VACCINE COMPOSITIONS FOR USE AGAINST DIGITAL DERMATITIS IN A MAMMAL

20200360498 · 2020-11-19

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides new pharmaceutical and vaccine compositions comprising Treponema spp. bacterins, supplemented with antigens from Treponema spp. or other digital dermatitis causative pathological agents such as but not limited to D. nodosus or F. necrophorum, for effectively immunizing susceptible mammals, preferably ungulates, against DD, in particular against bovine digital dermatitis. The present invention also identifies Treponema pedis and Treponema phagedenis as two of the etiologic agents of digital dermatitis (DD) in mammals, in particular ungulate digital dermatitis. The invention therefore also provides isolated cultures of Treponema pedis and Treponema phagedenis for effectively immunizing susceptible mammals, preferably ungulates, against DD, in particular against bovine digital dermatitis. In addition, the present invention provides methods of diagnosing DD by detecting infection with a series of specific Treponema antigens.

    Claims

    1. A pharmaceutical composition comprising an immunogenically effective amount of at least a Treponema spp. bacterin, and one or more isolated antigens from Treponema spp. or other digital dermatitis causative pathological agents.

    2. The pharmaceutical composition according to claim 1, wherein said composition comprises an immunogenically effective amount of at least a Treponema spp. bacterin selected from the group consisting of Treponema pedis, Treponema phagedenis, Treponema medium, Treponema vincentii, Treponema refringens, Treponema calligyrum, Treponema maltophilum and/or Treponema brennaborense.

    3. The pharmaceutical composition according to claim 1, wherein said composition comprises an immunogenically effective amount of at least a Treponema spp. bacterin selected from the group consisting of Treponema pedis, Treponema phagedenis, and/or Treponema medium.

    4. The pharmaceutical composition according to claim 1, wherein said composition comprises an immunogenically effective amount of at least a Treponema spp. bacterin selected from the group consisting of Treponema pedis, and/or Treponema phagedenis.

    5. The pharmaceutical composition according to any of claims 1 to 4, wherein such isolated antigens, preferably recombinant antigens, are selected from the list consisting of adhesins, proteases, peptidases, surface antigens, proteins involved in motility and hemolysins.

    6. The pharmaceutical composition according to any one of claims 1 to 4, wherein such isolated antigens are Treponema spp. antigens selected from any of the following list: MSP, PrtP, PrtPM, TylC, OrfC, Hemolysin III, PrcB, PrcA, Cys peptidase, Hemolysin erythrocyte lysis protein 2, Surface antigen BspA, Filament protein, Flagellar hook protein, Oligopeptidase B, Prolyl endopeptidase, Oligopeptidase, or Oligopeptidase F; and/or antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, or any combination thereof, wherein optionally said antigens are recombinantly produced.

    7. The pharmaceutical composition according to any one of claims 1 to 6, wherein such isolated antigens are antigens selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and/or antigens MSP and Haemolysin III from Treponema phagedenis; and/or antigens PrtP, preferably PrtPM, from Treponema vincentii; and/or antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, or any combination thereof, wherein optionally said antigens are recombinantly produced.

    8. The pharmaceutical composition according to any one of claims 1 to 6, wherein such isolated antigens are selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, wherein optionally said antigens are recombinantly produced.

    9. The pharmaceutical composition of any one of claims 1 to 8, wherein the Treponema spp. bacterin is in the form of a suspension of killed bacteria.

    10. A pharmaceutical composition, preferably a vaccine, comprising an immunogenically effective amount of a Treponema pedis bacterin.

    11. The pharmaceutical composition of claim 10, wherein the Treponema pedis bacterin is in the form of a suspension of killed bacteria.

    12. The pharmaceutical composition of any one of claim 10 or 11, further comprising one or more isolated antigens from Treponema spp. or other digital dermatitis causative pathological agents.

    13. The pharmaceutical composition of claim 12, wherein said one or more isolated antigens are selected from the list consisting of adhesins, proteases, peptidases, surface antigens, proteins involved in motility and hemolysins.

    14. The pharmaceutical composition of claim 12, wherein said one or more isolated antigens are selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and/or antigens MSP and Haemolysin III from Treponema phagedenis; and/or antigens PrtP, preferably PrtPM, from Treponema vincentii; and/or antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, or any combinations thereof, wherein optionally said antigens are recombinantly produced.

    15. The pharmaceutical composition of claim 12, wherein said one or more isolated antigens are selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, wherein optionally said antigens are recombinantly produced.

    16. The pharmaceutical composition of any one of claims 10 to 15, wherein the composition further comprises an immunogenically effective amount of a bacterin selected from the group consisting of Treponema medium, Treponema vincentii, Treponema phagedenis, Treponema refringens, Treponema calligyrum, Treponema maltophilum and/or Treponema brennaborense, or any combination thereof.

    17. A pharmaceutical composition, preferably a vaccine, comprising an immunogenically effective amount of a Treponema phagedenis bacterin.

    18. The pharmaceutical composition of claim 17, wherein the Treponema phagedenis bacterin is in the form of a suspension of killed bacteria.

    19. The pharmaceutical composition of any one of claim 17 or 18, further comprising one or more isolated antigens from Treponema spp. or other digital dermatitis causative pathological agents.

    20. The pharmaceutical composition of claim 19, wherein said one or more isolated antigens are selected from the list consisting of adhesins, proteases, peptidases, surface antigens, proteins involved in motility and hemolysins.

    21. The pharmaceutical composition of claim 19, wherein said one or more isolated antigens are selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and/or antigens MSP and Haemolysin III from Treponema phagedenis; and/or antigens PrtP, preferably PrtPM, from Treponema vincentii; and/or antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, or any combinations thereof, wherein optionally said antigens are recombinantly produced.

    22. The pharmaceutical composition of claim 19, wherein said one or more isolated antigens are selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, wherein optionally said antigens are recombinantly produced.

    23. The pharmaceutical composition of any one of claims 17 to 22, wherein the composition further comprises an immunogenically effective amount of a bacterin selected from the group consisting of Treponema medium, Treponema vincentii, Treponema pedis, Treponema refringens, Treponema calligyrum, Treponema maltophilum and/or Treponema brennaborense, or any combination thereof.

    24. The pharmaceutical composition of any one of claims 1 to 23, wherein the composition further comprises a bovine respiratory syncytial virus antigen, a bovine herpes virus antigen, a leptospiral antigen, a bovine diarrhoea virus antigen, a bovine parainfluenza virus antigen, a vesicular stomatitis virus antigen, a malignant catarrhal fever virus antigen, a blue tongue virus antigen, a pseudorabies virus antigen, a rabies virus antigen, a rinderpest virus antigen, a Guggenheimella antigen, a Porphyromonas antigen, a Bacteroides antigen, a Prevotella antigen, a Peptosteptococcus antigen, a Campylobacter antigen, a Mycoplasma antigen, a Corynebacterium/Actinomyces antigen, a Cryptosporidium antigen, a rotavirus antigen, a coronvavirus antigen a Fusobacterium necrophorum antigen, a Dichelobacter nodosus antigen, or a Clostridia spp. antigen.

    25. The pharmaceutical composition of any one of claims 1 to 24, wherein said composition further comprises a pharmaceutically acceptable carrier.

    26. A vaccine comprising the pharmaceutical composition of any one of claims 1 to 9.

    27. A vaccine comprising the pharmaceutical composition of any one of claims 10 to 16.

    28. A vaccine comprising the pharmaceutical composition of any one of claims 17 to 23.

    29. The pharmaceutical composition according to any one of claims 1 to 9, or a vaccine according to claim 26, for use in a method of treatment or prevention of digital dermatitis in a mammal.

    30. The pharmaceutical composition according to any one of claims 10 to 16 or a vaccine according to claim 27, for use in a method of treatment or prevention of digital dermatitis in a mammal.

    31. The pharmaceutical composition according to any one of claims 17 to 23 or a vaccine according to claim 28, for use in a method of treatment or prevention of digital dermatitis in a mammal.

    32. The pharmaceutical composition or the vaccine for use according to claim 29, wherein the digital dermatitis is bovine digital dermatitis, contagious ovine digital dermatitis and/or footrot.

    33. The pharmaceutical composition or the vaccine for use according to claim 30, wherein the digital dermatitis is bovine digital dermatitis, contagious ovine digital dermatitis and/or footrot.

    34. The pharmaceutical composition or the vaccine for use according to claim 31, wherein the digital dermatitis is bovine digital dermatitis, contagious ovine digital dermatitis and/or footrot.

    35. A vaccination kit characterized in that it comprises a container which comprises the pharmaceutical composition of any one of claims 1 to 23 or the vaccine of claims 26 to 28.

    36. The kit according to claim 35, characterized in that it also comprises an informative manual or leaflet which contains the information on administering said pharmaceutical composition of any one of claims 1 to 23 or of the vaccine of claims 26 to 28.

    37. A pharmaceutical composition, preferably a vaccine, comprising an immunogenically effective amount of a Treponema spp. bacterin selected from the group consisting of Treponema pedis, Treponema phagedenis, Treponema medium, Treponema vincentii, Treponema refringens, Treponema calligyrum, Treponema maltophilum and/or Treponema brennaborense.

    38. The pharmaceutical composition, preferably a vaccine, according to claim 37, wherein said composition comprises an immunogenically effective amount of a Treponema spp. bacterin selected from the group consisting of Treponema pedis, Treponema phagedenis, and/or Treponema medium.

    39. A vaccine comprising the pharmaceutical composition of any one of claims 37 to 38.

    40. The pharmaceutical composition according to any one of claims 37 o 38 or a vaccine according to claim 39, for use in a method of treatment or prevention of digital dermatitis in a mammal.

    41. The pharmaceutical composition or the vaccine for use according to claim 40, wherein the digital dermatitis is bovine digital dermatitis, contagious ovine digital dermatitis and/or footrot.

    42. A T. phagedenis strain deposited under the Budapest treaty by HIPRA SCIENTIFIC, S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen under accession number DSM 32950 on Nov. 7, 2018

    43. A T. pedis strain deposited under the Budapest treaty by HIPRA SCIENTIFIC, S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen under accession number DSM 32663 on Oct. 10, 2017.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0074] FIG. 1. Inhibition assay and indirect ELISA against T. pedis of sera obtained from cattle at day 47 post-vaccination (5 animals per group). A) Inhibition assay of T. pedis in a microplate (d47 pv) at dil. 1/32. Quantity of spiral forms (from 0 to 3) is shown as the ordinates for different tested vaccines, as the abscissas; B). Indirect ELISA against T. pedis at d47 post-vaccination. Optical density (OD) at 405 nm is shown, as the ordinates, for different tested vaccines, as the abscissas. Each vaccine is illustrated in example 1. Vaccine A (Treponema pedis bacterin+4 recombinant proteins); Vaccine B (4 recombinant proteins alone without Treponema bacterins); vaccine C (Treponema pedis bacterin alone), Vaccine D (placebo).

    [0075] FIG. 2. ELISA against T. pedis isolate of sera obtained from cattle at days 0, 21 and 35 post-vaccination. Mean of the optical density (OD) at 405 nm is shown, as the ordinates, for different tested vaccines, as the abscissas. Each vaccine is illustrated in example 1.

    [0076] FIG. 3. ELISA against T. phagedenis isolate of sera obtained from cattle at days 0, 21 and 35 post-vaccination. Mean of the optical density (OD) at 405 nm is shown, as the ordinates, for different tested vaccines, as the abscissas. Each vaccine is illustrated in example 1.

    [0077] FIG. 4. Images showing different lesion severity and their corresponding score. A) Score DD=10 and D32 pi; B) Score DD=5 and D32 pi; C) Score DD=0 and D32 pi. Example 1.

    [0078] FIG. 5. Figures representing score lesions and percentages of animals with BDD lesion, according to Iowa and Wisconsin score at 32 days post-infection. A) Assessment of final macroscopic lesions at 32 days pi (Iowa score). Total Iowa score group (0 to 50) and percentage of calf with digital dermatitis are depicted in the left and right ordinates, respectively, for different assayed vaccines shown as the abscissas; B) Total lesion percentage at day 32 pi (Wisconsin score). Percentage of total lesion score is depicted, as the ordinates, for the different tested vaccines, as the abscissas. Each vaccine is illustrated in example 1.

    [0079] FIG. 6. Growth and morphology inhibition assay of T. pedis in vitro from sera at day 35 post-vaccination, using dark field microscopy. A) Serum 1 ( 1/16) day 0 pv (vaccine 1); B) Serum 1 ( 1/16) day 35 pv (vaccine 1). Example 2.

    [0080] FIG. 7. Serology/ELISA (IgG2) against T. pedis (A), T. phagedenis (B) and T. medium (C) of sera obtained from cattle at days 0, 21 and 35 post-vaccination. Mean of the optical density (OD) at 405 nm is shown, as the ordinates, for different tested vaccines, as the abscissas. Each vaccine is illustrated in example 2.

    [0081] FIG. 8. Boxplot of the lesions score at day 32 post-infection for each group of calves. Digital dermatitis score lesion (0 to 10) is shown, as the abscissas, for different tested vaccines, as the ordinates. Example 2.

    [0082] FIG. 9. Immunogenicity assay against two different T. pedis strains in rabbits (ELISA of sera obtained at days 0, 14 and 35 post-vaccination). Mean of the optical density at 405 nm (OD) is shown, as the ordinates, at different days post-vaccination as the abscissas, for Group 1 and Group 2. Each Group is illustrated in example 3.

    [0083] FIG. 10: Serology/ELISA against T. pedis (A), T. phagedenis (B), and T. medium (C) of sera obtained from vaccinated cattle with a T. phagedenis bacterin at days 0, 21, 35, 48, and 69. Mean of IRPC (Relative Index Percentage) is shown as the ordinates for the different groups, as the abscissas. Each Group is illustrated in example 4.

    [0084] FIG. 11: Serology/ELISA against T. pedis PrtPM protein (A), D. nodosus Apr2 protein (B), and T. phagedenis MSP protein (C) of sera obtained from vaccinated cattle at days 0, 21, 35, 48, and 69. Mean of IRPC (Relative Index Percentage) is shown as the ordinates for the different groups, as the abscissas. Each Group is illustrated in example 5.

    DETAILED DESCRIPTION OF THE INVENTION

    [0085] The present invention provides digital dermatitis, preferably bovine digital dermatitis, pharmaceutical or vaccine compositions having as active ingredients at least Treponema spp. bacterins; preferably an immunogenically effective amount of a bacterin selected from the group consisting of: Treponema pedis, Treponema medium, Treponema vincentii, Treponema phagedenis, Treponema refringens, Treponema brennaborense, Treponema calligyrum, and/or Treponema maltophilum. More preferably, an immunogenically effective amount of a bacterin selected from Treponema pedis and Treponema phagedenis. In addition, the present invention provides isolated antigens, preferably recombinant antigens, from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, in a variety of applications, including the production of nucleic acids and proteins for diagnostic assays for digital dermatitis and the preparation of immunogenic proteins and compositions for use in digital dermatitis vaccine compositions, wherein in these compositions said antigens are used in combination with an immunogenically effective amount of a Treponema spp. bacterin, preferably with an immunogenically effective amount of a Treponema pedis bacterins, or preferably with an immunogenically effective amount of a bacterin selected from the group consisting of: Treponema medium, Treponema vincentii, Treponema phagedenis, Treponema refringens, Treponema brennaborense, Treponema calligyrum, and Treponema maltophilum. In addition, in preferred embodiments of the present invention said isolated antigens are selected from virulence factors such as adhesins, peptidases, proteases, surface antigens, proteins involved in motility and haemolysisn. More preferably said isolated antigens are selected from the following list: MSP (Major Outer Sheath Protein), PrtP (Serine-protease Complex PrtP-like Protein) and PrtPM (PrtP Mature Protein), TylC (Hemolysin C), OrfC (Surface Antigen OrfC Lipoprotein), Haemolysin III, Apr2 (Acidic Extracellular Subtilisin-like Protease Apr2) and Apr2BM (Apr2 Benign Mature Protein), Apr5 (Acidic Extracellular Subtilisin-like Protease Apr5) and Apr5M (Apr5 Mature Protein), Bpr (Basic Extracellular Subtilisin-like Protease Bpr) and BprM (Bpr Mature Protein), PrcB (Serine-protease Complex PrcB-like protein), PrcA (Serine-protease Complex PrcA-like protein), Cys peptidase, Hemolysin erythrocyte lysis protein 2, Surface antigen BspA, Filament protein, Flagellar hook protein, Prolyl endopeptidase, Oligopeptidase, Oligopeptidase B, and Oligopeptidase F. Still more preferably said isolated antigens are selected from the list consisting of: MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; and/or antigens MSP and Haemolysin III from Treponema phagedenis; and/or antigens PrtP, preferably PrtPM, from Treponema vincentii; and/or antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus. As already stated, said antigens can be used in a variety of applications, including the production of nucleic acids and proteins for diagnostic assays for digital dermatitis and the preparation of immunogenic proteins and compositions for use in digital dermatitis vaccine compositions optionally comprising bacteria pertaining to the Treponema spp.

    Definitions

    [0086] As used herein, the following terms have the meanings ascribed to them unless specified otherwise.

    [0087] Treponema, Ungulate Treponema and bovine Treponema refer to flexible, spiral-shaped spirochete bacteria of the Treponema genus identified in or isolated from ungulate and bovine biological samples, in particular from hoof and foot tissue. The definition also relates to isolates of Treponema-like species from other origins such as ruminants, porcine, ovine, and/or human that are useful for preventing and/or treating digital dermatitis.

    [0088] Ungulate refers to hooved animals such as cows, horses, sheep, and goats.

    [0089] Bovine refers to cattle (bulls, cows, calves). Typically, the spirochetes of the Treponema genus can be isolated from foot or hoof tissue of hooved animals infected with DD (digital dermatitis).

    [0090] Bacterin refers to a preparation of inactivated whole or partial bacteria cells suitable for use as a vaccine.

    [0091] Treponema pedis was first described in bovine digital dermatitis lesions in Holstein-Friesian cows and was first deposited as Treponema pedis Evans et al. 2009, DSM No.: 18691, Type strain T3552B. In the present invention, the term Treponema pedis refers to any strains that belong to the species T. pedis, in particular to bacterial strains having a sequence identity over the whole 16S rRNA gene EF061268 (genebank accession number) of at least 90%, preferably of at least 99%. Other Treponema sources are also comprised in the definition. Therefore, any particular Treponema strain having a sequence identity over the whole 16S rRNA genes are also encompassed in the present invention. Some examples of T. pedis strains are T3552B, G819CB, T18B, T354A. Any T. pedis strain is suitable to be used in the present invention. Preferably, the strain used is T. pedis deposited by HIPRA SCIENTIFIC S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (Inhoffenstrae 7 B 38124 Braunschweig, Germany) under accession number DSM 32663 on Oct. 10, 2017.

    [0092] Treponema medium refers to a bacterial species as defined in Umemoto T, Nakazawa F, Hoshino E, Okada K, Fukunaga M, Namikawa I. Treponema medium sp. nov., isolated from human subgingival dental plaque. Int J Syst Bacteriol. 1997 January; 47(1):67-72. The definition also encompasses isolates from Treponema medium-like species from other sources such as ruminant, porcine, ovine, human, etc. Some examples of T. medium strains are: T18A, T19, T35B1, 3C14, B-8307. Any T. medium strain is suitable to be used in the present invention. Treponema phagedenis is described in Standards in Genomic Sciences 2015; https://doi.org/10.1186/s40793-015-0059-0, Mushtaq et al. 2015. In the present invention, the term Treponema phagedenis refers to any strains that belong to the species T. phagedenis, in particular to bacterial strains having a sequence identity over the whole 16S rRNA gene of Treponema phagedenis' strain V1 of at least 90%, at least 95%, at least 98%, preferably of at least 99%. Some examples of T. phagedenis strains are V1, V2, T413, T551B, T603, B-7330. Any T. phagedenis strain is suitable to be used in the invention. Preferably, the strain used is T. phagedenis deposited by HIPRA SCIENTIFIC S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (Inhoffenstrae 7 B 38124 Braunschweig, Germany) under accession number DSM 32950 on Nov. 7, 2018.

    [0093] A Treponema, or other digital dermatitis causative pathological agents, protein or polypeptide or antigen refers to a polymer of amino acid residues and are not limited to a minimum length of the product. Peptides, oligopeptides, dimers, multimers are included in the definition. It includes allelic variations normally found in the natural population and changes introduced by recombinant techniques. Those of skill recognize that proteins can be modified in a variety of ways including the addition, deletion and substitution of amino acids. Specific treponema, or other digital dermatitis causative pathological agents, proteins, polypeptides or antigens useful in the present invention without any limitation are:

    [0094] T. pedis PrtP (Serine-protease Complex PrtP-like Protein) and PrtPM (PrtP Mature Protein) proteins refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 1 or 2 respectively, or immunogenic fragments thereof.

    TABLE-US-00001 SEQ.IDNO1(PrtP,T.pedis): MKKILVLSAVLAILAGSCSFNIDPQNISSNEQRVQSMEALYGNSSS VIPYAPKDEDTVDGFFIVKTKDGFDKTAFEEKGFTVKGALPLTGTG FTYWYLNKEGNDKKNLSVISSVKGVISAESDYKVEPPDGIKVAKTV DGGGLVDISRLINGDYSGDPIANNSDYGLSITEALKAYKEIGYGDK TVVAGIIATGINMTHKDFKDENGNSIVLYAKSCVKSNGGTYIGNGN PFTEIPIGENWDKGAAGTHCSGTICARGDNNAGIAGVAWKNTKLIS YQSLDVDGGGSAWAVYGALADLTRTVNILRKPKSDRTLDENNALPS YLKNEDFQITQKTVPVNMSLGGSYGTEFAFSVLTAAVKNNILPVIA MGNEGRYTAAYPAAFPGMLAVGATNGKDKKVHFSNKGAWISISAPG DGIKSCGISGDDDYETMSGTAMATPFVTGVISYLLSFNNAHNLTPY QIKSLLEKTADKVDGAVSFTEGYGHGRVNVYNAAKAIRENSIPQVN EIYSEGSVYVEVKNNNEVIASKISLVDEETKVPLAYVAGLGNNPVV EFKGLVKGKSYSVYASLLKYAKKETFTADGSDKTVTIQFNKNLAWV STVPSLHYNGGNEQPDTKIIVFKADSSGNLSRSPSPILIYDKDYLD TAYFEYESGAEYYAEITGLKDEQGIFRGGNYVVKIGLTPLDLNGED IIDGSRVASDNDTHEDDDEPDKAKLKGNAWEKKYACNLAAHGTNNE DIDFFYIKMP SEQIDNO2(PrtPmatureprotein(PrtPM), T.pedis): GDPIANNSDYGLSITEALKAYKEIGYGDKTVVAGIIATGINMTHKD FKDENGNSIVLYAKSCVKSNGGTYIGNGNPFTEIPIGENWDKGAAG THCSGTICARGDNNAGIAGVAWKNTKLISYQSLDVDGGGSAWAVYG ALADLTRTVNILRKPKSDRTLDENNALPSYLKNEDFQITQKTVPVN MSLGGSYGTEFAFSVLTAAVKNNILPVIAMGNEGRYTAAYPAAFPG MLAVGATNGKDKKVHFSNKGAWISISAPGDGIKSCGISGDDDYETM SGTAMATPFVTGVISYLLSFNNAHNLTPYQIKSLLEKTADKVDGAV SFTEGYGHGRVNVYNAAKAIRENS

    [0095] T. pedis TlyC (Hemolysin C) protein refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 3, or immunogenic fragments thereof.

    TABLE-US-00002 SEQ.IDNO3(TlyC,T.pedis): MGLFDKFKKKPNVSQILKNGLNDEKRDMIRGIVDLSDTAVKEVMIP RIDVDFLSLDTPGNEILDKISESGHSRFPVYEDSIDNVIGILYVKD ILKLLPKNEKIDLKKVVRKAFFVPESKRIDDLLREFKRRHLHIAIA VDEYGGTSGIVCMEDIIEEIVGDIQDEFDNEGEDITKIGEGVWLCD ARIDLDDLKEAIDAEDLPADEFETLGGFVFDLFGKIPVKYEKAVWQ NYDFIVQDMDGHKVKTVKIILNKEALKPEAE

    [0096] T. pedis MSP (Major Outer Sheath Protein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 4, or immunogenic fragments thereof.

    TABLE-US-00003 SEQ.IDNO4(MSP,T.pedis): MKKILSILIALVLVGGAVFAQDAPEMPAPVFKGSATLSWGIDLGYG TDKYGSALISHGFLNEATASVSLPFVKSGSKKGEGDVYALINLDGV KLGLEADLKEAKATGKIDKVEAKIVFYGAYITVYNAPEMKTKYAAD ATSLINDDNFGIFNSGFGGYGTKIGYANPDLMDLDVGIKFTSNGSW KDRDGSLGAEYVKTVTVKANRVNGTGTVHLEDGQELRDMSGKVVER GPGWKRVPSGQYMIYRSAYYRYRMNGHYGLGIDFHMAPVDKYLTVD ANFNMTFDTAGSYRTDVESNFDDMRVMNVGAMIKSEPIDGLMFKLG FDGGHAFKKASDASAPLFAWALGFGTEYKDSRAGTINAGLYVSSDG TPYGNAGIFDPYKLNFVPDGKGGFKEEKRPDGTRPGRGITDIAFTV GYSGLPAVEGLDLHARLNVFGLLSKISKEERAMGELIPLGLNVGAG YKAMLTDSIWIKPYADLWGETNSDIYSDDTPKSKQKLYFGLAYKVG LSVSPMERLTIDLNWSHGKAFNPDVLMGTGSMFGLGQWRSTPFQHK ADNGRFVVSAKITY

    [0097] T. pedis OrfC (Surface Antigen OrfC Lipoprotein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 5, or immunogenic fragments thereof.

    TABLE-US-00004 SEQ.IDNO5(OrfC,T.pedis): MQKIKKKLSFVFFLFTFSVFAEFNFDLIVQPFTGTEFFVDGKTVKP LVLEKDNTLAKVRLILKDSASAIEVKNKGFRTVNLTDELIRLKNDV GKTADLKAPFSIKALAILSRKESKFDTKAFFPTGRQPKSVTFVNSD TVAVALLDGNGADIINIETGEKKRISPPKEYAEKLGFVEALVLKNK NELWISQMPTALIHVFNLTTFEYKTAVKTSGKWSKVMAYNPLTDRV YLSNWQTFDISVINTETYSEEKKIKTKAVPRGMAFSEDGKFIYCAQ FEDAAGNSNCRLVKKELDTFKTVSESGMKGAKRHIVTDYKQGRLYV SDMLNAVIEVYSLKDESLIKTVKVFSHPNTIQLSPDGKFLYVSCRG PNNPDKGYLYKGYVMGRLDIIDTETLTRIESVEAGNQPTGLDISPD GKTIVLSDFLDNRIRVFKKN

    [0098] T. vincentii PrtP (Serine-protease Complex PrtP-like Protein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 6, or immunogenic fragments thereof.

    TABLE-US-00005 SEQ.IDNO6(PrtP,T.vincentii): MIKQKKFRFTLFFITSALAAVFAGCAMGFVNNSAKSDGTGSVHGTA DSNTVFNSKWIISQQERHDKGTVVREGYSIVKTVDSFNPDSFTALN GSVAATQDLHDGYLYFLIKTESDAAQFRTAVRTLEGVLYAQPDYHY DAPAAMVDNTARPPVRNRGAAGKGTLGTADGNLDNDPKAALADWGL TATGALEAFKRYDAKYPVLAAIIDTGVNSLHEDFYDKNNKSIILYA KSSLHRGDVTQYTNPIPISLDENWDNHGHGTHCSGTIAAVGNNGIG ICGVSHANTKLITYRGLDASGGDTYATYSCLGDLAEIITELRKEPG SRNSAVFAGLPPDVINYPQLRQKTVPVNLSLGGPAGHPYEVEMMNK ALAAGVLPVIAMGNDGKTLAEYPAALQGILAVGATTMDDTRAAFSN GGTWMSVCAPGESIYSCGNGGQNWANSHSPDVKSSYRWMSGTSMAT PFVTGVVTYLLSINPDLSPYQIKALLENTADKIDRGSPYGQYDSRG FSKWYGYGRVNVLKATEALVTGSNIPAEGSVYSEKAVMITLKKAGA AQKKTPVWLYEKATGICAAVGLTDETNGIVRFYGLRTGLEYEIGVN DAGTYKTYIITATNDSDIDYTFLL

    [0099] T. vincentii PrtPM (PrtP Mature Protein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 7, or immunogenic fragments thereof.

    TABLE-US-00006 SEQ.IDNO7(PrtPmatureprotein(PrtPM), T.vincentii): NDPKAALADWGLTATGALEAFKRYDAKYPVLAAIIDTGVNSLHEDF YDKNNKSIILYAKSSLHRGDVTQYTNPIPISLDENWDNHGHGTHCS GTIAAVGNNGIGICGVSHANTKLITYRGLDASGGDTYATYSCLGDL AEIITELRKEPGSRNSAVFAGLPPDVINYPQLRQKTVPVNLSLGGP AGHPYEVEMMNKALAAGVLPVIAMGNDGKTLAEYPAALQGILAVGA TTMDDTRAAFSNGGTWMSVCAPGESIYSCGNGGQNWANSHSPDVKS SYRWMSGTSMATPFVTGVVTYLLSINPDLSPYQIKALLENTADKID RGSPYGQYDSRGFSKWYGYGRVNVLKATEALVTGSN

    [0100] T. phagedenis Hemolysin III refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 8, or immunogenic fragments thereof.

    TABLE-US-00007 SEQ.IDNO8(HemolysinIII,T.phagedenis): MTNKIKRRYTVGEEIANAITHGVGVGLSIAALVLLIVRANRYAPPE LKAGYIVGFSIFGASLIILYLFSTLYHALPLGAKKVFQIFDHCSIY ILIAGTYTAFCLTALHGAIGWTIFGIIWGFAIAGIVLYAIFQNKFP IFSLITYIVMGWIIIFAARPLKSQLPSISFLFLILGGIVYTAGCIF FALKKIRWMHTIWHFFVLGGSILHFFSMYYSL

    [0101] D. nodosus Apr2 (Acidic Extracellular Subtilisin-like Protease Apr2) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 9, or immunogenic fragments thereof.

    TABLE-US-00008 SEQ.IDNO9(Apr2,D.nodosus): MKRFIMNKMALVVCAALVGQVASAETMVNYASAKAIGKQPAGSVRF IVKYKDNSQSSKDLKNRSTTKVMANGMQVAGFNAQFVRMTGAGAGI FSVPDLKTTKEAHLVMDTIASNPDVEFVEVDRIARPTAAPNDQHYR EQWHYFDRYGVKADKVWDMGFTGQNVVVAVVDTGILHHRDLNANVL PGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGRPDPRKERSD SSWHGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRALGRCGGYDSD ISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCSYNAQTMIDR ATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATTSRGIRASFS NYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGTSMATPHVSG VAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLDRALGSGIVD AEAAVNSVLGNEGNNGRDDRRDNVAPVENARNYANNSIKFIRDYRL TSSVIEVEGRSGAANGKINLALDIRHGNRSQLSIQLTSPAGHVYHI NHDGARRPNLSGTVEIPVQNEQINGAWVLQVGDHGRGATGYIKSWS LTL

    [0102] D. nodosus Apr2BM (Apr2 Benign Mature Protein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 10, or immunogenic fragments thereof.

    TABLE-US-00009 SEQ.IDNO10(Apr2benignmatureprotein (Apr2BM),D.nodosus): AAPNDQHYREQWHYFDRYGVKADKVWDMGFTGQNVVVAVVATGILH HRDLNANVLPGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGR PDPRKERSDSSWAGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRAL GRCGGYDSDISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCS YNAQTMIDRATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATT SRGIRASFSNYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGT AMATPHVSGVAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLD RALGSGIVDAEAA

    [0103] D. nodosus Bpr (Basic Extracellular Subtilisin-like protease Bpr) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 11, or immunogenic fragments thereof.

    TABLE-US-00010 SEQ.IDNO11(Bpr,D.nodosus): MNLSNISAVKVLTLVVSAAIAGQVCAAESIVNYESANAISKQPEGS VRFIVKYKDGTPSSQGLKTRSTTKVMASGMQVAGFEAQFVRTTGLG AGIFAVPELKTTKEAHLVMDTIASNPDVEFVEVDRLAYPKAAPNDP SYRQQWHYFSNYGVKADKVWDRGFTGQGVVVSVVDTGILDHVDLNG NMLPGYDFISSAPKARDGDQRDNNPADEGDWFDNWDCGGYPDPRRE KRFSTWHGSHVAGTIAAVTNNGVGVAGVAYGAKVIPVRVLGKCGGY DSDITDGMYWSAGGHIDGVPDNQNPAQVINMSLGGDGDCSQSSQRI IDKTTNLGALIVIAAGNENQDASRTWPSSCNNVLSVGATTPKGKRA PFSNYGARVHLAAPGTNILSTIDVGQAGPVRSSYGMKAGTSMAAPH VSGVAALVISAANSIGKTLTPSELSDILVRTTSRFNGRLDRGLGSG IVDANAAVNAVLGDQNRAQPRPPVNQPINSGNKVYRSDRRVAIRDL RSVTSGIRVNDQARVGSANITLTLDIRHGDRSQLAVELIAPSGRVY PIYHDGKRQPNIVGPATFSVKNERLQGTWTLKVTDKARGVTGSIDS WSLTF

    [0104] D. nodosus BprM (Bpr Mature Protein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 12, or immunogenic fragments thereof.

    TABLE-US-00011 SEQ.IDNO12(Bprmatureprotein(BprM), D.nodosus): AAPNDPSYRQQWHYFSNYGVKADKVWDRGFTGQGVVVSVVATGILD HVDLNGNMLPGYDFISSAPKARDGDQRDNNPADEGDWFDNWDCGGY PDPRREKRFSTWAGSHVAGTIAAVTNNGVGVAGVAYGAKVIPVRVL GKCGGYDSDITDGMYWSAGGHIDGVPDNQNPAQVINMSLGGDGDCS QSSQRIIDKTTNLGALIVIAAGNENQDASRTWPSSCNNVLSVGATT PKGKRAPFSNYGARVHLAAPGTNILSTIDVGQAGPVRSSYGMKAGT AMAAPHVSGVAALVISAANSIGKTLTPSELSDILVRTTSRFNGRLD RGLGSGIVDANAA

    [0105] D. nodosus Apr5 (Acidic Extracellular Subtilisin-like Protease Apr5) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 13, or immunogenic fragments thereof.

    TABLE-US-00012 SEQ.IDNO13(Apr5,D.nodosus): MKQSGINGVKTLTLVVCAALASQAYAAVNYESANYIGSQPEGSVRF IIKYKDKSQSQQMMTNRSTTSVMNNNNITIAGFNAQFVRTMTIGAG IFAVPDLKTTKEAHLVMDTIASNPDVEYVEVDRWLRPFAAPNDPFY NDQWHYYSEYGVKADKVWDRGITGKGVTVAVVDTGIVNHPDLNANV IPGSGYDFIQEAEIAQDGDGRDSNPADAGDWHSNWACGKYPDPRYE KRNSSWHGSHVAGTIAAVTNNRIGVSGVAYDAKIVPVRVLGRCGGY NSDINEGMYWAAGGHIDGVPDNKHPAQVINMSLGGPGVCGSTEQTL INRATQLGATIIVAAGNDNIDAYGVTPASCDNILTVGATTSNGTRA YFSNHGSVVDISAPGAGITSTVDSGARYPSGPSYSLMDGTSMATPH VAGVAALVISAANSVNKEMTPAQVRDVLVRTVSSFNGTPDRRIGAG IVDADAAVNAVLDGNVVERPIDELKPQAEYRNPQIKLIRDYQMMFS EIKVNGRPGNTKFAVVKADIRHTDPSQLKLRLVSPKGYEYAVHYDN IKNKSSELITFPRDEQMNGYWRLKIVDTKRGVTGYTRGWSVAF

    [0106] D. nodosus Apr5M (Apr5 Mature Protein) refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 14, or immunogenic fragments thereof.

    TABLE-US-00013 SEQ.IDNO14(Apr5matureprotein(Apr5M), D.nodosus): AAPNDPFYNDQWHYYSEYGVKADKVWDRGITGKGVTVAVVATGIVN HPDLNANVIPGSGYDFIQEAEIAQDGDGRDSNPADAGDWHSNWACG KYPDPRYEKRNSSWAGSHVAGTIAAVTNNRIGVSGVAYDAKIVPVR VLGRCGGYNSDINEGMYWAAGGHIDGVPDNKHPAQVINMSLGGPGV CGSTEQTLINRATQLGATIIVAAGNDNIDAYGVTPASCDNILTVGA TTSNGTRAYFSNHGSVVDISAPGAGITSTVDSGARYPSGPSYSLMD GTAMATPHVAGVAALVISAANSVNKEMTPAQVRDVLVRTVSSFNGT PDRRIGAGIVDADAA SEQ.IDNO15(MajorOuterSheathProtein(MSP), T.phagedenis): MKKYLIAFSIFAFALGIAFAQEAEAAEPAQKAAAAEPAQKAAAAEP AKEPEVYALTSGAKASIEGSTKLEWGIDLGAGKVTKDSIAHGFKNS GSWKVSFPLFEKKSFTSKADTPVYAEVIIKDVELGIQSKNKSKKEK DFAFTGKVDEIVGTLYFYDAYLKIYKKPGFKVNYAQIWDPLKADDW DKSGYKFEPGFDIAGGTTLGYKKDNIGNSGLDLDAGVKFGSNGNWE TEGKSDYEGSPQYALITGPATLAKGSTYVELEPVYGKEAEEKASYI MLDNQRFKITSNFKKVSPDKDLEVKEGKYYAKIDGLTKKDTPATKN RYGMGFYTSVAYKPGDLKYIGFNFDINTTFCSHKDWENNTEKGNYF NVSFGTKITSEPVKDLSLVLAFDGEPFVNGEKKFAWDMLFDTTYKW VGAGVYVGNENTFYKSNKDKVDMSIYAKFETKGDKKKANFLVENLN AGAAIYVHHLLSKPVSPKTVPIGLKVYADYKYDINDSMWLKPYASF YGETNHAEPKFGVYYNVGLTFSPLERLELTADWEQGKVVKNKHEGF IEKSAGKEHNGRFKLGCKVSF

    [0107] MSP (Major Outer Sheath Protein) T. phagedenis refers to a protein having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, preferably at least 99% sequence identity to SEQ ID NO: 15, or immunogenic fragments thereof.

    [0108] Other candidate proteins, polypeptides or antigens useful in the present invention are selected from known virulence factors such as adhesins, peptidases, proteases, surface antigens, proteins involved in motility and haemolysins. Preferably selected from the following list: [0109] PcrB (Serine-protease Complex PrcB-like protein); [0110] PcrA (Serine-protease Complex PrcA-like protein); [0111] Cys peptidase; [0112] Hemolysin erythrocyte lysis protein 2; [0113] Surface antigen BspA; [0114] Filament protein; [0115] Flagellar hook protein; [0116] Prolyl endopeptidase; [0117] Oligopeptidase; [0118] Oligopeptidase B; and [0119] Oligopeptidase F.

    [0120] Treponema, or other digital dermatitis causative pathological agents,nucleic acids and polynucleotides, as used herein, may be DNA or RNA. One of skill will recognize that for use in the expression of Treponema proteins or as diagnostic probes, polynucleotide sequences need not be identical and may be substantially identical to sequences disclosed here. In particular, where the inserted polynucleotide sequence is transcribed and translated to produce a functional polypeptide, one of skill will recognize that because of codon degeneracy a number of polynucleotide sequences will encode the same polypeptide.

    [0121] Biological sample refers to any sample obtained from a living or dead organism. Examples of biological samples include biological fluids and tissue specimens. Examples of tissue specimens also include hoof and foot tissue. Such biological samples can be prepared for analysis using in situ techniques.

    [0122] A biologically pure culture or biological pure culture refers to a continuous in vitro culture of ungulate Treponema which is substantially free of other organisms. A culture is substantially free of other organisms if standard harvesting procedures (as described below) result in a preparation which comprises at least about 90%, preferably 99% or more of the organism, e.g., Treponema.

    [0123] Percentage of sequence identity for polynucleotides and polypeptides is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Optimal alignment of sequences for comparison may be conducted by computerized implementations of known algorithms (BLAST in the resources of the National Center for Biotechnology Information, CLUSTAL in the resources of the European Bioinformatics Institute, GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection.

    [0124] Substantial identity of polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 75% sequence identity, preferably at least 80%, more preferably at least 90% and most preferably at least 95%. Typically, two polypeptides are considered to be substantially identical if at least 40%, preferably at least 60%, more preferably at least 90%, and most preferably at least 95% are identical or conservative substitutions. Sequences are preferably compared to a reference sequence using GAP using default parameters.

    [0125] Another indication that polynucleotide sequences are substantially identical is if two molecules hybridize to each other under stringent conditions. Stringent conditions are sequence dependent and will be different in different circumstances. Generally, stringent conditions are selected to be about 5 DEG C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically stringent conditions for a Southern blot protocol involve washing at room temperature with a 5.times.SSC, 0.1% SDS wash.

    [0126] The phrase specifically or selectively hybridizing to, refers to hybridization between a probe and a target sequence in which the probe binds substantially only to the target sequence, forming a hybridization complex, when the target is in a heterogeneous mixture of polynucleotides and other compounds. Such hybridization is determinative of the presence of the target sequence. Although the probe may bind other unrelated sequences, at least 90%, preferably 95% or more of the hybridization complexes formed are with the target sequence.

    [0127] Antibody refers to an immunoglobulin molecule able to bind to a specific epitope on an antigen. Antibodies can be a polyclonal mixture or monoclonal. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies may exist in a variety of forms including, for example, Fv, Fab, and F(ab)2, as well as in single chains. Single-chain antibodies, in which genes for a heavy chain and a light chain are combined into a single coding sequence, may also be used.

    [0128] Immunogenic or immunological composition refers to material which elicits an immunological response in the host of a cellular or antibody-mediated immune response type to the composition upon administration to a vertebrate, including humans. The immunogenic composition comprises molecules with antigenic properties, such as killed or attenuated bacteria or virus, among others and also immunogenic polypeptides. An immunogenic polypeptide is generally referred to as antigenic. A molecule is antigenic when it is capable of specifically interacting with an antigen recognition molecule of the immune system, such as an immunoglobulin (antibody) or T cell antigen receptor. An antigenic polypeptide contains an epitope of at least about five, and particularly at least about 10, at least 15, at least 20 or at least 50 amino acids. An antigenic portion of a polypeptide, also referred to as an epitope, can be that portion that is immunodominant for antibody or T cell receptor recognition, or it can be a portion used to generate an antibody to the molecule by conjugating the antigenic portion to a carrier polypeptide for immunization. The immunogenic composition relates according to this description, to the active molecule, composition comprising said molecule, or composition comprising more than one antigenic molecule to which a particular immune reaction is desired. Examples of immunogenic compositions include the supernatants of microorganism cultures, including bacteria, protozoa and viruses. Said supernatants contain those antigenic molecules of interest for initiating an immune response against thereto and that have been released (exotoxins) or delivered to the culture media where microorganisms grew and after the microorganism cells or particles (viruses) have been separated. The supernatants are also termed herewith as cell-free preparations.

    [0129] Antigen refers to a molecule against which a subject can initiate an immune response, e.g. a humoral and/or cellular immune response. Depending on the intended function of the composition, one or more antigens may be included.

    [0130] Immunologically effective amount, or immunologically effective dose means the administration of that amount or dose of antigen, either in a single dose or as part of a series, that elicits, or is able to elicit, an immune response that reduces the incidence of or lessens the severity of infection or incident of disease in an animal for either the treatment or prevention of disease. The immunologically effective amount or effective dose is also able for inducing the production of antibody for either the treatment or prevention of disease. This amount will vary depending upon a variety of factors, including the physical condition of the subject, and can be readily determined by someone of skill in the art.

    [0131] Vaccine as used herein, means an immunogenic composition of the invention accompanied by adequate excipients and/or carriers, that when administered to an animal, elicits, or is able to elicit, directly or indirectly, an immune response in the animal. Particularly, the vaccines of the present invention elicit an immunological response in the host of a cellular or antibody-mediated type upon administration to the subject that it is protective. The term combination vaccine means that the vaccine contains various antigens in a single preparation, protecting against two or more diseases or against one disease caused by two or more microorganisms. Thus the vaccine includes as active principle an immunogenic composition, according to the invention.

    [0132] Medicament as used herein is synonymous of a pharmaceutical or veterinary drug (also referred to as medicine, medication, or simply drug) use to cure, treat or prevent disease in animals, including humans, as widely accepted. Drugs are classified in various ways. One key distinction is between traditional small-molecule drugs, usually derived from chemical synthesis, and biopharmaceuticals, which include recombinant proteins, vaccines, blood products used therapeutically (such as IVIG), gene therapy, monoclonal antibodies and cell therapy (for instance, stem-cell therapies). In the present invention medicament preferably is a veterinary medicament, and even more preferably is a vaccine for veterinary use.

    [0133] The phrase specifically immunoreactive with, when referring to a protein or peptide, refers to a binding reaction between the protein and an antibody which is determinative of the presence of the protein in the presence of a heterogeneous population of proteins and other compounds. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein and do not bind in a significant amount to other proteins present in the sample. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein and are described in detail below.

    [0134] The phrase substantially pure or isolated when referring to a Treponema peptide or protein, means a chemical composition which is free of other subcellular components of the Treponema organism. Typically, a monomeric protein is substantially pure when at least about 85% or more of a sample exhibits a single polypeptide backbone. Minor variants or chemical modifications may typically share the same polypeptide sequence. Depending on the purification procedure, purities of 85%, and preferably over 95% pure are possible. Protein purity or homogeneity may be indicated by a number of means well known in the art, such as polyacrylamide gel electrophoresis of a protein sample, followed by visualizing a single polypeptide band on a polyacrylamide gel upon silver or Coomasie staining. For certain purposes high resolution will be needed and HPLC, FPLC or a similar means for purification utilized.

    [0135] A label is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, or chemical means. For example, useful labels include .sup.32 P, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, dioxigenin, or haptens and proteins for which antisera or monoclonal antibodies are available.

    [0136] The term recombinant when used with reference to a cell, or nucleic acid, or vector, indicates that the cell, or nucleic acid, or vector, has been modified by the introduction of a heterologous nucleic acid or the alteration of a native nucleic acid, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.

    [0137] Pharmaceutically acceptable means a material that is not biologically or otherwise undesirable, i.e., the material can be administered to an individual along with a Treponema antigen without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition.

    [0138] Preventing, to prevent or prevention, include without limitation, decreasing, reducing or ameliorating the risk of a symptom, disorder, condition, or disease, and protecting an animal from a symptom, disorder, condition, or disease. A prevention may be applied or administered prophylactically.

    [0139] Treating, to treat or treatment, include without limitation, restraining, slowing, stopping, reducing, ameliorating, or reversing the progression or severity of an existing symptom, clinical sign, disorder, condition, or disease. A treatment may be applied or administered therapeutically.

    [0140] Subject means an individual. In one aspect, a subject is a mammal such as a primate, including humans. In another aspect, the mammal is a non-human primate such as marmosets, monkeys, chimpanzees, gorillas, orangutans and gibbons among others. The term subject also includes domesticated animals such as cats, dogs, etc.; livestock such as for example cattle, horses, pigs, sheep, goats, etc.; laboratory animals for example ferret, chinchilla, mouse, rabbit, rat, gerbil, guinea pig, etc.; and avian species such as chicken, turkeys, ducks, pheasants, pigeons, doves, parrots, cockatoos, geese, etc. Subjects can also include, but are not limited to fish (for example, zebrafish, goldfish, tilapia, salmon and trout), amphibians and reptiles. As used herein, a subject is the same as a patient or affected subject, and the terms can be used interchangeably.

    Description

    [0141] The present invention provides new pharmaceutical and/or vaccine compositions comprising Treponema spp. bacterins, optionally supplemented with antigens from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum. Said vaccine compositions are preferably for effectively immunizing susceptible mammals, preferably ungulates, against DD, in particular against bovine digital dermatitis, and wherein said Treponema spp. bacterins are preferably selected from T. pedis, T. phagedenis, T. vincentii, T. medium, T. refringens, T. calligyrum, T. maltophilum and/or T. brennaborense, preferably from T. pedis or T. phagedenis.

    [0142] In addition, the present invention provides isolated antigens, preferably recombinant antigens, from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, in a variety of applications, including the production of nucleic acids and proteins for diagnostic assays for digital dermatitis and the preparation of immunogenic proteins and compositions for use in digital dermatitis vaccine compositions, wherein in these compositions said antigens are used in combination with an immunogenically effective amount of a Treponema spp. bacterin, preferably with an immunogenically effective amount of a Treponema pedis bacterins, or preferably with an immunogenically effective amount of a bacterin selected from the group consisting of: Treponema medium, Treponema vincentii, Treponema phagedenis, Treponema refringens, Treponema brennaborense, Treponema calligyrum, and Treponema maltophilum, or any combination thereof. In a preferred embodiment, said antigens are isolated antigens from Treponema spp. such us but not limited to T. pedis, selected from the list consisting of MSP (Major Outer Sheath Protein), PrtP (Serine-protease Complex PrtP-like Protein), TlyC (Hemolysin C), OrfC (Surface Antigen OrfC Lipoprotein), and Hemolysin III. In a more preferred embodiment, said antigens are isolated antigens from Treponema pedis and are selected from the list consisting of MSP (Major Outer Sheath Protein), PrtP (Serine-protease Complex PrtP-like Protein), preferably PrtPM (PrtP Mature Protein), TlyC (Hemolysin C), and OrfC (Surface Antigen OrfC Lipoprotein); and/or antigens MSP and Haemolysin III from Treponema phagedenis; and/or antigens PrtP, preferably PrtPM, from Treponema vincentii; and/or antigens Apr2 (Acidic Extracellular Subtilisin-like Protease Apr2), preferably Apr2BM (Apr2 Benign Mature Protein), Apr5 (Acidic Extracellular Subtilisin-like Protease Apr5), preferably Apr5M (Apr5 Mature Protein), and Bpr (Basic Extracellular Subtilisin-like Protein Bpr), preferably BprM (Bpr Mature Protein), from Dichelobacter nodosus; as well as other candidate proteins, polypeptides or antigens useful in the present invention selected from virulence factors such as adhesins, peptidases, proteases, surface antigens, proteins involved in motility, and haemolysins. In yet another preferred embodiment, said polypeptides or antigens useful in the present invention can be selected from the following list: [0143] PcrB (Serine-protease Complex PrcB-like protein); [0144] PcrA (Serine-protease Complex PrcA-like protein); [0145] Cys peptidase; [0146] Hemolysin erythrocyte lysis protein 2; [0147] Surface antigen BspA; [0148] Filament protein; [0149] Flagellar hook protein; [0150] Prolyl endopeptidase; [0151] Oligopeptidase; [0152] Oligopeptidase B; and [0153] Oligopeptidase F;
    and use in a variety of applications, including the production of nucleic acids and proteins for diagnostic assays for digital dermatitis and the preparation of immunogenic proteins and compositions for use in digital dermatitis vaccine compositions optionally comprising bacteria pertaining to the Treponema spp. Preferably, the above said digital dermatitis vaccine compositions comprising bacteria pertaining to the Treponema spp., comprise at least one or more of the following treponema species: T. pedis, T. phagedenis, T. vincentii, T. medium, T. refringens, T. calligyrum, T. maltophilum and/or T. brennaborense.

    [0154] On the other hand, the present invention identifies Treponema pedis as one of the etiologic agents of digital dermatitis (DD) in mammals, in particular ungulate digital dermatitis. The invention therefore further provides isolated cultures of Treponema pedis for effectively immunizing susceptible mammals, preferably ungulates, against DD, in particular against bovine digital dermatitis, and methods of diagnosing DD by detecting infection with a series of specific Treponema antigens.

    [0155] The invention thus provides for a, preferably biologically pure, culture of Treponema spp. bacterins, preferably Treponema pedis bacterins or T. phagedenis, T. vincentii, T. medium, T. refringens, T. calligyrum, T. maltophilum and/or T. brennaborense, optionally supplemented or in combination with one or more isolated antigens from Treponema spp. or with other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, for use as a vaccine.

    [0156] Such antigens are already listed above.

    [0157] All of the above identified aspects and embodiments of the invention, are based on the surprising findings that Treponema spp. bacterins effectively immunized mammals against digital dermatitis, in particular against bovine digital dermatitis. In this sense, in Example 1, the in vitro immunogenicity of experimental vaccines against an experimental infection of BDD was assessed. The in vivo efficacy against an experimental infection of BDD in calves for these vaccines was also tested. The materials and methods associated to these vaccines, their preparation as well as the qualitative and quantitative composition, the vaccination protocol and animals used are described in the examples section.

    [0158] As illustrated in the results provided in example 1, vaccines B (4 recombinant proteins alone without Treponema bacterins) and D (placebo) were clearly not effective. In contrast, with vaccines A (Treponema pedis bacterin+4 recombinant proteins) and C (Treponema pedis bacterin alone), the authors of the present invention did not only obtain a strong response against T. pedis but also against T. phagedenis. Since none of the formulations tested contained T. phagedenis, this can only be explained in virtue of a potential cross-reactivity. In addition, there was no difference between using adjuvant A or B. Moreover, there was an increase in the immunological response of the combined vaccine (bacterin+recombinants) in respect of the vaccine comprising the bacterium alone (A vs C), demonstrated with the serum titter at day 47 post-vaccination.

    [0159] In addition, as shown in example 2, the authors assessed the in vivo efficacy of 2 experimental vaccines against an experimental infection of BDD in calves and confirm the results commented above. From this last experiment it is very interesting to note that when compared any of vaccines A or B with vaccine number C from the previous set of experiments shown in example 1, it is apparent that most of the potential therapeutic effect is attributable to the Treponema bacterin, whereas the recombinant antigens used in vaccine A of the previous experiment seem to enhance the immunological reaction of a vaccine comprising inactivated T. pedis bacterin.

    [0160] Furthermore, the application additionally discloses, in particular in example 4, the immunogenicity of an experimental T. phagedenis vaccine against BDD, wherein an immunological response against the different Treponema spp. tested (T. pedis, T. phagedenis and T. medium) was clearly observed from animal's sera of Group 2. Since the vaccine formulation of Group 2 did not contain T. pedis or T. medium bacterins, the immunological response observed in vaccinated animals can be attributed to the cross-reactivity between Treponema spp. (FIG. 10). Furthermore, a clear inhibitory effect on the in vitro growth of T. phagedenis with the sera of calves vaccinated with the T. phagedenis bacterin (Group 2) was observed. This inhibitory effect was not observed for the control group.

    [0161] These results suggest that the immunological response observed in vaccinated animals can be attributed to the cross reactivity between Treponema species which share some epitopes which are responsible for that cross reaction.

    [0162] Moreover, the application further discloses, in particular in example 5, the immunogenicity of an experimental T. phagedenis vaccine complemented with antigens against BDD, wherein an immunological response against all the antigens present in the vaccine composition in animal's sera of vaccinated Group 2 was clearly observed. Furthermore, the immunological response against the MSP protein of T. phagedenis was increased when the bacterin was complemented with the recombinant proteins (Group 2). Even though, Group 3 (bacterin alone) developed a clear immunological response as well. Contrary, the control group (Group 1) did not develop an immunologically response to any of the tested antigens.

    [0163] Moreover, a clear inhibitory effect on the in vitro growth of T. phagedenis was observed in the sera of vaccinated calves of Group 2 (bacterin+recombinant proteins) and Group 3 (bacterin alone). These results demonstrate the presence of neutralizing antibodies in animals vaccinated in Group 2 and 3.

    [0164] Consequently, these findings indicate that Treponema species share some epitopes, probably outer membranes or flagellar epitopes, which are responsible for the cross reactivity and are conserved between different species of Treponema spp. These epitopes are clearly involved in protection in view of the results obtained thus far in an experimental infection in calves by using two different experimental Treponema spp. vaccines.

    [0165] Thus, the results provided herein thus make it feasible to extrapolate the same to any Treponema spp. vaccine compositions, in particular the invention provides, in one aspect, a pharmaceutical composition comprising an immunogenically effective amount of T. pedis, T. phagedenis, T. vincentii, T. medium, T. refringens, T. calligyrum, T. maltophilum and/or T. brennaborense. More particularly, in view of these results, the present invention identifies Treponema pedis and Treponema phagedenis as two of the etiologic agents of digital dermatitis (DD) in mammals, in particular ungulate digital dermatitis. The invention therefore provides isolated cultures of Treponema pedis and Treponema phagedenis vaccines for effectively immunizing susceptible mammals, preferably ungulates, against DD, in particular against bovine digital dermatitis, and methods of diagnosing DD by detecting infection with a series of specific Treponema antigens. Therefore, in one aspect, the invention provides a pharmaceutical composition comprising an immunogenically effective amount of Treponema pedis and/or Treponema phagedenis bacterins, preferably of any T. pedis strains such as but not limited to T3552B, G819CB, T18B, or T354A, or the T. pedis strain deposited by HIPRA SCIENTIFIC S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH (InhoffenstraRe 7 B38124 Braunschweig, Germany) under accession number DSM 32663 on Oct. 10, 2017; or preferably any T. phagedenis strains such as but not limited to V1, V2, T413, T551B, T603, B-7330, or the T. phagedenis strain deposited under the Budapest treaty by HIPRA SCIENTIFIC, S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen under accession number DSM 32950 on Nov. 7, 2018. Preferably, said pharmaceutical compositions further comprise isolated antigens, preferably recombinant antigens, from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum. More preferably, said pharmaceutical composition further comprises isolated antigens from Treponema spp. selected from the list consisting of MSP (Major Outer Sheath Protein), PrtP (Serine-protease Complex PrtP-like Protein), TlyC (Hemolysin C), OrfC (Surface Antigen OrfC Lipoprotein), and Hemolysin III. Even more preferably, said pharmaceutical composition further comprises isolated antigens from Treponema pedis selected from the list consisting of MSP (Major Outer Sheath Protein), PrtP (Serine-protease Complex PrtP-like Protein), preferably PrtPM (PrtP Mature Protein), TlyC (Hemolysin C), and OrfC (Surface Antigen OrfC Lipoprotein); and/or antigens MSP and Haemolysin III from Treponema phagedenis; and/or antigens PrtP, preferably PrtPM, from Treponema vincentii; and/or antigens Apr2 (Acidic Extracellular Subtilisin-like Protease Apr2), preferably Apr2BM (Apr2 Benign Mature Protein), Apr5 (Acidic Extracellular Subtilisin-like Protease Apr5), preferably

    [0166] Apr5M (Apr5 Mature Protein), and Bpr (Basic Extracellular Subtilisin-like Protein Bpr), preferably BprM (Bpr Mature Protein), from Dichelobacter nodosus; as well as other candidate proteins, polypeptides or antigens useful in the present invention selected from adhesins, peptidases, proteases, surface antigens, proteins involved in motility, and haemolysins. Other polypeptides or antigens useful in the present invention are preferably selected from the following list: [0167] PcrB (Serine-protease Complex PrcB-like protein); [0168] PcrA (Serine-protease Complex PrcA-like protein); [0169] Cys peptidase; [0170] Hemolysin erythrocyte lysis protein 2; [0171] Surface antigen BspA; [0172] Filament protein; [0173] Flagellar hook protein; [0174] Prolyl endopeptidase; [0175] Oligopeptidase; [0176] Oligopeptidase B; and [0177] Oligopeptidase F;
    or any combination thereof.

    [0178] In addition, since the recombinant antigens used in the present invention enhanced the immunological response of the exemplified vaccines compositions, the results provided herein thus make it feasible to extrapolate the same to any Treponema spp. vaccine compositions. Therefore, in a further aspect the present invention provides a pharmaceutical composition comprising an immunogenically effective amount of Treponema spp. bacterins, wherein said Treponema spp. bacterins are preferably selected from T. pedis, T. phagedenis, T. vincentii, T. medium, T. refringens, T. calligyrum, T. maltophylum and/or T. brennaborense, preferably from T. pedis or T. phagedenis, and one or more isolated antigens from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum. Such pharmaceutical compositions are useful for effectively immunizing susceptible mammals, preferably ungulates, against DD, in particular against bovine digital dermatitis; wherein such isolated antigens, preferably recombinant antigens, are preferably obtained from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum. More preferably, said antigens are the Treponema antigens selected from the list consisting of: MSP (Major Outer Sheath Protein), PrtP (Serine-protease Complex PrtP-like Protein), TlyC (Hemolysin C), OrfC (Surface Antigen OrfC Lipoprotein), and Hemolysin III. It is noted that all of these antigens can be obtained from Treponema spp. such as but not limited to T. pedis, T. phagedenis, or T. vincentii. Additional antigens useful in the present invention can be selected from other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum. All of these antigens can be used in combination in the pharmaceutical composition of the invention and are preferably recombinantly produced. More preferably, said proteins, polypeptides or antigens useful in the present invention are selected from virulence factors such as adhesins, peptidases, proteases, surface antigens, proteins involved in motility and haemolysins. Even more preferably said proteins, polypeptides or antigens useful in the present invention are selected from the following list: [0179] MSP (Major Outer Sheath Protein); [0180] PrtP (Serine-protease Complex PrtP-like Protein) and PrtPM (PrtP Mature Protein); [0181] TylC (Hemolysin C); [0182] OrfC (Surface Antigen OrfC Lipoprotein); [0183] Haemolysin III; [0184] Apr2 (Acidic Extracellular Subtilisin-like Protease Apr2) and Apr2BM (Apr2 Benign Mature Protein); [0185] Apr5 (Acidic Extracellular Subtilisin-like Protease Apr5) and Apr5M (Apr5 Mature Protein); [0186] Bpr (Basic Extracellular Subtilisin-like Protease Bpr) and BprM (Bpr Mature Protein); [0187] PrcB (Serine-protease Complex PrcB-like protein); [0188] PrcA (Serine-protease Complex PrcA-like protein); [0189] Cys peptidase; [0190] Hemolysin erythrocyte lysis protein 2; [0191] Surface antigen BspA; [0192] Filament protein; [0193] Flagellar hook protein; [0194] Prolyl endopeptidase; [0195] Oligopeptidase; [0196] Oligopeptidase B; and [0197] Oligopeptidase F.

    [0198] Still more preferably, said antigens are antigens selected from the list consisting of MSP, PrtP, preferably PrtPM, TlyC, and OrfC from Treponema pedis; or antigens MSP and Haemolysin III from Treponema phagedenis; or antigens PrtP, preferably PrtPM, from Treponema vincentii; or antigens Apr2, preferably Apr2BM, Apr5, preferably Apr5M, and Bpr, preferably BprM, from Dichelobacter nodosus, or any combination thereof, wherein optionally said antigens are recombinantly produced.

    [0199] The pharmaceutical composition of the invention may further comprise a pharmaceutically acceptable carrier. The carrier suitable for preparing the vaccine in liquid form may include water, or an isotonic saline solution, that is to say, with a salt concentration equal to that of the physiological cellular medium, or an oil, or the culture liquid wherein the bacteria are cultured, or the mixtures thereof.

    [0200] Additionally, if it is desired, the carrier can include other auxiliary substances or pharmaceutically acceptable excipients such as for example wetting agents, dispersant agents, emulsifying agents, buffer agents (for example phosphate buffer), stabilizing agents such as carbohydrates (for example glucose, sucrose, mannitol, sorbitol, starch or dextrans), or proteins (for example albumin, casein, bovine serum or skimmed milk).

    [0201] The physical-chemical characteristics of the excipients as well as the name of the commercial products under which they are marketed can be found in the book R. C. Rowe et al., Handbook of Pharmaceutical Excipients, 4.sup.th edition, Pharmaceutical Press, London, 2003 [ISBN: 0-85369-472-9].

    [0202] The pharmaceutical compositions described above, preferably vaccine compositions, can be used in a variety of pharmaceutical preparations for the treatment and/or prevention of digital dermatitis (DD) in mammals, in particular ungulate digital dermatitis. The pharmaceutical compositions of the present invention are typically used to vaccinate hooved animals such as cattle, sheep, goats and other animals infected by Treponema spp. including humans.

    [0203] The immunogenic cell organism, which is employed as the active component of the present vaccines, comprises attenuated or inactivated DD-associated Treponema spp., preferably inactivated Treponema spp. bacterin, and more preferably an inactivated Treponema pedis or phagedenis bacterin. Inactivation can be achieved i.e by chemical, molecular or heat treatment. These spirochetes can be isolated from subjects affected with DD. The spirochetes can be maintained in infected subjects, or in suitable nutrient media. The immunogenic spirochetes are typically isolated from skin of affected animals and cultured in defined media. The spirochetes culture may be inactivated either by chemical, molecular or heat treatment. Spirochetes also can be inactivated by exposing the culture under aerobic (oxygen) conditions. The inactivation processes render the culture without toxicity while other properties, typically immunogenicity, is maintained.

    [0204] To prepare the vaccine, the spirochetes are first separated from the medium by centrifugation or filtration, or with the use of selective media and the like. The spirochetes can be treated by a number of methods, including chemical treatment, to inactivate them as explained above. The spirochetes suspensions can be dried by lyophilization or frozen in an aqueous suspension thereof to yield inactivated whole cells.

    [0205] The dried or cultured whole cells are then adjusted to an appropriate concentration, optionally combined with a suitable adjuvant, and packaged for use. Suitable adjuvants include but are not limited to: aluminum hydroxide, aluminum phosphate, aluminum oxide, muramyl dipeptides, vitamin E, squalene, squalene, saponins for example Quil A, QS-21, ginseng, zymosan, glucans, non-ionic block polymers, monophosphoryl lipid A, vegetable oils, complete Freund's adjuvant, incomplete Freund's adjuvant, W/O, O/W, W/O/W type emulsions, Ribi adjuvant system (Ribi Inc.), heat-labile enterotoxin from E.coli (recombinant or otherwise), cholera toxin, dimethylaminoehtyldextran, dextrans or analogs or mixtures thereof.

    [0206] Finally, the immunogenic product can be incorporated into liposomes for use in a vaccine formulation, or may be conjugated to polysaccharides or other polymers.

    [0207] The vaccines of the invention are typically prepared as parenteral vaccines in the form of solutions, emulsions or liquid suspensions. They can also be prepared in a solid form suitable to be dissolved or suspended in a liquid vehicle before injection.

    [0208] Particularly, the vaccine is [0209] (a) in liquid form; or [0210] (b) in dry powder form, lyophilized, freeze dried, spray dried, or foam dried.
    The typical volume of a dose of the vaccine of the invention is between 0.1 ml and 5 ml, particularly between 0.15 ml and 3 ml, and more particularly between 0.2 ml and 2 ml.

    [0211] Usually, for intramuscular administration it is used between 0.5 ml and 5 ml, particularly between 1 ml and 3 ml, and more particularly between 1 ml and 2 ml.

    [0212] The liquid vehicles which can be used for preparing the vaccine of the invention include, for example, water (in particular, water for injection), saline solution with a physiological salt concentration, or the culture liquid in which the bacteria are cultured.

    [0213] The vaccine of the invention can be administered by different routes of administration. Particular routes include but are not limited to oral, transdermal, transmucosal, intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous route. Particularly they are administered by intramuscular route. According to the desired duration and effectiveness of the treatment, the compositions according to the invention may be administered once or several times, also intermittently, for example on a daily basis for several days, weeks or months and in different dosages. Particularly, the immunogenic compositions of the invention are administered several times. More particularly the vaccination plan comprises two doses, the second dose administered 3 weeks after the first one. Said vaccine can be prepared according to the normal process used by the person skilled in the art for the preparation of pharmaceutical formulations suitable for the different forms of administration as is described for example in the manual Remington The Science and Practice of Pharmacy, 20.sup.th edition, Lippincott Williams & Wilkins, Philadelphia, 2000 [ISBN: 0-683-306472]. More particularly, the vaccine is for use by intramuscular route.

    [0214] For parenteral administration, the antigen may be combined with a suitable carrier. For example, it may be administered in water, saline or buffered vehicles with or without various adjuvants or immunomodulating agents such as aluminum hydroxide, aluminum phosphate, aluminum potassium sulfate (alum), beryllium sulfate, silica, kaolin, carbon, water-in-oil emulsions, oil-in-water emulsions, muramyl dipeptide, bacterial endotoxin, lipid, Bordetella pertussis, and the like. Such adjuvants are available commercially from various sources, for example, Merck Adjuvant 6 (Merck and Company, Inc., Rahway, N.J.). Other suitable adjuvants are MPL+TDM Emulsion (RIBBI Immunochem Research Inc. U.S.A.). Other immuno-stimulants include interleukin 1, interleukin 2 and interferon-gamma. These proteins can be provided with the vaccine or their corresponding genetic sequence provided as a functional operon with a recombinant vaccine system such as vaccinia virus. The proportion of antigen and adjuvant can be varied over a broad range so long as both are present in effective amounts.

    [0215] As already stated, in addition to the Treponema ssp bacterins, preferably Treponema pedis or phagedenis bacterins, the vaccine can also include an antigen from Treponema spp. or other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, as discussed above. Moreover, antigens to other ungulate diseases can also be included in the vaccines. For example, the vaccine can include antigens to ungulate Fusobacterium necrophorum, Porphyromonas levii, and Dichelobacter nodosus (the organisms that cause interdigital necrobacillosis, commonly known as footrot), leptospiral bacteria, bovine respiratory syncytial virus, bovine herpes virus, bovine diarhhea virus, bovine parainfluenza virus, vesicular stomatitis virus, malignant catarrhal fever virus, blue tongue virus, pseudorabies virus, rabies virus, rinderpest virus, Guggenheimella, Porphyromonas, Bacteroides, Prevotella, Peptosteptococcus, Campylobacter, Mycoplasma, Corynebacterium/Actinomyces, Cryptosporidium, Rotavirus, Coronavirus and Clostridia spp. antigen.

    [0216] Furthermore, in case the vaccine comprises at least Treponema pedis or phagedenis, said vaccine might further comprise an immunogenically effective amount of a bacterin selected from the group consisting of: Treponema medium, Treponema vincentii, Treponema phagedenis, Treponema pedis, Treponema refringens, Treponema calligyrum, Treponema maltophilum and Treponema brennaborense. Preferably, Treopnema medium, Treponema vincentii, Treponema pedis and Treponema phagedenis. As shown in the examples, these bacterins improved the therapeutic effect of the vaccines of the present invention comprising Treponema pedis.

    [0217] In addition, it is further noted that the vaccine compositions of the invention are administered to a cattle, sheep, horses, or goats susceptible to or otherwise at risk of infection to induce an immune response against the antigen and thus enhance the patient's own immune response capabilities. Such an amount, as already stated throughout the present specification, is defined to be an immunogenically effective amount. In this use, the precise amounts depend on the judgement of the vaccine manufacturer and prescribing veterinarian and would include consideration of the patient's state of health and weight, the mode of administration, the nature of the formulation, and the like.

    [0218] A variety of vaccination regimens may be effective in immunizing cattle and other animals. For example, ungulate young and adults can both be vaccinated, preferably calves. A second immunization will be given 2-4 weeks after initial immunization. Animals that have been previously exposed to Treponema may require booster injections. The booster injection is preferably timed to coincide with times of maximal challenge and/or risk of abortion. Different immunization regimes may be adopted depending on the judgement of the veterinarian. Generally, on a per-dose basis, the concentration of the Treponema spp. bacterins, typically the whole cell, can range from about 10 to about 10.sup.9 cells per dose, or 1 g to about 100 mg antigen per dose. For administration to cattle, a preferable range is from about 10.sup.3 to 10.sup.9 cells or 1 g to 1 mg antigen per unit dose, preferably from 10 g to 1 mg, more preferably from 30 g to 1 mg, and even more preferably from 50 g to 1 mg antigen per unit dose. A suitable dose volume range is 0.5 to 2.0 ml, preferably about 2 ml. Accordingly, a typical dose for intramuscular injection, for example, would comprise 2 ml containing 10.sup.9 cells or 50 g of antigen.

    [0219] Vaccines of the invention may comprise a crude extract of Treponema spp., preferably Treponema pedis or phagedenis or any other Treponema spp. as exemplified throughout the present specification. Chemically fixed cells can also be used. As noted above, preferred vaccines comprise partially or completely purified Treponema protein preparations. The antigen produced by recombinant DNA technology is preferred because it is more economical than the other sources and is more readily purified in large quantities (Standard recombinant techniques can be carried out as described in well-known manuals to the skilled person in the art such as, for example, J. Sambrook and D. W. Russell, Molecular Cloning: A laboratory manual, 4.sup.th edition, Cold Spring Harbor Laboratory Press, New York, 2012). In addition to use in recombinant expression systems, the isolated Treponema gene sequences can also be used to transform viruses that transfect host cells in animals. Live attenuated viruses, such as vaccinia or adenovirus, are convenient alternatives for vaccines because they are inexpensive to produce and are easily transported and administered.

    [0220] Other protein expression systems such as bacteria (for example E. coli) or yeast cells such as Pichia, Saccharomyces are also useful to express recombinant antigens of the invention.

    [0221] Suitable viruses for use in the present invention include, but are not limited to baculovirus, pox viruses, such as canarypox and cowpox viruses, and vaccinia viruses, alpha viruses, adenoviruses, herpesvirus, and other animal viruses. The recombinant viruses can be produced by methods well known in the art, for example, using homologous recombination or ligating two plasmids. A recombinant canarypox or cowpox virus can be made, for example, by inserting the DNA encoding the Treponema protein or fragments thereof into plasmids so that they are flanked by viral sequences on both sides. The DNA encoding Treponema polypeptides are then inserted into the virus genome through homologous recombination.

    [0222] The vaccine of the invention is for use in a method of prevention and/or treatment of diseases in a mammal, preferably ungulates. More in particular for preventing and/or treating digital dermatitis or associated diseases caused by Treponema spirochete bacteria in a subject. Thus, it can be administered in a subject in need thereof in an immunologically effective amount in a method for preventing and/or treating digital dermatitis, in particular bovine digital dermatitis, contagious ovine digital dermatitis and/or footrot; and more particularly in bovine digital dermatitis. That is, the immunogenic composition or the vaccine as defined above are for the manufacture of a medicament for the treatment and/or prevention of digital dermatitis or associated diseases caused by Treponema spp.

    [0223] Furthermore, as already stated above, the present invention provides isolated antigens, preferably recombinant antigens, from Treponema spp. or from any other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, preferably from Treponema pedis or Treponema phagedenis, selected from at least one, preferably at least 2 or 3, of the antigens already identified above, in the preparation of immunogenic proteins and compositions for use in digital dermatitis vaccine compositions. It is noted that such isolated antigens will enhance the immunological effect of any vaccine which comprises an immunogenically effective amount of a Treponema spp. bacterin, preferably selected from the group consisting of: T. pedis, T. phagedenis, T. vincentii, T. medium, T. refringens, T. calligyrum, T. maltophylum and/or T. brennaborense, preferably from T. pedis or T. phagedenis. Such vaccines are for use in a method of treatment of diseases in a mammal, preferably ungulates. More in particular for preventing and/or treating digital dermatitis or associated diseases caused by Treponema spirochete bacteria in a subject. Thus, these can be administered in a subject in need thereof in an immunologically effective amount in a method for preventing and/or treating digital dermatitis, and in particular bovine digital dermatitis. That is, these immunogenic compositions or vaccines are also for the manufacture of a medicament for the treatment and/or prevention of digital dermatitis or associated diseases caused by Treponema spp.

    [0224] Moreover, the invention also provides a vaccination kit characterized in that it comprises a container comprising the pharmaceutical composition or the vaccine of the invention.

    [0225] In another aspect, the invention provides a vaccination kit characterized in that it comprises an informative manual or leaflet which contains the information on administering said pharmaceutical composition or vaccine of the invention.

    [0226] In addition, the present invention also provides methods for detecting the presence or absence of Treponema spp, or of any other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, in a biological sample. For instance, antibodies specifically reactive with any Treponema spp., or with any other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, can be detected using either Treponema or any other antigens from digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum. Such antigens or proteins have been described throughtout the present invention. Such proteins or antigens and isolates can be used to raise specific antibodies (either monoclonal or polyclonal) to detect the antigen in a sample. Each of these assays is described below.

    [0227] For a review of immunological and immunoassay procedures in general, see Antibodies: A Laboratory Manual (Greenfield E. A., 2nd ed. 2014). The immunoassays of the present invention can be performed in any of several configurations, which are reviewed extensively in Enzyme Immunoassay (Maggio, ed., 1980); Tijssen, Laboratory Techniques in Biochemistry and Molecular Biology (1985)). For instance, the proteins and antibodies disclosed here are conveniently used in ELISA, immunoblot analysis and agglutination assays. In brief, immunoassays to measure anti-Treponema antibodies or antibodies against any other digital dermatitis causative pathological agents such as D. nodosus or F. necrophorum, or antigens can be either competitive or non-competitive binding assays. In competitive binding assays, the sample analyte (e.g., anti-Treponema antibodies) competes with a labelled analyte (e.g., anti-Treponema monoclonal antibody) for specific binding sites on a capture agent (e.g., isolated Treponema protein) bound to a solid surface. The concentration of labelled analyte bound to the capture agent is inversely proportional to the amount of free analyte present in the sample.

    [0228] Non-competitive assays are typically sandwich assays, in which the sample analyte is bound between two analyte-specific binding reagents. One of the binding agents is used as a capture agent and is bound to a solid surface. The second binding agent is labelled and is used to measure or detect the resultant complex by visual or instrument means.

    [0229] A number of combinations of capture agent and labelled binding agent can be used. For instance, an isolated Treponema antigen, preferably from Treponema pedis selected from the list consisting of MSP, PrtP, OrfC and TlyC or any combinations thereof, can be used as the capture agent and labelled anti-bovine antibodies specific for the constant region of bovine antibodies can be used as the labelled binding agent. Goat, sheep and other non-bovine antibodies specific for bovine immunoglobulin constant regions (e.g., .gamma. or mu.) are well known in the art. Alternatively, the anti-bovine antibodies can be the capture agent and the antigen can be labelled.

    [0230] Various components of the assay, including the antigen, anti-Treponema antibody, or anti-bovine antibody, may be bound to a solid surface. Many methods for immobilizing biomolecules to a variety of solid surfaces are known in the art. For instance, the solid surface may be a membrane (e.g., nitrocellulose), a microtiter dish (e.g., PVC or polystyrene) or a bead. The desired component may be covalently bound or noncovalently attached through nonspecific bonding.

    [0231] Alternatively, the immunoassay may be carried out in liquid phase and a variety of separation methods may be employed to separate the bound labelled component from the unbound labelled components. These methods are known to those of skill in the art and include immunoprecipitation, column chromatography, adsorption, addition of magnetizable particles coated with a binding agent and other similar procedures.

    [0232] An immunoassay may also be carried out in liquid phase without a separation procedure. Various homogeneous immunoassay methods are now being applied to immunoassays for protein analytes. In these methods, the binding of the binding agent to the analyte causes a change in the signal emitted by the label, so that binding may be measured without separating the bound from the unbound labelled component.

    [0233] Western blot (immunoblot) analysis can also be used to detect the presence of antibodies to Treponema in the sample. This technique is a reliable method for confirming the presence of antibodies against a particular protein in the sample. The technique generally comprises separating proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with the separated proteins. This causes specific target antibodies present in the sample to bind their respective proteins. Target antibodies are then detected using labelled anti-bovine antibodies.

    [0234] The immunoassay formats described above employ labelled assay components. The label can be in a variety of forms. The label may be coupled directly or indirectly to the desired component of the assay according to methods well known in the art. A wide variety of labels may be used. The component may be labelled by any one of several methods. Traditionally a radioactive label incorporating .sup.3H, .sup.125I, .sup.35.sub.S, , .sup.14C, or .sup.32.sub.P was used. Non-radioactive labels include ligands which bind to labelled antibodies, fluorophores, chemiluminescent agents, enzymes, and antibodies which can serve as specific binding pair members for a labelled ligand. The choice of label depends on sensitivity required, ease of conjugation with the compound, stability requirements, and available instrumentation.

    [0235] Enzymes of interest as labels will primarily be hydrolases, particularly phosphatases, esterases and glycosidases, or oxidoreductases, particularly peroxidases. Fluorescent compounds include fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, etc. Chemiluminescent compounds include luciferin, and 2,3-dihydrophthalazinediones, e.g., luminol. For a review of various labelling or signal producing systems which may be used, see U.S. Pat. No. 4,391,904, which is incorporated herein by reference.

    [0236] Non-radioactive labels are often attached by indirect means. Generally, a ligand molecule (e.g., biotin) is covalently bound to the molecule. The ligand then binds to an anti-ligand (e.g., streptavidin) molecule which is either inherently detectable or covalently bound to a signal system, such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound. A number of ligands and anti-ligands can be used. Where a ligand has a natural anti-ligand, for example, biotin, thyroxine, and cortisol, it can be used in conjunction with the labelled, naturally occurring anti-ligands. Alternatively, any haptenic or antigenic compound can be used in combination with an antibody.

    [0237] Some assay formats do not require the use of labelled components. For instance, agglutination assays can be used to detect the presence of the target antibodies. In this case, antigen-coated particles are agglutinated by samples comprising the target antibodies. In this format, none of the components need to be labelled and the presence of the target antibody is detected by simple visual inspection.

    [0238] Finally, the present invention is further directed to a T. pedis strain deposited by HIPRA SCIENTIFIC S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (Inhoffenstraf3e 7 B38124 Braunschweig, Germany) under accession number DSM 32663 on Oct. 10, 2017; or to a T. phagedenis strain deposited under the Budapest treaty by HIPRA SCIENTIFIC, S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen under accession number DSM 32950 on Nov. 7, 2018. Pharmaceutical compositions and vaccines of the invention also encompasses both deposited strains and their use in a method of treatment or prevention of digital dermatitis in a mammal, wherein the digital dermatitis is preferably bovine digital dermatitis, contagious ovine digital dermatitis and/or footrot.

    [0239] The present invention is further shown in light of the following examples which merely illustrate the invention but do not limit the same. Furthermore, the present invention covers all possible combinations of particular and preferred embodiments described herein.

    EXAMPLES

    Example 1: In Vitro Immunogenicity and In Vivo Efficacy of Experimental Vaccines Against BDD in Calves

    [0240] 35 calves between 2 and 4 months of age, free of antibodies against T. pedis and T. phagedenis and without clinical signs of BDD were chosen for this study. The animals were randomly assigned into 7 groups of 5 calves each one (A to G). On Day 0 calves received a first dose of an experimental vaccine according to the group assignment. Three weeks later (Day 21) calves received a second dose of the vaccine. Vaccines were administered at the neck by subcutaneous route at 2 mL for each administration.

    [0241] At Day 48 calves were challenged with a macerated culture obtained from naturally occurring BDD lesions. The challenge inoculum was obtained by homogenizing 23 samples of active BDD lesions from different cows. The macerated culture consisted of T. phagedenis, T. medium/T. vincentii and T. pedis (92% of BDD lesion samples positive to T. phagedenis, 85% positive to T. medium/T. vincentii-like and 13% positive to T. pedis). Furthemore 56% and 65% of BDD lesion samples were positive to D. nodosus and T. praeacuta, respectively. [0242] Group A received Vaccine A which comprised 10.sup.9 bacteria/dose of inactivated T. pedis isolate (reference number B-8308, HIPRA SCIENTIFIC, S.L.U.) and 70 g/dose of each purified recombinant proteins MSP (SEQ ID NO: 4), PrtPM (SEQ ID NO: 2) and OrfC (SEQ ID NO: 5) of T. pedis and Apr2BM (SEQ ID NO: 10) of D. nodosus. The vaccine was formulated at 50% w/w with the adjuvant Montanide A. An adjuvant based on a combination of a mineral oil and a product obtained from fatty acid and a sugar alcohol such as for example those marketed by the company SEPPIC under the commercial designation Montanide. Emulsions of the W/O/W type can be prepared with said adjuvant. [0243] Group B received Vaccine B which comprised 70 g/dose of each purified recombinant proteins MSP (SEQ ID NO: 4), PrtPM (SEQ ID NO: 2) and OrfC (SEQ ID NO: 5) of T. pedis and Apr2BM (SEQ ID NO: 10) of D. nodosus. The vaccine was formulated at 50% w/w with the same adjuvant Montanide A. [0244] Group C received Vaccine C which comprised 10.sup.9 bacteria/dose of the same inactivated T. pedis isolate of Group A. The vaccine was formulated at 50% w/w with the same adjuvant Montanide A. [0245] Group D corresponded to the control group which received Vaccine D which comprised PBS without antigens and 50% v/v of the same Montanide A adjuvant. [0246] Group E received Vaccine E which comprised 10.sup.9 bacteria/dose of the same inactivated T. pedis isolate as Group A and 70 g/dose of each purified recombinant proteins MSP (SEQ ID NO: 4), PrtPM (SEQ ID NO: 2) and OrfC (SEQ ID NO: 5) of T. pedis and Apr2BM (SEQ ID NO: 10) of D. nodosus. The vaccine was formulated with 25% v/v of adjuvant B based on AlOH.sub.3/AlPO.sub.4 and 2% w/v of DEAE dextran. [0247] Group F received Vaccine F which comprised 70 g/dose of each purified recombinant proteins MSP (SEQ ID NO: 4), PrtPM (SEQ ID NO: 2) and OrfC (SEQ ID NO: 5) of T. pedis and Apr2BM (SEQ ID NO: 10) of D. nodosus. The vaccine was formulated with 25% v/v of adjuvant B based on AlOH.sub.3/AlPO.sub.4 and 2% w/v of DEAE dextran. [0248] Group G received Vaccine G which comprised 10.sup.9 cells/dose of the same inactivated T. pedis isolate as Groups A, C and E. The vaccine was formulated with 25% v/v of adjuvant B based on AlOH.sub.3/AlPO.sub.4 and 2% w/v of DEAE dextran.

    [0249] A summary of the different groups and vaccines is illustrated in the following table.

    TABLE-US-00014 TABLE 1 Summary of the Groups and Vaccines used in the example 1. Groups Vaccine Antigens Adjuvant A (n = 5) A T. pedis inactivated bacterin + 4 A recombinant proteins (MSP, PrtPM, OrfC, Apr2BM) B (n = 5) B 4 recombinant proteins (MSP, PrtPM, A OrfC, Apr2BM) C (n = 5) C T. pedis inactivated bacterin A D (n = 5) D Placebo (PBS) A E (n = 5) E T. pedis inactivated bacterin + 4 B recombinant proteins (MSP, PrtPM, OrfC, Apr2BM) F (n = 5) F 4 recombinant proteins (MSP, PrtPM, B OrfC, Apr2BM) G (n = 5) G T. pedis inactivated bacterin B [0250] Blood samples were collected from all calves on Days 0, 21, 35, 47, 59, 80, 97 to obtain sera.

    In Vitro Results

    [0251] The in vitro immunogenicity of the experimental vaccines was carried out by analyzing the neutralizing effect of sera from vaccinated animals at day 47 in the growth of T. pedis, and by indirect ELISA against T. pedis in order to detect the presence antibodies in the animals' sera (FIG. 1).

    [0252] Inhibitory effect of the sera corresponded to the experimental vaccines containing T. pedis bacterin, with and without the recombinant proteins (Vaccines A, C, E and G). Similar results were obtained when using both adjuvants A and B.

    [0253] Serology post-vaccination was analyzed by ELISA (IgG2) against whole bacterium T. pedis and T. phagedenis at different days post-vaccination (FIGS. 2 and 3), in order to assess the antibody humoral response.

    [0254] No immunological response of the recombinant proteins when administered alone (vaccine B) and in the control group (vaccine D) was observed. A better immunological response was observed when the combined vaccine (bacterin+recombinant proteins; vaccine A) was administered to the animals. The immunological response to the combined vaccine was also better when compared to the bacterin-based vaccine administered alone (vaccine C).

    [0255] There was a similar response with both adjuvants A and B.

    [0256] A lower immunological response than T. pedis was observed for T. phagedenis. Since the vaccine formulations did not contain T. phagedenis antigens, a cross-reactivity was assumed.

    In Vivo Efficacy Results Post-Infection

    [0257] In order to assess the in vivo efficacy of the experimental vaccines a challenge was carried out at day 48 post-vaccination to groups A, C and D. As no in vitro efficacy was observed for the group B, which received the experimental vaccine containing only recombinant proteins alone, this group were left without challenge.

    [0258] To assess the post-infection efficacy of the experimental vaccines, evaluation of the severity of the clinical macroscopic lesions was performed. The assessment was performed at day 32 post-infection. Different methods were used. The methods were based on assigning a score to each animal by evaluating pre-established parameters of the disease. Two different scores were used: Iowa score (Krull, A. C., Cooper, V. L., Coatney, J. W., Shearer, J. K., Gorden, P. J., & Plummer, P. J. A highly effective protocol for the rapid and consistent induction of digital dermatitis in Holstein calves. PloS one, 2016, 11.4: e0154481) and Wisconsin score (Gomez, A., Cook, N. B., Bernardoni, N. D., Rieman, J., Dusick, A. F., Hartshorn, R., Socha M. T., Read D. H., Dpfer D. An experimental infection model to induce digital dermatitis infection in cattle. Journal of dairy science, 2012, 95.4: 1821-1830). Table 2 shows how the Iowa score was obtained (see FIG. 4 as well).

    TABLE-US-00015 TABLE 2 Assessment of the macroscopic lesions of BDD according to Iowa score. Size of the lesion Less than No changes Expands Absence the initial respect the beyond initial of lesion abrasion area abrasion area abrasion area Score 0 1 3 5 Color of the lesion Normal color, Red or no lesion Whitish Pink bright red Score 0 1 2 3 Edges of the lesion Absence Edges well No border of lesion defined defined Score 0 1 2 * It was considered a digital dermatitis lesion when the final score was 7.

    [0259] In groups A and C, 1/5 and 2/5 calves respectively did not develop clinical lesions, while 5/5 animals of the group D (control) developed lesions. Furthermore, when assessing the severity of the lesions, for both scores (Iowa and Wisconsin) groups A and C showed less lesion scores and percentage of calves with bovine digital dermatitis lesions with respect to the control group (D). There was also a major reduction in the percentage of animals presenting DD lesions (Iowa score 7) in the group vaccinated with the vaccine A (bacterin+recombinant proteins) (FIG. 5).

    Conclusions of Example 1

    [0260] A clear inhibitory effect on in vitro growth of T. pedis in the sera of calves vaccinated with T. pedis bacterin or the bacterin combined with recombinant proteins was observed. This effect was not seen in sera from animals which were vaccinated with the recombinant proteins alone.

    [0261] A higher humoral response against T. pedis was observed when T. pedis bacterin vaccine was combined with recombinant proteins.

    [0262] After the experimental infection with the inoculum containing T. phagedenis, T. medium-vincentii-like and T. pedis, it was observed that the vaccines with T. pedis alone or combined with the recombinant proteins reduced the incidence and the severity of the DD lesions compared to the control group. It was also observed that the group vaccinated with the combined vaccine (bacterin+recombinant proteins) showed less percentage of animals with DD lesions.

    Example 2: Assessing the In Vivo Efficacy of Experimental Vaccines Against an Experimental Infection of BDD in Calves

    [0263] 30 calves between 2 and 3 months of age, free of antibodies against T. pedis and T. phagedenis and without clinical signs of BDD were chosen for this study. The animals were randomly assigned into 3 groups of 10 calves each one (groups A to C). On Day 0 calves received one dose of the vaccine according to their group assignment. Three weeks later (Day 21) calves received a second dose of the vaccine. Vaccines were administered at the neck by intramuscular route at 2 mL for each administration.

    [0264] At Day 49 calves were challenged with a macerated culture obtained from naturally occurring BDD lesion as in Example 1. The macerated consisted of a homogenized of 13 samples of BDD active lesions from 10 different cows. In this case the 100% of samples were positive to T. phagedenis and T. medium/T. vincentii-like, and 69% were positive to T. pedis. Therefore, the macerated consisted of T. phagedenis, T. medium/vincentii-like and T. pedis. Furthermore 23% of BDD samples were also positive to D. nodosus. [0265] Group A received vaccine 1, which comprised inactivated T. pedis (same isolate used in Example 1), inactivated T. phagedenis (isolate reference number B-7330, HIPRA SCIENTIFIC, S.L.U.), inactivated T. medium (isolate reference number B-8307, HIPRA SCIENTIFIC, S.L.U.) combined with the recombinant proteins MSP (SEQ ID NO: 4), PrtPM (SEQ ID NO: 2) and TlyC (SEQ ID NO: 3) of T. pedis and Apr2BM (SEQ ID NO: 10) from D. nodosus. Vaccine 1 contained adjuvant Montanide A as described in Example 1 at 50% w/w. The titer was 10.sup.9 total bacteria per dose of 2 ml and 50 g of each recombinant protein per dose of 2 ml. [0266] Group B received vaccine 2, which comprised inactivated T. pedis isolate, inactivated T. phagedenis isolate, and inactivated T. medium isolate (same isolates as Group A), this vaccine did not contain recombinant proteins. The vaccine contained the adjuvant Montanide A as described in Example 1 at 50% w/w. The titer was 10.sup.9 total bacteria per dose of 2 ml. [0267] Group C corresponded to the control group which received vaccine 3 consisting of a PBS solution without antigens formulated with the adjuvant Montanide A as described in Example 1 at 50% w/w.

    TABLE-US-00016 TABLE 3 Summary of the treatments groups of Example 2. Groups Vaccine Antigen Adjuvant A (n = 10) 1 T. pedis, T. medium, and T. phagedenis A inactivated bacterins + 4 recombinants proteins (MSP, PrtPM, TlyC, Apr2BM) B (n = 10) 2 T. pedis, T. medium, and T. Phagedenis A inactivated bacterins C (n = 10) 3 Placebo (PBS) A

    [0268] At days 0, 21, 35, 46, 57, 64, 70, 81 and 95 blood was extracted from all the animals in order to obtain sera.

    In Vitro Assay of Treponema spp. Growth Inhibition From the Sera Obtained Post-Vaccination

    [0269] The inhibition assay was performed using sera obtained on day 35 post-vaccination from vaccinated animals. The growth inhibition assay was carried out for T. pedis and T. phagedenis. This assay demonstrated that only calves belonging to the vaccinated groups A and B inhibited the growth of both bacteria. No effect on the growth inhibition was observed from sera belonging to the control group (FIG. 6).

    Serology Results Post-Vaccination

    [0270] To assess the humoral response upon vaccination different ELISA assays were performed. ELISA assays were performed with sera from days 0, 21, and 35 post-vaccination to detect antibodies against T. pedis, T. phagedenis, T. medium, D. nodosus and against the recombinant proteins MSP, PrtPM, TlyC from T. pedis and Apr2BM from D. nodosus. The sera obtained from the different animals was diluted 1/400 in order to perform the ELISA assay.

    [0271] A good seroconversion of IgG2 antibodies against all antigens present in the study was observed (FIG. 7). Significant differences for seroconversion between the vaccinated groups and the control group were shown. Animals which were vaccinated with the Treponema spp. bacterins combined with recombinant proteins (vaccine 1) obtained higher humoral response against T. pedis and T. medium in comparison to vaccine 2 (bacterins-based vaccine).

    In Vivo Efficacy Results Post-Infection

    [0272] A final evaluation of the BDD lesions at day 32 post-infection (Day 81 of the study) was performed. The assessment was realized using the Iowa score as explained in the Example 1.

    TABLE-US-00017 TABLE 4 Summary of the clinical assessment of the BDD macroscopic lesions at day 32 post-infection. Proportion Proportion of calves of calves Proportion with lesions with major Group, of calves of DD spirochetes Vaccine with lameness (score 7) per MCP A, 1 2/10 (20%) 4/10 (40%) 5/10 (50%) B, 2 3/10 (30%) 6/10 (60%) 6/10 (60%) C, 3 5/9 (55%)** 8/10 (80%) 8/10 (80%) (placebo)

    [0273] Regarding lesion severity scores, in groups A (vaccine 1) and B (vaccine 2) the severity was lower and even 1/10 and 3/10 of the groups A and B respectively did not reveal signs of lesion, while all the animals in the control group developed digital lesions.

    [0274] Regarding the Iowa score, the percentage of calves that achieved a minimum of 7 score (Iowa score establishes a score of at least 7 to consider a BDD lesion) was 40%, 60% and 80% for the groups A (vaccine 1), B (vaccine 2) and C (vaccine 3) respectively. Significant differences were observed between group A and group C (vaccine 3, placebo) (p value=0.04 using the Mann-Whitney test).

    [0275] To sum up, it was observed that both vaccinated groups reduced the incidence and severity of the lesion respect to the control group. Furthermore, it was observed a higher protection in the group A (vaccine comprising a combination of bacterins plus recombinant proteins), as the differences respect the control group were significant (FIG. 8).

    Summary

    [0276] A clear in vitro growth inhibition effect of T. pedis and T. phagedenis was observed in the sera of vaccinated animals. Therefore, the antibodies raised against these Treponema spp. showed a clear inhibitory effect. [0277] A high humoral response post-vaccination was observed against three genus of Treponema spp., i.e. T. pedis, T. phagedenis and T. medium. Significant differences with respect to the control group were also observed. [0278] A higher humoral response against T. pedis was observed for the vaccine which combines Treponema spp. bacterins and recombinant proteins. [0279] The assessment of the severity lesions at day 32 post-infection demonstrated that all the animals in the control group developed digital lesions, while several vaccinated animals did not develop any lesion. Furthermore, the vaccination reduced the severity of the lesions. [0280] In the final assessment at day 32 post-infection, both the proportion of animals with BDD lesions (grade 7 according to the Iowa score) and the final lesion score showed statistical significance between the vaccinated group 1 (bacterins combined with recombinant proteins) and the control group.

    Example 3: Demonstration of the Equivalence of the Immune Response Between Different T. pedis Strains

    [0281] In this study, 6 New Zealand rabbits of at least 3 weeks of age were immunized with 2 different formulations based on bacterins from two different Treponema pedis strains, 3 animals per each formulation. Group 1 was vaccinated with the same T. pedis strain as disclosed in the Examples 1 and 2, and Group 2 was vaccinated with T. pedis strain deposited by HIPRA SCIENTIFIC, S.L.U. (Avda. La Selva, 135-Amer, Girona, Spain) in the Leibnitz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen under accession number DSM 32663 (Oct. 10, 2017)

    [0282] The vaccine compositions were formulated with Freund adjuvant, and both contained 10.sup.9 bacteria/dose. Animals received two doses of 1 ml subcutaneously, the first one at day 0 of the study adjuvanted in FCA (Freunds Complete Adjuvant) and the second one 2 weeks later, at day 14 of the study and adjuvanted in IFA (Incomplete Freund's Adjuvant). The 1 ml-volume was administered in the neck and split in two points of 0.5 ml each for ethical reasons.

    [0283] Blood samples were collected at day 0, 14 and 35 of study. The serological response was then analyzed by ELISA/Western-Blot from the blood extractions performed during the study.

    [0284] The results showed seroconversion for both groups against the homologous Treponema species. Seroconversion at days 14 and 35 post-vaccination was significant when compared to day 0 post-vaccination for both vaccines. The response was equivalent for both groups, either at one or at two doses (FIG. 9).

    [0285] The serological response against heterologous Treponema species, such as T. phagedenis and T. medium was also analyzed. Equivalent response was seen for both groups. It was observed seroconversion for both T. phagedenis and T. medium, demonstrating cross-protection of the T. pedis strain.

    [0286] From the results, it can be concluded that the protection of a vaccine containing T. pedis bacterin does not depend of a specific strain, as different strains had an equivalent serological response. In addition, cross-protection of T. pedis strain was seen against heterologous Treponema spp., such as T. phagedenis and T. medium.

    Example 4: Immunogenicity of Experimental T. phagedenis vaccine Against BDD

    [0287] 20 calves between 2 and 3 months of age, with low levels or free of antibodies against T. pedis, T. phagedenis and T. medium and without clinical signs of BDD were chosen for this study. The animals were randomly assigned into 2 treatment groups of 10 calves each one (Group 1 and Group 2). [0288] Group 1 received a vaccine comprising a PBS sterile solution without antigens formulated with the adjuvant Montanide A as described in Example 1 at 50% w/w. This group corresponded to the control group. [0289] Group 2 received a vaccine based on a T. phagedenis bacterin, which comprised 10.sup.9 total bacteria per dose of inactivated T. phagedenis isolate (reference number B-7330, HIPRA SCIENTIFIC, S.L.U.). The vaccine of Group 2 was formulated at 50% w/w with the adjuvant Montanide A, as described in Example 1.

    [0290] The vaccines were administered at the neck region by intramuscular route at 2 ml each administration. Both groups, received a first dose of the vaccine at Day 0. Three weeks later (Day 21) calves received a second dose of the vaccine at the opposite side of the neck.

    [0291] The immunogenicity of the experimental vaccine was carried out analyzing the sera from vaccinated animals at days 0, 21, 35, 48, and 69 post-vaccination by indirect ELISA assay, in order to detect the presence of antibodies in the animals' sera.

    [0292] Serology post-vaccination was analyzed by ELISA (IgG2) against whole bacterium T. pedis, T. phagedenis and T. medium in order to assess the antibody humoral response to that Treponema spp.

    [0293] An immunological response against the different Treponema spp. tested (T. pedis, T. pahgedenis and T. medium) was clearly observed from animal's sera of Group 2. Since the vaccine formulation of Group 2 did not contain T. pedis or T. medium bacterins, the immunological response observed in vaccinated animals can be attributed to the cross-reactivity between Treponema spp. (FIG. 10).

    [0294] Furthermore a clear inhibitory effect on the in vitro growth of T. phagedenis with the sera of calves vaccinated with the T. phagedenis bacterin (Group 2) was observed. This inhibitory effect was not observed for the control group.

    [0295] Once again, these results suggest that the immunological response observed in vaccinated animals can be attributed to the cross reactivity between Treponema species which share some epitopes which are responsible for that cross reaction.

    Example 5 Immunogenicity of Experimental Vaccines Against BDD

    [0296] 30 calves between 2 and 3 months of age, with low levels or free of antibodies against T. pedis, T. phagedenis and T. medium and without clinical signs of BDD were chosen for this study. The animals were randomly assigned into 3 treatment groups of 10 calves each one (Group 1, Group 2 and Group 3). [0297] Group 1 received a vaccine comprising a PBS sterile solution without antigens formulated with the adjuvant Montanide A as described in Example 1 at 50% w/w. This group corresponded to the control group. [0298] Group 2 received a vaccine based on a T. phagedenis bacterin, which comprised 10.sup.9 total bacteria per dose of inactivated T. phagedenis isolate (reference number B-7330, HIPRA SCIENTIFIC, S.L.U.) combined with the following recombinant proteins: MSP protein (SEQ ID NO: 15) of T. phagedenis, PrtPM protein (SEQ ID NO: 2) of T. pedis and Apr2BM protein (SEQ ID NO: 10) of D. nodosus at 50 g of each recombinant protein per dose. The vaccine was formulated with the adjuvant Montanide A as described in Example 1 at 50% w/w. [0299] Group 3 received a vaccine based on a T. phagedenis bacterin, which comprised 10.sup.9 total bacteria per dose of inactivated T. phagedenis isolate (reference number B-7330, HIPRA SCIENTIFIC, S.L.U.). The vaccine was formulated at 50% w/w with the adjuvant Montanide A, as described in Example 1.

    TABLE-US-00018 Groups Antigen 1 (n = 10) Placebo (PBS solution) 2 (n = 10) T. phagedenis inactivated bacterin + 3 recombinant proteins (MSP from T. phagedenis, PrtPM from T. pedis, Apr2BM from D. nodosus) 3 (n = 10) T. phagedenis inactivated bacterin

    [0300] Calves in all groups received a first dose of the vaccine at Day 0 at the neck region. Three weeks later (Day 21) calves received a second dose of the vaccine at the opposite side of the neck. The vaccines were administered at neck region by intramuscular route at 2 ml each administration.

    [0301] The immunogenicity of the experimental vaccine was carried out analyzing the sera from vaccinated animals at days 0, 21, 35, 48, and 69 post-vaccination by indirect ELISA assay, in order to detect the presence of antibodies in the animals' sera.

    [0302] Serology post-vaccination was analyzed by ELISA (IgG2) against T. pedis PrtPM protein, D. nodosus Apr2 protein and T. phagedenis MSP protein (FIG. 11) in order to assess the antibody humoral response conferred by the vaccines to that proteins.

    [0303] An immunological response against all the antigens present in the vaccine composition in animal's sera of vaccinated Group 2 was clearly observed. Furthermore, the immunological response against the MSP protein of T. phagedenis was increased when the bacterin was complemented with the recombinant proteins (Group 2). Even though, Group 3 (bacterin alone) developed a clear immunological response as well.

    [0304] Contrary, the control group (Group 1) did not develop an immunologically response to any of the tested antigens.

    [0305] Moreover, a clear inhibitory effect on the in vitro growth of T. phagedenis was observed in the sera of vaccinated calves of Group 2 (bacterin+recombinant proteins) and 3 (bacterin alone). These results demonstrate the presence of neutralizing antibodies in animals vaccinated of Group2 and 3.