activity or levels or pharmaceutical composition containing an agent that increases IGFBL-1 activity or levels is administered to the subject. The method may further comprise selecting a subject in need of such treatment (e.g., identification of a damaged nerve, (e.g., CNS and/or PNS). The injury may occur by one or more means described herein. Optionally, administration occurs following neuronal injury in the subject, not prior to, or concurrent with injury.
(49) As used herein, the term subject is intended to include animals susceptible to neuronal (e.g., CNS or PNS) injuries, mammals, such as primates (e.g. human). Other examples of subjects include animals typically kept as pets (e.g., dogs, cats, birds, horses), farm animals (e.g., goats, pigs, cows, horses, sheep, poultry fowl) and exotic animals or zoo animals. Preferably, the subject is not a rabbit.
(50) Another aspect of the invention relates to method for treatment/treating a disease, disorder or condition associated with damage to a neuron or reduced neuronal outgrowth of a neuron, by administration of an agent that increases IGFBL-1 activity or levels to a subject with such a disease, disorder or condition. As used herein, the term associated with injury to a neuron, when used in conjunction with disease, disorder or condition, refers to the damage or injury to the neuron resulting from or causing the disease symptoms. Such disorders or conditions are generally known in the art, with representative diseases, disorders and conditions so associated being described herein. The subject may be at risk for such a disease, disorder or conditions or suspected of being in the early stages of development. Prevention of the development or progression of such a disease, disorder or condition by the methods described herein is also envisioned. For treatment or prevention, a therapeutically effective amount of an agent that increases IGFBL-1 activity or levels is administered. An agent that increases IGFBL-1 activity or levels can be administered in the presence of one or more exogenous factors (e.g., NGF, BDNF, GDNF, CNTF, IGF-1, sonic hedgehog, wnt, a hexose or hexose derivative, oncomodulin, inosine, other axogenic factors, a cAMP activator) described herein. For instance, they can be co-administered, or administered separately. The agent that increases IGFBL-1 activity or levels is optionally administered in the absence of one or more exogenous factors described herein (e.g., NGF, BDNF, a hexose or hexose derivative, oncomodulin, inosine, other axogenic factors, a cAMP activator).
(51) The method may further comprise selecting a subject in need of treatment or prevention of nerve damage (CNS and/or PNS). Such selection may involve identification within a subject of nerve damage and/or identification of a risk for the development of nerve damage in the subject.
(52) In general, ocular, CNS, and PNS disorders or injuries are identified using methods known in the art. For example, a subject with Alzheimer's disease is identified by observing symptoms such as difficulty performing tasks that take some thought, but used to come easily, such as balancing a checkbook, playing complex games (such as bridge); learning new information or routines; getting lost on familiar routes; language problems, such as trouble finding the name of familiar objects; losing interest in things previously enjoyed; flat mood; misplacing items; personality changes and loss of social skills. Alzheimer's disease is also described in Dubois et al., 2007 Lancet Neurol, August; 6(8):734-46, incorporated herein by reference.
(53) A subject with traumatic brain injury (TBI; e.g., blast-related TBI) is identified, e.g., by utilizing the Glasgow Coma Scale for Diagnosing Traumatic Brain Injury (i.e., evaluation of motor response, verbal response, and eye opening) and/or the Ranchos Los Amigos Scale for Diagnosing Traumatic Brain Injury (i.e., the varying levels of response and cognition). Each patient with TBI presents with different symptoms. Thus, the treatment for TBI varies based on the needs of the patient. Various treatments for traumatic main injury include speech therapy, physical therapy, occupational therapy, and therapeutic recreation. TBI is also described in Kubal W S, 2012 Radiol Clin North Am, January; 50(1):15-41, incorporated herein by reference.
(54) A subject with glaucoma is identified by, e.g., measuring intraocular pressure, determining the presence of optic nerve damage, performing a visual field test to determine if the visual field is affected, and by measuring corneal thickness. To distinguish between open-angle glaucoma and angle-closure glaucoma, a physician may use a technique called gonioscopy in which a special lens is placed on the eye to inspect the drainage angle. Another test, tonography, measures how quickly fluid drains from the eye. Glaucoma is also described in Tamide et al., 2011 Can J Ophthalmol, February; 46(1):89-90, incorporated herein by reference.
(55) A subject with Huntington disease is identified by observing various symptoms (e.g., dementia, abnormal movements, abnormal reflexes, prancing and wide walk, and hesitant speech or poor enunciation), and is confirmed with a cranial computed tomography (CT) scan, a cranial magnetic resonance imaging scan, or a positron emission tomography scan of the brain. Huntington disease is also described in Novak et al., 2011 Int Rev Neurobiol, 98:297-323, incorporated herein by reference.
(56) The methods described herein may further comprise the step of detecting a resultant neuronal outgrowth following treatment or in the course of treatment. For in vitro applications, the therapeutic effect of neural regeneration can be detected by any routinely used method such as a neurite outgrowth assay. For in vivo applications, neuronal outgrowth can be detected by detecting neural regeneration. Such regeneration can be detected using imaging methodologies such as confocal microscopy and MRI. More commonly, neural regeneration will be detected inferentially by neurological examination showing improvement in the patient's neural function or vision. The detecting step may occur at any time point after initiation of an agent that increases IGFBL-1 activity or levels administration, e.g., at least one day, one week, one month, three months, six months, after initiation of treatment. In some cases, the detecting step will comprise an initial neurological examination and a subsequent neurological examination conducted at least one day, week, or month after the initial exam. Improved neurological function at the subsequent exam compared to the initial exam indicates resultant neural regeneration. The specific detection and/or examination methods used will usually be based on the prevailing standard of medical care for the particular type of neural damage being evaluated (i.e. trauma, neurodegeneration, etc.).
(57) Administration of an agent that increases IGFBL-1 activity or levels to a subject, alone or in combinations described herein is to be made under conditions effective to stimulate nerve regeneration at the site of the injury and/or under conditions effective to at least partially restore nerve function (e.g., through an injured spinal cord). Restoration of nerve function can be evidenced by restoration of nerve impulse conduction, a detectable increase in conduction action potentials, observation of anatomical continuity, restoration of more than one spinal root level, an increase in behavior or sensitivity, or a combination thereof. Administration is by a method which results in contacting the administered factors with the site of injury to thereby promote nerve regeneration (complete or partial).
(58) Administering the formulation to the eye can involve cell transplantation, nanoparticle carriers, eye drops, salves, or implantable devices, depending on the precise nature of the formulation and the desired outcome of the administration. Specifically, a composition of the invention is delivered directly to the eye, (e.g., slow release devices such as pharmaceutical drug delivery sponges implanted in the cul-de-sac or implanted adjacent to the sclera or within the eye), using techniques well known by those of ordinary skill in the art. It is further contemplated that a polypeptide as disclosed herein is formulated in intraocular inserts or implantable devices. The ophthalmic formulations of the invention are administered in any form suitable for ocular drug administration, e.g., dosage forms suitable for topical administration, a solution or suspension for administration as eye drops or eye washes, ointment, gel, liposomal dispersion, colloidal microparticle suspension, or the like, or in an ocular insert such as a disc, and/or an optionally biodegradable controlled release polymeric matrix. The ocular insert is implanted in the conjunctiva, sclera, pars plana, anterior segment, or posterior segment of the eye. Implants provide for controlled release of the formulation to the surface, typically sustained release over an extended time period. Additionally, in a preferred embodiment, the formulation is entirely composed of components that are naturally occurring and/or as GRAS (Generally Regarded as Safe) by the U.S. Food and Drug Administration.
(59) Injuries, Diseases and Disorders
(60) The injury of the neuron for treatment can be acute or chronic. An injury can be complete severing, or partial severing of the nerve or axon tract, or crushing or compression injury to the neuron or nerve fibers. For example, an injury to a nerve or neuron directly impairs the normal functioning of the neuron. Alternatively, the injury to the nerve fiber or neuron indirectly impairs the normal functioning of the neuron. The injury to a nerve fiber or neuron can result from an acute or traumatic event, chronic event, pressure build-up, chronic neurodegeneration. Injury to a subject often results in injury to a nerve fiber or neuron. Causes of neuronal injury include, without limitation, disease and/or infection, ischemia, anoxia, hypoglycemia, contusion, laceration, tumor, blast or shedding force, laser, trauma to the brain or spinal cord (such as caused by acute spinal cord damage or stroke), damage by exogenous chemical agents (e.g., exposure to a toxin), and combinations thereof.
(61) As used herein, the term stroke is art recognized and is intended to include sudden diminution or loss of consciousness, sensation, and voluntary motion caused by rapture or obstruction (e.g., by a blood clot) of an artery of the brain. A spinal cord injury may be a complete severing of the spinal cord, a partial severing of the spinal cord, or a crushing or compression injury of the spinal cord.
(62) The neuronal injury may also be associated with peripheral neuropathies including, but not limited to, the following: diabetic neuropathies, virus-associated neuropathies, including acquired immunodeficiency syndrome (AIDS) related neuropathy, infectious mononucleosis with polyneuritis, viral hepatitis with polyneuritis; Guillian-Barre syndrome; botulism-related neuropathy; toxic polyneuropathies including lead and alcohol-related neuropathies; nutritional neuropathies including subacute combined degeneration; angiopathic neuropathies including neuropathies associated with systemic lupus erythematosis; sarcoid-associated neuropathy; carcinomatous neuropathy; compression neuropathy (e.g. carpal tunnel syndrome) and hereditary neuropathies, such as Charcot-Marie-Tooth disease, peripheral nerve damage associated with spinal cord injury can also be treated with the present method.
(63) Peripheral nerves such as dorsal root ganglia, otherwise known as spinal ganglia, are known to extend down the spinal column. These nerves can be injured as a result of spinal injury. Such peripheral nerve damage associated with spinal cord injury can also benefit from neuron axonal outgrowth produced by contact with an agent that increases IGFBL-1 activity or levels. As such, the present invention relates to methods of treatment of such an injury, the method comprising administering an agent that increases IGFBL-1 activity or levels to an individual in need thereof, to result in contact of the injured neuron with an effective amount of an agent that increases IGFBL-1 activity or levels, to promote neuronal outgrowth.
(64) Diseases, disorders, or conditions described herein as associated with injury to a neuron(s) can be treated in a subject by therapeutic administration of an agent that increases IGFBL-1 activity or levels. As such, aspects of the invention relate to methods of treating an individual for such diseases, disorders or conditions, described herein, by the methods herein described. Diseases, disorders, or conditions associated with injury to a neuron(s) disorders or conditions in a subject, include, without limitation, damage to retinal ganglion cells; traumatic brain injury; stroke related injury; a cerebral aneurism related injury: a spinal cord injury, including monoplegia, diplegia, paraplegia, hemiplegia and quadriplegia; a neuroproliferative disorder or neuropathic pain syndrome.
(65) Neuronal injury may also result from neurodegeneration which, for example, can be caused by or associated with neurotoxicity or a neurological disease, disorder or condition. Such disease or disorder includes, without limitation, Huntington's disease, Parkinson's disease, Multiple Sclerosis, Alzheimer's disease, multiple system atrophy (MSA), spinocerebellar atrophy, motor neuronopathy, epilepsy or seizures, peripheral neuropathy, cerebral palsy, glaucoma (e.g., angle closure or open angle), age related loss of neurons or neuronal connectivity and related deterioration of sensory, motor, reflect, or cognitive abilities. Disease which are inflammatory and/or autoimmune disease can also cause or be indicated/associated with neuronal degeneration from which such neuronal injury can arise. Injury to optic nerve neurons or retinal neurons may occur from the above listed causes. Injury to the optic nerve may further be the result of branch and central vein/artery occlusion, trauma, edema, angle-closure glaucoma, open-angle glaucoma. Retinal neurons may be injured by macular degeneration, age related macular degeneration, retinitis pigmentosa, retinal detachments, damage associated with laser therapy, and surgical light-induced iatrogenic retinopathy.
(66) In some instances, damage to the neuron may be evidenced by loss of function or the presence of physical damage, e.g., visible nerve damage such as a break in an extension (axon or dendrite) or another form of lesion. Subjects at risk for developing such neuronal damage can also be so treated by the methods described herein.
(67) Other Agents
(68) The agent that increases IGFBL-1 activity or levels can be contacted to the injured neuron(s) in combination with, or prior or subsequent to, other treatment regimes. One such treatment regimen is the use of anti-inflammatory agents such as methylprednisolone.
(69) An agent that increases IGFBL-1 activity or levels can further be contacted in combination with other axogenic factors, such as inosine, hexose or hexose derivatives, oncomodulin, nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), ciliary neurotrophic factor (CNTF). It can also be contacted/administered in combination with a cAMP activator. The term hexose derivative refers to a hexose molecule that has one or more residues (e.g., esters, ethers, amino groups, amido groups, phosphate groups, sulphate groups, carboxyl groups, carboxy-alkyl groups, and combinations thereof) covalently or ionically attached to one or more of the molecules hydroxyl groups and able to produce a neurosalutary effect, as described in US Patent Application 20050256059. Hexoses include mannose (D and L isomers), glucose, glucose-6-phosphate, aminomannose, mannose-6-phosphate (Phosporic acid mano-(3,4,5,6-tetrahydroxy-tetrahydro-pyran-2-ylmethy) ester). While not wishing to be bound by a particular theory, it is believed that the cAMP and/or and axogenic factors may potentiate the activity of an agent that increases IGFBL-1 activity or levels. Preferably, the cAMP activator is non-hydrolyzable cAMP analogue, forskolin, adenylate cyclase activators, calcium ionophores, membrane depolarization, phosphodiesterase inhibitors, specific phosphodiesterase IV inhibitors, beta2-adrenoreceptor inhibitors or vasoactive intestinal peptide, and combinations thereof.
(70) Administration of an agent that increases IGFBL-1 activity or levels to a subject, alone or in combinations described herein is to be made under conditions effective to stimulate nerve regeneration at the site of the injury and/or under conditions effective to at least partially restore nerve function through the injured spinal cord. Restoration of nerve function can be evidenced by restoration of nerve impulse conduction, a detectable increase in conduction action potentials, observation of anatomical continuity, restoration of more than one spinal root level, an increase in behavior or sensitivity, or a combination thereof. Administration is by a method which results in contacting the administered factors with the site of injury to thereby promote nerve regeneration (complete or partial).
(71) In one embodiment, an agent that increases IGFBL-1 activity or levels is not co-administered or administered concurrently with xanthine oxidase, or any other oxidizing method to generate reactive 02.
(72) Pharmaceutically Acceptable Compositions
(73) The agent that increases IGFBL-1 activity or levels which is administered in vivo is optionally in a pharmaceutical composition or solution. The pharmaceutical composition or solution can further include one or more other exogenous agents (e.g., one or more axogenic factors, and/or cAMP activators) described herein as administered with or contacted in the presence of an agent that increases IGFBL-1 activity or levels. The pharmaceutical composition or solutions may optionally, be specifically formulated to exclude one or more such other agents. The pharmaceutical composition can optionally be formulated to exclude xanthine oxidase, or any other oxidizing method to generate reactive oxygen. In some cases, the pharmaceutical composition consists essentially of an agent that increases IGFBL-1 activity or levels and a pharmaceutically acceptable carrier. By the term consists or consisting essentially of is meant that the pharmaceutical composition does not contain any other active agents (e.g., modulators of neuronal growth such as, for example, NGF)).
(74) In one aspect, the pharmaceutical composition of the invention can be provided as a packaged formulation. The packaged formulation may include a pharmaceutical composition of the invention in a container and printed instructions for administration of the composition for treating a subject having a neuronal injury, and/or disease, disorder or condition associated with an injury neurons, as described herein.
(75) Pharmaceutical compositions are considered pharmaceutically acceptable for administration to a living organism. For example, they are sterile, the appropriate pH, and ionic strength, for administration. They generally contain an agent that increases IGFBL-1 activity or levels formulated in a composition within/in combination with a pharmaceutically acceptable carrier, also known in the art as excipients.
(76) The pharmaceutically acceptable carrier is formulated such that it facilitates delivery of the active ingredient (e.g., an agent that increases IGFBL-1 activity or levels) to the target site. Such a carrier is suitable for administration and delivery to the target neuron. The pharmaceutically acceptable carrier will depend upon the location of the target neuron and the route of administration. For example, a typical carrier for intravenous administration of an agent is saline. The term pharmaceutically acceptable carrier includes, without limitation, any and all solvents, dispersion media, coatings, antibacterial and anti fungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. For example, the carrier can be suitable for injection into the cerebrospinal fluid. The pharmaceutical composition can further be designed to provide protection of the agent that increases IGFBL-1 activity or levels from unnecessary dispersion or degradation. The pharmaceutical composition may also contain additional ingredients such as stabilizers and disintegrants. Appropriate carriers and pharmaceutical compositions will be determined by the skilled practitioner. In some cases, the pharmaceutical composition is easily suspended in aqueous vehicles and introduced through conventional hypodermic needles or using infusion pumps.
(77) Prior to introduction, the composition can be sterilized with, preferably, gamma radiation or electron beam sterilization, described in U.S. Pat. No. 436,742 the contents of which are incorporated herein by reference.
(78) Additional examples of carriers are synthetic or natural polymers in the form of macromolecular complexes, nanocapsules, microspheres, or beads, and lipid-based formulations including oil-in-water emulsions, micelles, mixed micelles, synthetic membrane vesicles, and resealed erythrocytes. Optionally, the pharmaceutically acceptable carrier comprises a polymeric matrix.
(79) The terms polymer or polymeric are art-recognized and include a structural framework comprised of repeating monomer units which is capable of delivering an agent that increases IGFBL-1 activity or levels or analog thereof such that treatment of a targeted condition, e.g., a CNS injury, occurs. The terms also include co-polymers and homopolymers e.g., synthetic or naturally occurring. Linear polymers, branched polymers, and cross-linked polymers are also meant to be included.
(80) For example, polymeric materials suitable for forming the pharmaceutical composition employed in the present invention, include naturally derived polymers such as albumin, alginate, cellulose derivatives, collagen, fibrin, gelatin, and polysacchanides, as well as synthetic polymers such as polyesters (PLA, PLGA), polyethylene glycol, poloxomers, polyanhydrides, and pluronics. These polymers are biocompatible with the nervous system, including the central nervous system, they are biodegradable within the central nervous system without producing any toxic byproducts of degradation, and they possess the ability to modify the manner and duration of an agent that increases IGFBL-1 activity or levels release by manipulating the polymer's kinetic characteristics. As used herein, the term biodegradable means that the polymer will degrade over time by the action of enzymes, by hydrolytic action and/or by other similar mechanisms in the body of the subject. As used herein, the term biocompatible means that the polymer is compatible with a living tissue or a living organism by not being toxic or injurious and by not causing an immunological rejection.
(81) Polymers can be prepared using methods known in the art (Sandler. S. R.; Karo, W. Polymer Syntheses; Harcourt Brace: Boston. 1994; Shalaby, W.; Ikada, Y.; Langer, R.: Williams, J. Polymers of Biological and Biomedical Significance (ACS Symposium Series 540; American Chemical Society: Washington, D.C. 1994). Polymers can be designed to be flexible; the distance between the bioactive side-chains and the length of a linker between the polymer backbone and the group can be controlled. Other suitable polymers and methods for their preparation are described in U.S. Pat. Nos. 5,455,044 and 5,576,018, the contents of which are incorporated herein by reference.
(82) The polymeric formulations are preferably formed by dispersion of an agent that increases IGFBL-1 activity or levels within liquefied polymer, as described in U.S. Pat. No. 4,883,666, the teachings of which are incorporated herein by reference or by such methods as bulk polymerization, interfacial polymerization, solution polymerization and ring polymerization as described in Odian G., Principles of Polymerization and ring opening polymerization, 2nd ed., John Wiley & Sons, New York, 1981, the contents of which are incorporated herein by reference. The properties and characteristics of the formulations are controlled by varying such parameters as the reaction temperature, concentrations of polymer and an agent that increases IGFBL-1 activity or levels, types of solvent used, and reaction times.
(83) The agent that increases IGFBL-1 activity or levels can be encapsulated in one or more pharmaceutically acceptable polymers, to form a microcapsule, microsphere, or microparticle, terms used herein interchangeably. Microcapsules, microspheres, and microparticles are conventionally free-flowing powders consisting of spherical particles of 2 millimeters or less in diameter, usually 500 microns or less in diameter. Particles less than 1 micron are conventionally referred to as nanocapsules, nanoparticles or nanospheres. For the most part, the difference between a microcapsule and a nanocapsule, a microsphere and a nanosphere, or microparticle and nanoparticle is size; generally there is little, if any, difference between the internal structures of the two. In one aspect of the present invention, the mean average diameter is less than about 45 m, preferably less than 20 m, and more preferably between about 0.1 and 10 m.
(84) The pharmaceutical composition optionally comprises lipid-based formulations. Any of the known lipid-based drug delivery systems can be used in the practice of the invention. For instance, multivesicular liposomes (MVL), multilamellar liposomes (also known as multilamellar vesicles or MLV). unilamellar liposomes, including small unilamellar liposomes (also known as unilamellar vesicles or SUV) and large unilamellar liposomes (also known as large unilamellar vesicles or LUV), can all be used so long as a sustained releaserate of the encapsulated an agent that increases IGFBL-1 activity or levels or analogue thereof can be established. In one embodiment, the lipid-based formulation can be a multivesicular liposome system. Methods of making controlled release multivesicular liposome drug delivery systems is described in PCT Application Ser. Nos. 96/11642, US94/12957 and US94/04490, the contents of which are incorporated herein by reference. The composition of the synthetic membrane vesicle is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used. Examples of lipids useful in synthetic membrane vesicle production include phosphatidylglycerols, phosphatidylcholines, phosphatidylserines, phosphatidylethanolamines, sphingolipids, cerebrosides, and gangliosides. Preferably phospholipids including egg phosphatidylcholine, dipalmitoylphosphatidylcholine, distearoylphosphatidylcholine, dioleoylphosphatidylcholine, dipalmitoylphosphatidylglycerol, and dioleoylphosphatidylglycerol are used. In preparing lipid-based vesicles containing an agent that increases IGFBL-1 activity or levels, such variables as the efficiency of an agent that increases IGFBL-1 activity or levels encapsulation, lability of an agent that increases IGFBL-1 activity or levels, homogeneity and size of the resulting population of vesicles, an agent that increases IGFBL-1 activity or levels-to-lipid ratio, permeability, instability of the preparation, and pharmaceutical acceptability of the formulation should be considered (see Szoka, et al., Annual Reviews of Biophysics and Bioengineering, 9:467, 1980; Deamer, et al., in Liposomes, Marcel Dekker, New York, 1983, 27; and Hope, et al., Chem. Phys. Lipids, 40:89, 1986, the contents of which are incorporated herein by reference). The pharmaceutical composition optionally provides sustained delivery, e.g., slow release of an agent that increases IGFBL-1 activity or levels to a subject for at least one, two, three, or four weeks after the pharmaceutical composition is administered to the subject.
(85) As used herein, the term sustained delivery is intended to include continual delivery of an agent that increases IGFBL-1 activity or levels or analogue thereof in vivo over a period of time following administration, preferably at least several days, a week or several weeks. Sustained delivery of an agent that increases IGFBL-1 activity or levels can be demonstrated by, for example, the continued therapeutic effect of an agent that increases IGFBL-1 activity or levels over time (e.g., by continued outgrowth of neurons over time). Alternatively, sustained delivery of an agent that increases IGFBL-1 activity or levels may be demonstrated by detecting the presence of an agent that increases IGFBL-1 activity or levels in vivo over time.
(86) In one embodiment, the pharmaceutical composition provides sustained delivery of an agent that increases IGFBL-1 activity or levels or analogue thereof to a subject for less than 30 days after an agent that increases IGFBL-1 activity or levels or analogue thereof is administered to the subject. For example, the pharmaceutical composition, e.g., slow release formulation, can provide sustained delivery of an agent that increases IGFBL-1 activity or levels to a subject for one, two, three or four weeks after an agent that increases IGFBL-1 activity or levels is administered to the subject. Alternatively, the pharmaceutically composition may provide sustained delivery of an agent that increases IGFBL-1 activity or levels to a subject for more than 30 days after an agent that increases IGFBL-1 activity or levels is administered to the subject.
(87) Administration
(88) Administration of an agent that increases IGFBL-1 activity or levels to a subject, (e.g., in a pharmaceutical composition, with or without an additional axogenic factor described herein) optionally results in an agent that increases IGFBL-1 activity or levels directly contacting a neuron in need of regeneration. The agent that increases IGFBL-1 activity or levels and/or one or more of the factors optionally does not directly contact the neuron, but contacts the surrounding cells. Combinations of different forms of contacting with the various factors described herein are also envisioned.
(89) Administration of a therapeutic amount of the compositions described herein is intended to produce a neurosalutary effect. The term neurosalutary effect means a response or result favorable to the health or function of a neuron, of a part of the nervous system, or of the nervous system generally. Examples of such effects include improvements in the ability of a neuron or portion of the nervous system to resist insult, to regenerate, to maintain desirable function, to grow or to survive. The phrase producing a neurosalutary effect includes producing or effecting such a response or improvement in function or resilience within a component of the nervous system. For example, examples of producing a neurosalutary effect would include stimulating axonal outgrowth after injury to a neuron; rendering a neuron resistant to apoptosis; rendering a neuron resistant to a toxic compound such as -amyloid, ammonia, or other neurotoxins; reversing age-related neuronal atrophy or loss of function; or reversing age-related loss of cholinergic innervation.
(90) Administration to the subject can be by any one or combination of a variety of methods (e.g., parenterally, enterally and/or topically). The appropriate method(s) will depend upon the circumstances of the individual (e.g. the location of the target neuron(s), the condition of the individual, the desired duration of the contact, whether local or systemic treatment is desired). The administration can be by any methods described herein that will result in contact of sufficient an agent that increases IGFBL-1 activity or levels to the target neuron to induce neuronal outgrowth. For instance, parenteral, enteral and topical administration can be used. The phrases parenteral administration and administered parenterally as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrasternal injection and infusion. Enteral administration involves the esophagus, stomach, and small and large intestines (i.e., the gastrointestinal tract).
(91) The phrases systemic administration, administered systemically, peripheral administration and administered peripherally as used herein mean the administration of a compound other than directly into the central nervous system, such that it enters the animal's system and, thus, is subject to metabolism and other like processes, for example, subcutaneous administration. Administration may be topical (including ophthalmic, vaginal, rectal, intranasal, epidermal, and transdermal), oral or pulmonary administration, e.g., by inhalation or insufflation, or intracranial, e.g., intrathecal or intraventricular, administration, topically to the eye, or by intraocular injection.
(92) Specific routes of administration and the dosage regimen will be determined by skilled clinicians, based on factors such as the exact nature of the condition being treated, the severity of the condition, and the age and general physical condition of the patient. The invention also provides methods for stimulating the outgrowth of central nervous system neurons following an injury. The method involves administering to a subject an agent that increases IGFBL-1 activity or levels or analog thereof.
(93) Contacting is optionally achieved by administering the agent that increases IGFBL-1 activity or levels to a subject by means to thereby contact the desired neuron(s). When administered following an injury, administration of an agent that increases IGFBL-1 activity or levels alone or in combinations described herein is to be made under conditions effective to stimulate nerve regeneration at the site of the injury and/or under conditions effective to at least partially restore nerve function through the injured nerve(s) (e.g., an injured spinal cord). Restoration of nerve function can be evidenced by restoration of nerve impulse conduction, a detectable increase in conduction action potentials, observation of anatomical continuity, restoration of more than one spinal root level, an increase in behavior or sensitivity, or a combination thereof. Under such circumstances, administration results in contacting the administered factors with the site of injury to thereby promote nerve regeneration (complete or partial).
(94) The term administering to a subject includes dispensing, delivering or applying an active compound in a pharmaceutical formulation to a subject by any suitable route for delivery of the active compound to the desired location in the subject, (e.g., the injury, the injured neuron, or the site of desired outgrowth of the neuron). This includes, without limitation, delivery by either the parenteral or oral route, intramuscular injection, subcutaneous/intradermal injection, intravenous injection, buccal administration, transdermal delivery and administration by the rectal, colonic, vaginal, intranasal or respiratory tract route, intraocular, ocular. Another form of administration suitable for treatment of spinal cord injury is injection into the spinal column or spinal canal.
(95) The agent that increases IGFBL-1 activity or levels or analog thereof is optionally contacted in vivo by introduction into the central nervous system of a subject, e.g., into the cerebrospinal fluid of the subject. In certain aspects of the invention, the agent that increases IGFBL-1 activity or levels or analog thereof is introduced intrathecally, e.g., into a cerebral ventricle, the lumbar area, or the cisterna magna. In another aspect, an agent that increases IGFBL-1 activity or levels or analog thereof is introduced intraocularly, to thereby contact retinal ganglion cells or the optic nerve. Modes of administration are described in U.S. Pat. No. 7,238,529.
(96) In some circumstances, the methods described herein will not encompass direct administration into the brain of the subject (e.g., intrastriatal injection). In some circumstances, the methods described herein do not encompass intrathecal administration. That is to say, contacting of the neuron (e.g. the target neuron) is not accomplished by intrathecal administration and/or by direct administration into the brain of the subject (e.g., intrastriatal injection).
(97) In one embodiment, administration occurs following neuronal injury in the subject, not prior to or at the time of neuronal injury.
(98) The agent that increases IGFBL-1 activity or levels formulation is optionally administered into a subject intrathecally. As used herein, the term intrathecal administration is intended to include delivering an agent that increases IGFBL-1 activity or levels formulation directly into the cerebrospinal fluid of a subject, by techniques including lateral cerebroventricular injection through a burrhole or cisternal or lumbar puncture or the like (described in Lazorthes et al. Advances in Drug Delivery Systems and Applications in Neurosurgery, 143-192 and Omaya et al., Cancer Drug Delivery, 1: 169-179, the contents of which are incorporated herein by reference). The term lumbar region is intended to include the area between the third and fourth lumbar (lower back) vertebrae. The term cisterna magna is intended to include the area where the skull ends and the spinal cord begins at the back of the head. The term cerebral ventricle is intended to include the cavities in the brain that are continuous with the central canal of the spinal cord. Administration of an agent that increases IGFBL-1 activity or levels to any of the above mentioned sites can be achieved by direct injection of the agent that increases IGFBL-1 activity or levels formulation or by the use of infusion pumps.
(99) For injection, an agent that increases IGFBL-1 activity or levels formulation of the invention can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution or Ringer's solution. In addition, an agent that increases IGFBL-1 activity or levels formulation may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included. The injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of an agent that increases IGFBL-1 activity or levels formulation.
(100) An agent that increases IGFBL-1 activity or levels formulation is optionally administered by lateral cerebro ventricular injection into the brain of a subject in the inclusive period from the time of the injury to 100 hours thereafter. The injection can be made, for example, through a burr hole made in the subject's skull. In some cases, the encapsulated therapeutic agent is administered through a surgically inserted shunt into the cerebral ventricle of a subject in the inclusive period from the time of the injury to 100 hours thereafter. For example, the injection can be made into the lateral ventricles, which are larger, even though injection into the third and fourth smaller ventricles can also be made. In other cases, the agent that increases IGFBL-1 activity or levels formulation is administered by injection into the cisterna magna, or lumbar area of a subject in the inclusive period from the time of the injury to 100 hours thereafter.
(101) Duration and Levels of Administration
(102) Contacting of the injured neuron(s) can be anytime following the injury. Preferably, the injured neuron is contacted within 96 hours of formation of the lesion on the neuron to be contacted, and more preferably within 72, 48, 24, or 12 hours. The treatment of a subject may likewise begin anytime following the injury.
(103) Preferably, the treatment progresses upon detection or suspicion of the injury. For example, the treatment can be 6 hr, 12, hr, 18 hr, or 24 hours post injury. Benefit is also expected to be had from treatment that takes place considerably longer after the injury. The injury may have occurred more than three months prior to the treatment, more than one month prior, more than three weeks prior to the treatment, or more than two weeks prior to the treatment, more than one week prior to the treatment or from between 1-6 days prior to the treatment.
(104) In one aspect, the agent that increases IGFBL-1 activity or levels (e.g., in the form of a pharmaceutical composition) described herein is contacted to a neuron, and/or administered to the subject in the period from the time of injury to 100 hours, for example within 24, 12 or 6 hours after the injury has occurred.
(105) The pharmaceutical composition, used in the method of the invention, contains a therapeutically effective amount of the agent that increases IGFBL-1 activity or levels. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired result (e.g., a neurosalutary effect, detectable neuronal outgrowth). A therapeutically effective amount of an agent that increases IGFBL-1 activity or levels may vary according to factors such as the disease state, age, and weight of the subject, and the ability of an agent that increases IGFBL-1 activity or levels or analogue thereof (alone or in combination with one or more other agents) to elicit a desired response in the subject. Dosage regimens may be adjusted to provide the optimum therapeutic response. A therapeutically effective amount is also one in which any toxic or detrimental effects of an agent that increases IGFBL-1 activity or levels or analogue thereof are outweighed by the therapeutically beneficial effects. The term therapeutically effective amount refers to an amount that is sufficient to effect a therapeutically reduction in a symptom associated with neuronal injury, disease, disorder or condition described herein, when administered to a typical subject who has said injury, disease, disorder, condition. A therapeutically significant reduction in a symptom is, e.g. about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 100%, about 125%, about 150% or more as compared to a control or non-treated subject. In some embodiments the term therapeutically effective amount refers to the amount that is safe and sufficient to prevent or delay the development and further spread of neuronal injury, disease, or other disease symptoms. The amount can also cure or cause the disease, disorder or condition to go into remission, slow the course of, or otherwise inhibit progression.
(106) Any of the subject formulations are administered in a single dose or in divided doses. Dosages for the formulations of the present invention may be readily determined by techniques known to those of skill in the art or as taught herein. For example, the composition is present in a concentration range of 0.1-25%, 0.1% to 20%, or 0.1% to 10%, with preferred ranges between 1-5% or 2-2.5% (mg/ml). Exemplary liquid formulations for eye drops contain 2-2.5% (mg/ml) of the composition. Preferred formulations are in the form of a solid, a paste, an ointment, a gel, a liquid, an aerosol, a mist, a polymer, a film, an emulsion, or a suspension. The formulations are administered topically, e.g., the composition is delivered to an ocular or adnexal tissue to directly contact that tissue. For example, the composition is incorporated into or coated onto a contact lens, which is applied directly to the ocular or adnexal tissue.
(107) For example, a non-limiting range for a therapeutically effective concentration of an agent that increases IGFBL-1 activity or levels is 5 M to 1 mM. A non-limiting range for a therapeutically effective concentration of an agent that increases IGFBL-1 activity or levels is at least 25 M to 1 mM. In a particularly preferred embodiment, the therapeutically effective concentration of an agent that increases IGFBL-1 activity or levels is 10-25 M, or 25-50 M. In a particularly preferred embodiment, the therapeutically effective concentration of an agent that increases IGFBL-1 activity or levels is 25-50 M, 50-100 M, or 100-150 M. Dosage values may vary with the severity of the condition to be alleviated. For any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of an agent that increases IGFBL-1 activity or levels or analogue thereof and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed invention.
(108) A therapeutically effective amount or dosage of an agent that increases IGFBL-1 activity or levels ranges from about 0.001 to 30 mg/kg body weight, with other ranges of the invention including about 0.01 to 25 mg/kg body weight, about 0.1 to 20 mg/kg body weight, about 1 to 10 mg/kg, 2 to 9 mg/kg, 3 to 8 mg/kg, 4 to 7 mg/kg, and 5 to 6 mg/kg body weight. A non-limiting range for a therapeutically effective in vivo concentration in tissue containing the injury is 5 M to 5 mM.
(109) In one embodiment, administration occurs following neuronal injury in the subject, not prior to or at the time of neuronal injury.
(110) In Vitro Treatment of Neurons
(111) Neurons can further be contacted with a therapeutically effective amount of an agent that increases IGFBL-1 activity or levels, in vitro or ex vivo. Accordingly, neuron cells can be isolated from a subject and grown in vitro, using techniques well known in the art. Briefly, a neuron cell culture can be obtained by allowing neuron cells to migrate out of fragments of neural tissue adhering to a suitable substrate (e.g., a culture dish) or by disaggregating the tissue, e.g., mechanically or enzymatically, to produce a suspension of neuron cells. For example, the enzymes trypsin, collagenase, elastase, hyaluronidase, DNase, pronase, dispase, or various combinations thereof can be used. Trypsin and pronase give the most complete disaggregation but may damage the cells. Collagenase and dispase give a less complete dissagregation but are less harmful. Methods for isolating tissue (e.g., neural tissue) and the disaggregation of tissue to obtain cells (e.g., CNS neuron cells) are described in Freshney R. L, Culture of Animal Cells, A Manual of Basic Technique, Third Edition, 1994, the contents of which are incorporated herein by reference.
(112) Such cells can be subsequently contacted with an agent that increases IGFBL-1 activity or levels at levels and for a duration of time as described above. Once modulation of neuronal outgrowth has been achieved in the neuron cells, these cells can be re-administered to the subject, e.g., by implantation.
(113) Eluting Devices
(114) The invention also provides an agent that increases IGFBL-1 activity or levels-eluting or an agent that increases IGFBL-1 activity or levels-impregnated implantable solid or semi-solid devices, for implantation into the CNS or the PNS. Examples of CNS implantable devices include polymeric microspheres (e.g. see Benny et al., Clin Cancer Res. (2005) 11:768-76) or wafers (e.g. see Tan et al., J Pharm Sci. (2003) 4:773-89), biosynthetic implants used in tissue regeneration after spinal cord injury (reviewed by Novikova et al., Curr Opin Neurol. (2003) 6:711-5), biodegradable matrices (see e.g. Dumens et al., Neuroscience (2004) 125:591-604), biodegradable fibers (see e.g. U.S. Pat. No. 6,596,296), osmotic pumps, stents, adsorbable gelatins (see e.g. Doudet et al., Exp Neurol. (2004) 189:361-8). Preferred devices are particularly tailored, adapted, designed or designated for CNS implantation. The implantable device may contain one or more additional agents used to promote or facilitate neural regeneration, as described herein.
(115) The invention is further illustrated in the following non-limiting examples illustrated in the accompanying Figures.
Example 1: Promotion of Optic Nerve Regeneration by IGFBPL-1
(116) The experiments described herein were aimed to elucidate the functional role and mechanisms of IGFBPL-1 on RGC survival and axon extension in mice. The expression pattern of IGFBPL-1 in the developing retina was examined in retinas at different developmental stage, ranging from embryonic day 16 through adult, using immunohistochemistry, western blot and quantitative RT-PCR. Retinal ganglion cells were purified using magnetic beads conjugated with Thy1.2 antibody from new born mouse pups at postnatal day 0 (P0), and cultured for up to five days in the presence or absence of IGFBPL-1 and/or IGF-I proteins. RGC survival and axonal growth were evaluated after three days in culture following LIVE/DEAD and -III-tubulin immunostaining. Lentiviral shRNAs were used to knockdown the expression of IGFBPL-1 and/or IGF-I in culture. The functional role of IGFBPL-1 in RGC development was further evaluated in IGFBPL-1 knockout (KO) mouse. RGC morphology and number were recorded using retinal vertical sections or whole-mount preparation. The number of axons in the optic nerve head was counted under electron microscopy. Data collected from the IGFBPL-1 KO mice were compared with that obtained from age-matched wildtype C57BL/6 littermates.
(117) As shown in
(118) Specifically,
(119) Western blot analysis of IGFBPL-1 expression is illustrated in
(120) As shown in
(121) Quantification of RGC neurite outgrowth in culture in the presence of increasing amounts of IGFBPL-1 is shown in
(122)
(123) As shown in
(124) Immunofluorescence images showing that blockade of IGFI-1 signaling abolishes IGFBPL-1 induced axon growth in P0 RGC cultures are shown in
(125) Quantification of axon growth from cultured P0 RGCs to the presence of control; IGFPL-1; IGF-1; IGFPL-1+IGF-1; IGFBPL-1+NBI-31772; IGFBPL-1+H1356; IGFBPL-1+Neut. Ab; IGFBPL-1+IGF-I+Neut. Ab; and IGFBPL-1+IGF-I+H1356 is shown in
(126) As shown in
(127) As shown in
(128) The expression of IGFBPL1 and IGF-I in the developing mouse retina is shown in
(129) Knockdown of IGF-I or IGFBPL1 impairs RGC neurite outgrowth (
(130) The addition of IGF-I and IGFBPL1 promotes RGC axonal growth.
(131) As shown in
(132) Blockage of IGF-I pathway abolishes IGFBPL1 induced axonal growth (
(133)
(134) The results presented herein demonstrate that IGFBPL-1 serves as an important regulator of RGC axonal growth during retinal development, likely functioning by facilitating the IGF-I signaling pathway. These studies provide new information regarding regulating RGC axon growth, protection, regeneration and repair.
Other Embodiments
(135) While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
(136) The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
(137) While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.