GENETICALLY MODIFIED NON-HUMAN ANIMALS AND METHODS RELATING TO COMPLEMENT DEPENDENT CYTOTOXICITY

20200359609 ยท 2020-11-19

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates generally to genetically modified non-human animals and immunodeficient non-human animals characterized by restored complement-dependent cytotoxicity, as well as methods and compositions for assessment of therapeutic antibodies in the genetically modified immunodeficient non-human animals. In specific aspects, the present invention relates to immunodeficient non-obese diabetic (NOD), A/J, A/He, AKR, DBA/2, NZB/B1N, B10.D2/oSn and other mouse strains genetically modified to restore complement-dependent cytotoxicity which is lacking in the unmodified immunodeficient mice. In further specific aspects, the present invention relates to NOD.Cg-Prkdc.sup.scid IL2re.sup.tmlWjl/SzJ (NSG), NOD.Cg-Rag1.sup.tm1Mom Il2rg.sup.tmlWjl/SzJ (NRG) and NOD.Cg-Prkdc.sup.scid Il2rg.sup.tm1Sug/JicTac (NOG) mice genetically modified to restore complement-dependent cytotoxicity which is lacking in unmodified NSG, NRG and NOG mice. Methods for assessment of therapeutic antibodies or putative therapeutic antibodies in the genetically modified immunodeficient mice characterized by an intact complement system are provided according to specific aspects of the present invention.

Claims

1. A genetically modified immunodeficient mouse, wherein the genome of the mouse comprises a repaired C5 complement component structural gene such that the genetically modified immunodeficient mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

2. The genetically modified immunodeficient mouse of claim 1 wherein the mouse has severe combined immunodeficiency.

3. The genetically modified immunodeficient mouse of claim 1, wherein the mouse has an Ilr2g mutation and the mouse is characterized by an IL2 receptor gamma chain (ILR2g) deficiency.

4. The genetically modified immunodeficient mouse of claim 1, wherein the mouse has a Rag1 mutation and the mouse is characterized by a recombination activating gene 1 (RAG 1) deficiency.

5. The genetically modified immunodeficient mouse of claim 1, wherein the mouse has a Rag2 mutation and the mouse is a recombination activating gene 2 (RAG 2) deficiency.

6. The genetically modified immunodeficient mouse of claim 1, wherein the mouse is homozygous for the scid mutation and the mouse has severe combined immunodeficiency.

7. The genetically modified immunodeficient mouse of claim 1, wherein the mouse comprises a Rag1.sup.tm1Mom mutation and has a RAG1 deficiency.

8. The genetically modified immunodeficient mouse of claim 1, wherein the mouse is homozygous for the Rag1.sup.tm1Mom mutation and has a RAG1 deficiency.

9. The genetically modified immunodeficient mouse of claim 1, wherein the mouse is an immunodeficient NOD, A/J, A/He, AKR, DBA/2, NZB/B1N, or B10.D2/oSn mouse.

10. The genetically modified immunodeficient mouse of claim 1, wherein the genetically modified immunodeficient animal is an NSG-Hc.sup.1 mouse comprising a repaired C5 complement component structural gene such that the genetically modified NSG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system, severe combined immunodeficiency and an IL2Rg deficiency.

11. The genetically modified immunodeficient mouse of claim 1, wherein the genetically modified immunodeficient animal is an NRG-Hc.sup.1 mouse comprising a repaired C5 complement component structural gene such that the genetically modified NRG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system, a RAG 1 deficiency and an IL2Rg deficiency.

12. The genetically modified immunodeficient mouse of claim 1, wherein the genetically modified immunodeficient animal is an NOG-Hc.sup.1 mouse comprising a repaired C5 complement component structural gene such that the genetically modified NOG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system, severe combined immunodeficiency and an IL2Rg deficiency.

13. The genetically modified immunodeficient mouse of claim 1, further comprising xenograft tumor cells.

14. The genetically modified immunodeficient mouse of claim 1, further comprising human xenograft tumor cells.

15. The genetically modified immunodeficient mouse of claim 1, further comprising xenograft tumor cells of a cell line.

16. A method for producing a mouse model system for assessment of an anti-cancer therapeutic or putative anti-cancer therapeutic, comprising: providing a genetically modified immunodeficient mouse comprising a repaired C5 complement component structural gene such that the genetically modified immunodeficient mouse expresses the C5 complement component structural gene and is characterized by an intact complement system; and administering xenograft tumor cells to the genetically modified immunodeficient mouse.

17-29. (canceled)

30. A method for assessing the effect of an anti-cancer therapeutic antibody or putative anti-cancer therapeutic antibody, comprising: providing a genetically modified immunodeficient mouse comprising a repaired C5 complement component structural gene such that the genetically modified immunodeficient mouse expresses the C5 complement component structural gene and is characterized by an intact complement system; administering xenograft tumor cells to the genetically modified immunodeficient mouse; administering an anti-cancer therapeutic antibody or putative anti-cancer therapeutic antibody to the mouse; and assaying a response of the xenograft tumor cells to the anti-cancer therapeutic antibody.

31-47. (canceled)

48. The genetically modified immunodeficient mouse of claim 2, wherein the mouse is homozygous for the scid mutation.

49. The genetically modified immunodeficient mouse of claim 15, wherein the cell line is a lymphoma cell line.

50. The genetically modified immunodeficient mouse of claim 1, wherein complement dependent cytotoxicity in the mouse is increased by 70%-90% relative to a genetically modified immunodeficient mouse wherein the genome of the mouse does not comprise a repaired C5 complement component structural gene.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0163] FIG. 1A is a diagram of the mouse C5 complement component structural protein of NSG and NSG-Hc.sup.1 mice showing that the 2 base pair deletion in NSG mice results in a premature stop codon and lack of a functional complement system compared to the repaired gene sequence in the NSG-Hc.sup.1 mice which results in production of full-length functional C5. Sequences from top to bottom correspond to SEQ ID Nos: 4-7;

[0164] FIG. 1B is a representative graph demonstrating the level of lysis of antibody coated sheep RBCs, i.e sensitized cells (EA cells), when incubated with either a 1:5 diluted sera from age and sex matched NSG or NSG-Hc.sup.1 mice. Serum from BALB/cByJ mice was used as a positive control. Data are reported as the meanSD. *P<0.0001;

[0165] FIG. 2A shows a representative graph of the change in body weight over time in different cohorts of age and sex matched NSG and NSG-Hc.sup.1 mice engrafted with 110.sup.5 Daudi cells via intravenous injections, and at 10 days post engraftment injected with either 25 g/g of rituximab or PBS. Non-engrafted NSG mice were used as negative controls. PBS, phosphate buffer saline; RTX, rituximab. Data are reported as percentage of the meanSE. *P<0.05;

[0166] FIG. 2B shows a representative Kaplan-Meier survival plot demonstrating percent survival over time in different cohorts of age and sex matched NSG and NSG-Hc.sup.1 mice engrafted with 110.sup.5 Daudi cells via intravenous injections, and at 10 days post engraftment injected with either 25 g/g of rituximab or PBS. Non-engrafted NSG mice were used as negative controls. PBS, phosphate buffer saline; RTX, rituximab. Data are reported as percentage of the meanSE. *P<0.05;

[0167] FIG. 3A shows representative flow cytometry analysis of peripheral blood lymphocytes in different cohorts of age and sex matched NSG and NSG-Hc.sup.1 engrafted with 110.sup.5 Daudi cells via intravenous injections, and at 10 days post engraftment injected with either 25 g/g of rituximab or PBS. Non-engrafted NSG mice were used as negative controls. Measurements were taken 38 day post-engraftment. Data are reported as the meanSD. PBS, phosphate buffer saline; RTX, rituximab; *P<0.05;

[0168] FIG. 3B shows representative flow cytometry analysis of bone marrow in different cohorts of age and sex matched NSG and NSG-Hc.sup.1 engrafted with 110.sup.5 Daudi cells via intravenous injections, and at 10 days post engraftment injected with either 25 g/g of rituximab or PBS. Non-engrafted NSG mice were used as negative controls. Measurements were taken 38 day post-engraftment. Data are reported as the meanSD. PBS, phosphate buffer saline; RTX, rituximab; *P<0.05;

[0169] FIG. 4A shows representative images of the ovary displaying levels of Daudi cells engraftment in different cohorts of age and sex matched NSG and NSG-Hc.sup.1 mice engrafted with 110.sup.5 Daudi cells via intravenous injections, and at 10 days post engraftment injected with either 25 g/g of rituximab or PBS. Measurements were taken 38 day post-engraftment. Original magnification 10 (scale bar=200 M) showing HE staining; high-magnification image 20 scale bar=100 m showing anti-human CD45 IHC. PBS, phosphate buffer saline; RTX, rituximab; and

[0170] FIG. 4B shows representative images of the kidney displaying levels of Daudi cell engraftment in different cohorts of age and sex matched NSG and NSG-Hc.sup.1 mice engrafted with 110.sup.5 Daudi cells via intravenous injections, and at 10 days post engraftment injected with either 25 g/g of rituximab or PBS. Measurements were taken 38 day post-engraftment. Original magnification 10 (scale bar=200 M) showing HE staining; high-magnification image 20 scale bar=100 m showing anti-human CD45 IHC. PBS, phosphate buffer saline; RTX, rituximab.

DETAILED DESCRIPTION OF THE INVENTION

[0171] Genetically modified non-human animals, methods and compositions according to aspects of the present invention allow for evaluation of antibody-based therapeutics.

[0172] Genetically modified immunodeficient non-human animals are provided by the present invention wherein the genome of the immunodeficient non-human animal includes a repaired C5 complement component structural gene (also known as hemolytic complement, Hc) such that the genetically modified non-human animal expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0173] In specific aspects, the present invention relates to immunodeficient non-obese diabetic (NOD), A/J, A/He, AKR, DBA/2, NZB/B1N, B10.D2/oSn and other mouse strains genetically modified to restore complement-dependent cytotoxicity which is lacking in the unmodified immunodeficient mice.

[0174] Genetically modified immunodeficient non-obese diabetic mice (NOD) are provided by the present invention wherein the genome of the NOD mouse includes a repaired C5 complement component structural gene such that the genetically modified NOD mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0175] Genetically modified immunodeficient NSG mice are provided by the present invention wherein the genome of the NSG mouse includes a repaired C5 complement component structural gene such that the genetically modified NSG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0176] Genetically modified NSG mice with an intact complement system are provided by the present invention, designated NSG-Hc.sup.1 mice.

[0177] NSG-Hc.sup.1 mice with an intact complement system and engrafted with cells characterized by abnormal proliferation, such as cancer cells, are provided by the present invention.

[0178] Genetically modified immunodeficient NRG mice are provided by the present invention wherein the genome of the NRG mouse includes a repaired C5 complement component structural gene such that the genetically modified NRG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0179] Genetically modified NRG mice with an intact complement system are provided by the present invention, designated NRG-Hc.sup.1 mice.

[0180] NRG-Hc.sup.1 mice with an intact complement system and engrafted with cells characterized by abnormal proliferation, such as cancer cells, are provided by the present invention.

[0181] Genetically modified immunodeficient NOG mice are provided by the present invention wherein the genome of the NRG mouse includes a repaired C5 complement component structural gene such that the genetically modified NRG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0182] Genetically modified NOG mice with an intact complement system are provided by the present invention, designated NOG-Hc.sup.1 mice.

[0183] NOG-Hc.sup.1 mice with an intact complement system and engrafted with cells characterized by abnormal proliferation, such as cancer cells, are provided by the present invention.

[0184] Scientific and technical terms used herein are intended to have the meanings commonly understood by those of ordinary skill in the art. Such terms are found defined and used in context in various standard references illustratively including J. Sambrook and D. W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; F. M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002; B. Alberts et al., Molecular Biology of the Cell, 4th Ed., Garland, 2002; D. L. Nelson and M. M. Cox, Lehninger Principles of Biochemistry, 4th Ed., W.H. Freeman & Company, 2004; Herdewijn, P. (Ed.), Oligonucleotide Synthesis: Methods and Applications, Methods in Molecular Biology, Humana Press, 2004; A. Nagy, M. Gertsenstein, K. Vintersten, R. Behringer (Eds) 2002, Manipulating the Mouse Embryo: A Laboratory Manual, 3.sup.rd edition, Cold Spring Harbor Laboratory Press, ISBN-10: 0879695919; and K. Turksen (Ed.), Embryonic stem cells: methods and protocols in Methods Mol Biol. 2002; 185, Humana Press; Current Protocols in Stem Cell Biology, ISBN: 9780470151808.

[0185] The singular terms a, an, and the are not intended to be limiting and include plural referents unless explicitly stated otherwise or the context clearly indicates otherwise.

[0186] The terms immunodeficient mouse and immunodeficient non-human animal refer to a mouse or other non-human animal characterized by one or more of: a lack of functional immune cells, such as T cells and B cells; a DNA repair defect; a defect in the rearrangement of genes encoding antigen-specific receptors on lymphocytes; and a lack of immune functional molecules such as IgM, IgG1, IgG2a, IgG2b, IgG3 and IgA.

[0187] Immunodeficient animals, such as mice, can be characterized by one or more deficiencies in a gene involved in immune function, such as Rag1 and Rag2 (Oettinger, M. A et al., Science, 248:1517-1523, 1990; and Schatz, D. G. et al., Cell, 59:1035-1048, 1989)

[0188] The term recombination activating gene 1 deficiency refers to decreased RAG 1 compared to a wild-type non-human animal. RAG 1 is an enzyme functional in the rearrangement and recombination of the genes encoding immunoglobulin and T cell receptor molecules and deficiency reduces or eliminates generation of mature T and B cells. Decreased RAG 1 can be due to gene deletion or mutation. Decreased RAG 1 can be detected, for example, by detection of RAG 1 gene deletion or mutation and/or detection of decreased RAG 1 expression using well-known methods.

[0189] The term recombination activating gene 2 deficiency refers to decreased RAG 2 compared to a wild-type non-human animal. RAG 2 is an enzyme functional in the rearrangement and recombination of the genes encoding immunoglobulin and T cell receptor molecules and deficiency reduces or eliminates generation of mature T and B cells. Decreased RAG 2 can be due to gene deletion or mutation. Decreased RAG 2 can be detected, for example, by detection of RAG 2 gene deletion or mutation and/or detection of decreased RAG 2 expression using well-known methods.

[0190] Immunodeficient mice may have any of these or other defects which result in abnormal immune function in the mice.

[0191] Particularly useful immunodeficient mouse strains are NOD.Cg-Prkdc.sup.scid Il2rg.sup.tmlWjl/SzJ, commonly referred to as NOD scid gamma (NSG) mice, described in detail in Shultz L D et al, 2005, J. Immunol, 174:6477-89; NOD.Cg-Rag1.sup.tm1Mom Il2rg.sup.tmlWjl/SzJ, Shultz L D et al, 2008, Clin Exp Immunol 154(2):270-84 commonly referred to as NRG mice; and NOD.Cg-Prkdc.sup.scid Il2rg.sup.tm1Sugs/JicTac, commonly referred to as NOG mice, described in detail in Ito, M. et al., Blood 100, 3175-3182 (2002).

[0192] The term severe combined immune deficiency (SCID) refers to a condition characterized by absence of T cells and lack of B cell function.

[0193] Common forms of SCID include: X-linked SCID which is characterized by gamma chain gene mutations in the IL2RG gene and the lymphocyte phenotype T() B(+) NK(); and autosomal recessive SCID characterized by Jak3 gene mutations and the lymphocyte phenotype T() B(+) NK(), ADA gene mutations and the lymphocyte phenotype T() B() NK(), IL-7R alpha-chain mutations and the lymphocyte phenotype T() B(+) NK(+), CD3 delta or epsilon mutations and the lymphocyte phenotype T() B(+) NK(+), RAG1/RAG2 mutations and the lymphocyte phenotype T() B() NK(+), Artemis gene mutations and the lymphocyte phenotype T() B() NK(+), CD45 gene mutations and the lymphocyte phenotype T() B(+) NK(+).

[0194] A genetically modified mouse according to aspects of the present invention has the severe combined immunodeficiency mutation (Prkdc.sup.scid), commonly referred to as the scid mutation. The scid mutation is well-known and located on mouse chromosome 16 as described in Bosma, et al., Immunogenetics 29:54-56, 1989. Mice homozygous for the scid mutation are characterized by an absence of functional T cells and B cells, lymphopenia, hypoglobulinemia and a normal hematopoetic microenvironment. The scid mutation can be detected, for example, by detection of markers for the scid mutation using well-known methods, such as PCR or flow cyotometry.

[0195] A genetically modified immunodeficient mouse according to aspects of the present invention has an IL2 receptor gamma chain deficiency. The term IL2 receptor gamma chain deficiency refers to decreased IL2 receptor gamma chain. Decreased IL2 receptor gamma chain can be due to gene deletion or mutation. Decreased IL2 receptor gamma chain can be detected, for example, by detection of IL2 receptor gamma chain gene deletion or mutation and/or detection of decreased IL2 receptor gamma chain expression using well-known methods.

[0196] The terms NOD scid gamma and NSG are used interchangeably herein to refer to a well-known immunodeficient mouse strain NOD.Cg-Prkdc.sup.scid Il2rg.sup.tmlWjl/SzJ. NSG mice combine multiple immune deficits from the NOD/ShiLtJ background, the severe combined immune deficiency (scid) mutation, and a complete knockout of the interleukin-2 receptor gamma chain. As a result, NSG mice lack mature T, B and NK cells, and are deficient in cytokine signaling. NSG mice are characterized by lack of IL2R- (gamma c) expression, no detectable serum immunoglobulin, no hemolytic complement, no mature T lymphocytes, and no mature natural killer cells.

[0197] The term NRG is used herein to refer to a well-known immunodeficient mouse strain NOD.Cg-Rag1.sup.tm1MomIl2rg.sup.tmlWjl/SzJ. NRG mice combine multiple immune deficits from the NOD/ShiLtJ background, a complete knockout of Rag1 due to the Rag1.sup.tm1Mom mutation and a complete knockout of the interleukin-2 receptor gamma chain. As a result, NRG mice lack mature T, B and NK cells, and are deficient in cytokine signaling. NRG mice are characterized by lack of IL2R- (gamma c) expression, no detectable serum immunoglobulin, no hemolytic complement, no mature T lymphocytes, and no mature natural killer cells.

[0198] The term NOG is used herein to refer to a well-known immunodeficient mouse strain NOD.Cg-Prkdc.sup.scid Il2rg.sup.tm1Sug/JicTac. NOG mice combine multiple immune deficits from the NOD/Shi background, the severe combined immune deficiency (scid) mutation, and a complete knockout of the interleukin-2 receptor gamma chain function. As a result, NOG mice lack mature T, B and NK cells, and are deficient in cytokine signaling. NOG mice are characterized by a truncation mutation of IL2R- (gamma c) such that ligands can still bind to the truncated protein but no signal is generated, no detectable serum immunoglobulin, no hemolytic complement, no mature T lymphocytes, and no mature natural killer cells.

[0199] Genetically modified NOD mice are provided by the present invention wherein the genome of the mouse comprises a repaired C5 complement component structural gene such that the genetically modified NOD mouse expresses the C5 complement component structural gene and is characterized by an intact complement system. Such genetically modified NOD mice, NOD-Hc.sup.1, are useful for combining with immunodeficient mice, such as by mating or by in vitro or other in vivo techniques for producing genetically modified immunodeficient mice such as described herein.

[0200] The terms express, expression, expressing and expresses with reference to the C5 complement component structural gene refers to transcription of the C5 complement component structural gene to produce a corresponding mRNA and/or translation of the mRNA to produce a functional corresponding the C5 complement component structural protein.

[0201] The C5 complement component structural gene and corresponding protein are well-known. Mus musculus C5 complement component structural protein is shown as SEQ ID NO: 1 herein.

[0202] A 2-base pair (TA) deletion in the C5 complement component structural gene is responsible for the lack of C5 protein expression in NOD mice (including NSG, NRG and NOG strains) as described in Baxter, A. G. et al., Diabetes, 42(11):1574-8, 1993 as well as in A/J, A/He, AKR, DBA/2, NZB/B1N and B10.D2/oSn mouse strains. This deletion close to the 5 end of exon 7 in the c5 gene located on chromosome 2 generates a premature stop codon and prevents expression of C5.

[0203] Thus, a repaired C5 complement component structural gene restores expression of the C5 complement component structural gene such that C5 complement component structural protein is produced and the genetically modified mice are characterized by an intact complement system.

[0204] The repaired C5 complement component structural gene is preferably repaired to replace the missing 2 base-pair deletion such that the repaired gene encodes the wild-type protein sequence of SEQ ID NO:1.

[0205] Any of various methods can be used to repair the C5 complement component structural gene in a mouse having a mutant C5 complement component structural gene to produce a genetically modified immunodeficient mouse whose genome includes a repaired C5 complement component structural gene. The C5 complement component structural gene is repaired in the genome of genetically modified animals according to standard methods of genetic engineering such as, but not limited to, gene editing methods, homologous recombination and transgenic expression of antisense RNA. Such techniques are well-known in the art and further include, but are not limited to, pronuclear microinjection and transformation of embryonic stem cells. Methods for generating genetically modified animals whose genome includes a repaired C5 complement component structural gene include, but are not limited to, those described in J. P. Sundberg and T. Ichiki, Eds., Genetically Engineered Mice Handbook, CRC Press; 2006; M. H. Hofker and J. van Deursen, Eds., Transgenic Mouse Methods and Protocols, Humana Press, 2002; A. L. Joyner, Gene Targeting: A Practical Approach, Oxford University Press, 2000; Manipulating the Mouse Embryo: A Laboratory Manual, 3rd edition, CSH Press; Dec. 15, 2002, ISBN-10: 0879695919; Kursad Turksen (Ed.), Embryonic stem cells: methods and protocols in Methods Mol Biol. 2002; 185, Humana Press; Current Protocols in Stem Cell Biology, ISBN: 978047015180; Meyer et al. PNAS USA, vol. 107 (34), 15022-15026; and CRISPR-Cas: A Laboratory Manual, Jennifer Doudna, J. and Mali, P. (Eds.), CSH Press, 2016, ISBN 978-1-621821-30-4

[0206] Generation of a genetically modified immunodeficient non-human animal whose genome includes a repaired C5 complement component structural gene can be achieved by introduction of a gene targeting vector into a preimplantation embryo or stem cells, such as embryonic stem (ES) cells or induced pluripotent stem (iPS) cells.

[0207] The term gene targeting vector refers to a double-stranded recombinant DNA molecule effective to recombine with and mutate a specific chromosomal locus, such as by insertion into or replacement of the targeted gene.

[0208] For targeted gene repair, a gene targeting vector is made using recombinant DNA techniques and includes 5 and 3 sequences which are homologous to the stem cell endogenous C5 complement component structural gene. The gene targeting vector optionally and preferably further includes a selectable marker such as neomycin phosphotransferase, hygromycin or puromycin. Those of ordinary skill in the art are capable of selecting sequences for inclusion in a gene targeting vector and using these with no more than routine experimentation. Gene targeting vectors can be generated recombinantly or synthetically using well-known methodology.

[0209] For methods of DNA injection of a gene targeting vector into a preimplantation embryo, the gene targeting vector is linearized before injection into non-human preimplantation embryos. Preferably, the gene targeting vector is injected into fertilized oocytes. Fertilized oocytes are collected from superovulated females the day after mating (0.5 dpc) and injected with the expression construct. The injected oocytes are either cultured overnight or transferred directly into oviducts of 0.5-day p.c. pseudopregnant females. Methods for superovulation, harvesting of oocytes, gene targeting vector injection and embryo transfer are known in the art and described in Manipulating the Mouse Embryo: A Laboratory Manual, 3rd edition, Cold Spring Harbor Laboratory Press; Dec. 15, 2002, ISBN-10: 0879695919. Offspring can be tested for the presence of a repaired C5 complement component structural gene by DNA analysis, such as PCR, Southern blot or sequencing. Mice having a repaired C5 complement component structural gene can be tested for C5 complement component structural protein expression such as by using ELISA or Western blot analysis and/or mRNA expression such as by RT-PCR.

[0210] Alternatively the gene targeting vector may be transfected into stem cells (ES cells or iPS cells) using well-known methods, such as electroporation, calcium-phosphate precipitation and lipofection.

[0211] Mouse ES cells are grown in media optimized for the particular line. Typically ES media contains 15% fetal bovine serum (FBS) or synthetic or semi-synthetic equivalents, 2 mM glutamine, 1 mM Na Pyruvate, 0.1 mM non-essential amino acids, 50 U/ml penicillin and streptomycin, 0.1 mM 2-mercaptoethanol and 1000 U/ml LIF (plus, for some cell lines chemical inhibitors of differentiation) in Dulbecco's Modified Eagle Media (DMEM). A detailed description is known in the art (Tremml et al., 2008, Current Protocols in Stem Cell Biology, Chapter 1:Unit 1C.4. For review of inhibitors of ES cell differentiation, see Buehr, M., et al. (2003). Genesis of embryonic stem cells. Philosophical Transactions of the Royal Society B: Biological Sciences 358, 1397-1402.

[0212] The cells are screened for a repaired C5 complement component structural gene by DNA analysis, such as PCR, Southern blot or sequencing. Cells with the correct homologous recombination event repairing the C5 complement component structural gene can be tested for C5 complement component structural protein expression such as by using ELISA or Western blot analysis and/or mRNA expression such as by RT-PCR. If desired, the selectable marker can be removed by treating the stem cells with Cre recombinase. After Cre recombinase treatment the cells are analyzed for the presence of the nucleic acid encoding C5 complement component structural protein.

[0213] Selected stem cells with the correct genomic event repairing the C5 complement component structural gene can be injected into preimplantation embryos. For microinjection, ES or iPS cell are rendered to single cells using a mixture of trypsin and EDTA, followed by resuspension in ES media. Groups of single cells are selected using a finely drawn-out glass needle (20-25 micrometer inside diameter) and introduced through the embryo's zona pellucida and into the blastocysts cavity (blastocoel) using an inverted microscope fitted with micromanipulators. Alternatively to blastocyst injection, stem cells can be injected into early stage embryos (e.g. 2-cell, 4-cell, 8-cell, premorula or morula). Injection may be assisted with a laser or piezo pulses drilled opening the zona pellucida. Approximately 9-10 selected stem cells (ES or iPS cells) are injected per blastocysts, or 8-cell stage embryo, 6-9 stem cells per 4-cell stage embryo, and about 6 stem cells per 2-cell stage embryo. Following stem cell introduction, embryos are allowed to recover for a few hours at 37 C. in 5% CO2, 5% 02 in nitrogen or cultured overnight before transfer into pseudopregnant recipient females. In a further alternative to stem cell injection, stem cells can be aggregated with morula stage embryos. All these methods are well established and can be used to produce stem cell chimeras. For a more detailed description see Manipulating the Mouse Embryo: A Laboratory Manual, 3rd edition (A. Nagy, M. Gertsenstein, K. Vintersten, R. Behringer, Cold Spring Harbor Laboratory Press; Dec. 15, 2002, ISBN-10: 0879695919, Nagy et al., 1990, Development 110, 815-821; U.S. Pat. No. 7,576,259: Method for making genetic modifications, U.S. Pat. Nos. 7,659,442, 7,294,754, Kraus et al. 2010, Genesis 48, 394-399).

[0214] Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and CRISPR-associated (Cas) systems can be used to repair the C5 complement component structural gene in non-human animals, including mice (e.g. NSG or NRG mice). Three types (I-III) of CRISPR systems have been identified across a wide range of bacterial and archaeal hosts, wherein each system comprises a cluster of CRISPR-associated (Cas) genes, noncoding RNAs and a distinctive array of repetitive elements (direct repeats). These direct repeats are interspaced by short variable sequences derived from exogenous DNA targets known as protospacers, and together they constitute the CRISPR RNA (crRNA) array. Within the DNA target, each protospacer is associated with a protospacer adjacent motif (PAM), which can vary depending on the specific CRISPR system.

[0215] For example, the type II CRISPR-Cas9 system, permits targeted gene cleavage and gene editing in a variety of eukaryotic cells. In order to easily manipulate genes using a CRISPR-Cas9 system, naturally-occurring tracrRNA and crRNA are fused into a single, synthetic guide RNA that directs Cas9 to virtually any desired DNA sequence. Thus, because the endonuclease cleavage specificity in CRISPR-Cas9 system is guided by RNA sequences, editing can be directed to virtually any genomic locus by engineering the guide RNA sequence and delivering it along with the Cas endonuclease to the target cell. The synthetic guide RNA hybridizes to a 20-nucleotide DNA sequence and immediately preceding the specific motif recognized by the Cas9. This results in a double-strand break three nucleotides upstream of the recognized motif. The double strand break can initiate homology-directed repair, which can be exploited with the use of an exogenously introduced double-strand or single-strand DNA repair template to correct a mutation in the genome, such as to repair the C5 complement structural gene. Those of ordinary skill in the art are capable of engineering the guide RNA sequence of a Cas system, such as the CRISPR-Cas9 system, to target the C5 complement structural gene of non-human animals, including a mouse (e.g. an NSG or NRG mouse) and use exogenously introduced double-strand or single-strand DNA repair template to repair the C5 complement structural gene.

[0216] Pseudopregnant embryo recipients are prepared using methods known in the art. Briefly, fertile female mice between 6-8 weeks of age are mated with vasectomized or sterile males to induce a hormonal state conductive to supporting surgically introduced embryos. At 2.5 days post coitum (dpc) up to 15 of the stem cell containing blastocysts are introduced into the uterine horn very near to the uterus-oviduct junction. For early stage embryos and morula, such embryos are either cultured in vitro into blastocysts or implanted into 0.5 dpc or 1.5 dpc pseudopregnant females according to the embryo stage into the oviduct. Chimeric pups from the implanted embryos are born 16-20 days after the transfer depending on the embryo age at implantation. Chimeric males are selected for breeding. Offspring can be analyzed for transmission of the ES cell genome by coat color and nucleic acid analysis, such as PCR, Southern blot or sequencing. Further the expression of repaired C5 complement component structural gene can be analyzed for C5 complement component structural protein mRNA or protein expression such as by protein analysis, e.g. immunoassay, or functional assays, to confirm repair of the C5 complement component structural gene. Offspring having the repaired C5 complement component structural gene are intercrossed to create non-human animals homozygous for the repaired C5 complement component structural gene. The transgenic mice are crossed to the immunodeficient mice to create a congenic immunodeficient strain with the repaired C5 complement component structural gene.

[0217] Methods of assessing a genetically modified non-human animal to determine whether the C5 complement component structural gene is repaired such that the non-human animal expresses the repaired C5 complement component structural gene are well-known and include standard techniques such as nucleic acid assays, spectrometric assays, immunoassays and functional assays.

[0218] One or more standards can be used to allow quantitative determination of C5 complement component structural protein in a sample.

[0219] Assays for assessment of function repaired C5 complement component structural gene in an animal having a putative repair of the C5 complement component structural gene can be performed.

[0220] Optionally, genetically modified immunodeficient non-human animals characterized by repaired C5 complement component structural gene of the present invention are produced by selective breeding. A first parental strain of non-human animal which has a first desired genotype may be bred with a second parental strain of non-human animal which has a second desired genotype to produce offspring which are genetically modified non-human animals having the first and second desired genotypes. For example, a first mouse which is immunodeficient and has a mutated C5 complement component structural gene may be bred with a second mouse which has an intact C5 complement component structural gene and further genetically crossed to produce offspring which are immunodeficient and have a repaired C5 complement component structural gene such that the C5 complement component structural gene is expressed and the animal has an intact complement system and demonstrates complement-dependent cytotoxicity.

[0221] In further examples, an NSG, NRG or NOG mouse may be bred with a mouse which has an intact C5 complement component structural gene to produce offspring which are immunodeficient and have a repaired C5 complement component structural gene such that the produced mice have an intact complement system and demonstrate complement-dependent cytotoxicity.

[0222] Aspects of the invention provide genetically modified animals that include a repaired C5 complement component structural gene in substantially all of their cells, as well as genetically modified animals that include a repaired C5 complement component structural gene in some, but not all their cells.

[0223] Genetically modified immunodeficient non-human animals of the present invention are preferably non-human mammals, particularly rodents, such as mice, rats or guinea pigs.

[0224] Methods for producing a non-human animal model system for response of xenograft tumor cells according to aspects of the present invention include providing a genetically modified immunodeficient non-human animal comprising a repaired C5 complement component structural gene such that the genetically modified immunodeficient non-human animal expresses C5 complement component structural protein and has a functioning complement system; and administering xenograft tumor cells to the genetically modified immunodeficient non-human animal. The immunodeficient non-human animal may have a severe combined immunodeficiency, an IL2 receptor gamma chain deficiency, or a severe combined immunodeficiency and an IL2 receptor gamma chain deficiency in combination.

[0225] The term xenograft is used herein with reference to a host cell or organism to indicate that the material referred to as xenograft is derived from another species than that of the host cell or organism.

[0226] The term tumor cells as used herein refers to abnormally proliferating cells, such as cancer cells.

[0227] Methods for producing a mouse model system for response of xenogeneic tumor cells according to aspects of the present invention include providing a genetically modified immunodeficient mouse having a repaired C5 complement component structural gene such that the genetically modified immunodeficient mouse expresses C5 complement component structural protein and has a functioning complement system; and administering xenogeneic tumor cells to the genetically modified immunodeficient mouse. The immunodeficient mouse may have a severe combined immunodeficiency, an IL2 receptor gamma chain deficiency, or a severe combined immunodeficiency and an IL2 receptor gamma chain deficiency in combination.

[0228] Tumor cells for administration to a genetically modified immunodeficient animal having a repaired C5 complement component structural gene can be obtained from a tumor biopsy or necropsy sample from a subject or a cancer cell line.

[0229] Administration of tumor cells to an animal for xenograft is well known, such as, but not limited to, subcutaneous surgical insertion of tumor cells or tumor tissue, or subcutaneous or intravenous injection of tumor cells or tumor tissue, see for example, Morton et al., Nature Protocols 2, 247-250 (2007); and Fujii et al., Pathol. Int., 2008, 58(9):559-67.

[0230] Engraftment of xenograft tumor cells can be assessed by any of various methods, such as, but not limited to, optical inspection of tumor growth, blood sampling and analysis where the tumor cells are not solid tumor forming cells, and imaging of the animal such as MRI, PET, CT or fluorescent imaging.

[0231] Exemplary methods for isolation of xenograft tumor cells, administration of the xenograft tumor cells to a host organism and methods for assessing engraftment thereof are well known.

[0232] The number of xenograft tumor cells administered to the recipient animal to be engrafted is not limited and can be in the range of 1 cell-1 billion cells, such as 1 cell-500 million cells, 1 cell-100 million cells, 1 cell-10 million cells, 1 cell-5 million cells, 1 cell-1 million cells, 1 cell-500,000 cells, 1 cell-100,000 cells, 1 cell-50,000 cells, 1 cell-10,000 cells or 1 cell-1,000 cells, of such cells.

[0233] Methods are provided according to aspects of the present invention which include administration of an anti-cancer therapeutic to the xenograft tumor cells in an immunodeficient animal having a repaired C5 complement component structural gene and analysis of the effect of the anti-cancer therapeutic on the xenograft tumor cells.

[0234] Assays for evaluation of C5 complement component structural gene defects and repair

[0235] Binding assays are optionally used in assays according to aspects of the present invention to evaluate C5 complement component structural gene defects and repair.

[0236] The term binding partner refers to a biological molecule capable of specific binding to a target analyte. Non-limiting examples of binding partners include antibodies, aptamers, receptors, ligands and substrates for enzymatic action of a target analyte. Binding partners may also be nucleic acid probes. The skilled artisan can routinely identify, isolate and/or make binding partners and use them in binding assays. Such techniques are well-known to those of ordinary skill in the art.

[0237] A binding assay can be performed according to any of various methods that allow for detection of one or more target analytes by binding to a binding partner. Binding of a target analyte and binding agent can be detected directly or indirectly, such as by use of detectable labels.

[0238] Nucleic acid assays such as sequencing, an amplification assay and/or a hybridization assay can be used to detect expression of a target analyte. Nucleic acid assays, include, but are not limited to, amplification reactions such as polymerase chain reactions (PCR), such as RT-PCR; dot blot; in situ hybridization; Northern blot; and RNase protection. Details of such assays are described in J. Sambrook and D. W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; and F. M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002, for example.

[0239] A nucleic acid probe or primer able to hybridize to a target analyte mRNA or cDNA to detect and/or quantify mRNA or cDNA can be used in a nucleic assay. A nucleic acid probe can be an oligonucleotide of at least 10, 15, 30, 50 or 100 nucleotides in length and sufficient to specifically hybridize under stringent conditions to a target mRNA or cDNA or complementary sequence thereof. A nucleic acid primer can be an oligonucleotide of at least 10, 15 or 20 nucleotides in length and sufficient to specifically hybridize under stringent conditions to the mRNA or cDNA, or complementary sequence thereof. The terms specific hybridization and specifically hybridizes refer to hybridization of a particular nucleic acid to a target nucleic acid without substantial hybridization to nucleic acids other than the target nucleic acid in a sample.

[0240] Stringency of hybridization and washing conditions depends on several factors, including the Tm of the probe and target and ionic strength of the hybridization and wash conditions, as is well-known to the skilled artisan. Hybridization and conditions to achieve a desired hybridization stringency are described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001; and Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002.

[0241] A sample from a non-human animal is optionally purified for assay according to a method of the present invention. Methods for isolation of mRNA and/or generation of cDNA for use in an assay of particular sequences are well known in the art.

[0242] The term nucleic acid refers to RNA or DNA molecules having more than one nucleotide in any form including single-stranded, double-stranded, oligonucleotide or polynucleotide. The term nucleotide sequence refers to the ordering of nucleotides in an oligonucleotide or polynucleotide in a single-stranded form of nucleic acid.

[0243] The term amplification assay refers to a method for copying a template nucleic acid, thereby producing nucleic acids which include copies of all or a portion of the template nucleic acid.

[0244] Amplification assays include those which include template directed primer extension catalyzed by a nucleic acid polymerase using a pair of primers which flank the target nucleic acid, illustratively including, but not limited to, polymerase chain reaction (PCR), reverse-transcription PCR (RT-PCR), ligation-mediated PCR (LM-PCR), phi-29 PCR, and other nucleic acid amplification methods, for instance, as described in C. W. Dieffenbach et al., PCR Primer: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2003; and V. Demidov et al., DNA Amplification: Current Technologies and Applications, Taylor & Francis, 2004. The term primer refers to a single stranded oligonucleotide, typically about 9-60 nucleotides in length, that may be longer or shorter, and that serves as a point of initiation for template-directed DNA synthesis.

[0245] Appropriate reactions conditions for in vitro nucleic acid amplification methods include presence of suitable reaction components including, but not limited to, a polymerase and nucleotide triphosphates. One of skill in the art will be able to determine conditions suitable for amplification of the target nucleic acids with only routine experimentation using primers of the present invention including choice of factors such as buffer, nucleotides, pH, Mg salt concentration, primer concentration and temperature. The nucleic acid product of the amplification methods optionally contains additional materials such as, but not limited to, non-target nucleic acid sequences, functional groups for chemical reaction and detectable labels, present in the primers and not present in the original DNA template. PCR may also being performed as quantitative PCR (Q-PCR) also known as real-time PCR or kinetic PCR (KPCR). Q-PCR is used to amplify and simultaneously quantify a targeted DNA molecule.

[0246] The terms quantitative PCR or Q-PCR refer to a variety of methods for quantifying the results of polymerase chain reactions. Q-PCR methods generally determine or compare the amplification factor, such as determining the threshold cycle (Ct), or are co-amplification methods that compare the amount of produce generated from simultaneous amplification of target and standard templates. Many Q-PCR techniques include reporter probes, intercalator dyes or both. Reporter probes include, but are not limited to, TaqMan probes (Applied Biosystems), molecular beacons, Scorpion primers, Lux primers and FRET primers; and intercalator dyes include, but are not limited to, ethidium bromide, SYBR Green I (Molecular Probes) and PicoGreen (Molecular Probes).

[0247] For one or more specific sequences in a DNA sample, Real Time-PCR enables both detection and quantification. The quantity can be either an absolute number of copies or a relative amount when normalized to DNA input or additional normalizing genes. Two common methods for detection of products in real-time PCR are: (1) non-specific fluorescent dyes that intercalate with any double-stranded DNA, and (2) sequence-specific DNA probes consisting of oligonucleotides that are labeled with a fluorescent reporter which permits detection only after hybridization of the probe with its complementary DNA target. For example TaqMan probes are used. The TaqMan probe principle relies on the 5-3 exonuclease activity of Taq polymerase to cleave a dual-labeled probe during hybridization to the complementary target sequence and fluorophore-based detection. As in other real-time PCR methods, the resulting fluorescence signal permits quantitative measurements of the accumulation of the product during the exponential stages of the PCR; however, the TaqMan probe significantly increases the specificity of the detection. TaqMan probes consist of a fluorophore covalently attached to the 5-end of the oligonucleotide probe and a quencher at the 3-end. Several different fluorophores (e.g. 6-carboxyfluorescein, acronym: FAM, or tetrachlorofluorescin, acronym: TET) and quenchers (e.g. tetramethylrhodamine, acronym: TAMRA, or dihydrocyclopyrroloindole tripeptide minor groove binder, acronym: MGB) are available. The quencher molecule quenches the fluorescence emitted by the fluorophore when excited by the cycler's light source via FRET (Fluorescence Resonance Energy Transfer) As long as the fluorophore and the quencher are in proximity, quenching inhibits any fluorescence signals.

[0248] TaqMan probes are designed such that they anneal within a DNA region amplified by a specific set of primers. As the Taq polymerase extends the primer and synthesizes the nascent strand (again, on a single-strand template, but in the direction opposite to that shown in the diagram, i.e. from 3 to 5 of the complementary strand), the 5 to 3 exonuclease activity of the polymerase degrades the probe that has annealed to the template. Degradation of the probe releases the fluorophore from it and breaks the close proximity to the quencher, thus relieving the quenching effect and allowing fluorescence of the fluorophore. Hence, fluorescence detected in the real-time PCR thermal cycler is directly proportional to the fluorophore released and the amount of DNA template present in the PCR.

[0249] Hybridization assays for a nucleic acid target include, but are not limited to, dot blot, nucleic acid hybridization, bead assays, in situ hybridization, Northern blot, Southern blot and microarray assays. Details of such assays are described in J. Sambrook and D. W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; and F. M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002, for example.

[0250] Nucleic acid hybridization assays include use of a nucleic acid probe which specifically hybridizes to a target nucleic acid under defined hybridization and wash conditions. The term probe encompasses nucleic acid sequences of various lengths, typically at least about 9 to about 8000 nucleotides in length, but may be shorter or longer as long as the probe is capable of specifically hybridizing to a target nucleic acid in a nucleic acid hybridization assay. A probe may be single or double stranded and may be generated by recombinant methods, chemical synthesis, isolation from natural sources, or a combination of two or more of these.

[0251] Immunoassay methods can be used to assay a target analyte, including, but not limited to, enzyme-linked immunosorbent assay (ELISA), enzyme-linked immunofiltration assay (ELIFA), flow cytometry, immunoblot, immunoprecipitation, immunohistochemistry, immunocytochemistry, luminescent immunoassay (LIA), fluorescent immunoassay (FIA), and radioimmunoassay. Assay methods may be used to obtain qualitative and/or quantitative results. Specific details of suitable assay methods for both qualitative and quantitative assay of a sample are described in standard references, illustratively including E. Harlow and D. Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1988; F. Breitling and S. Dbel, Recombinant Antibodies, John Wiley & Sons, New York, 1999; H. Zola, Monoclonal Antibodies: Preparation and Use of Monoclonal Antibodies and Engineered Antibody Derivatives, Basics: From Background to Bench, BIOS Scientific Publishers, 2000; B. K. C. Lo, Antibody Engineering: Methods and Protocols, Methods in Molecular Biology, Humana Press, 2003; F. M. Ausubel et al., Eds., Short Protocols in Molecular Biology, Current Protocols, Wiley, 2002; S. Klussman, Ed., The Aptamer Handbook: Functional Oligonucleotides and Their Applications, Wiley, 2006; Ormerod, M. G., Flow Cytometry: a practical approach, Oxford University Press, 2000; Givan, A. L., Flow Cytometry: first principles, Wiley, New York, 2001; Gorczyca, W., Flow Cytometry in Neoplastic Hematology: morphologic-immunophenotypic correlation, Taylor & Francis, 2006; Crowther, J. R., The ELISA Guidebook (Methods in Molecular Biology), Humana Press, 2000; Wild, D., The Immunoassay Handbook, 3rd Edition, Elsevier Science, 2005; and J. Sambrook and D. W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 3rd Ed., 2001.

[0252] Antibodies and methods for preparation of antibodies are well-known in the art. As used herein, the terms antibody and antibodies encompass monoclonal antibodies, polyclonal antibodies, bispecific antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, camelized antibodies, single domain antibodies, single-chain Fvs (scFv), single chain antibodies, disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies and antigen-binding fragments of any of the above. In particular, antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site. Immunoglobulin molecules are of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or subclass.

[0253] As used herein, the terms antibody fragment and antigen-binding fragment defines a fragment of an antibody that immunospecifically binds to a target analyte. Antibody fragments may be generated by any technique known to one of skill in the art. For example, Fab and F(ab)2 fragments may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab)2 fragments). Antibody fragments are also produced by recombinant DNA technologies.

[0254] Antibodies, antigen-binding fragments, methods for their generation and methods for screening of generated antibodies for substantially specific binding to an antigen are known in the art and such antibodies, antigen binding fragments and methods are described in further detail, for instance, in Antibody Engineering, Kontermann, R. and Dbel, S. (Eds.), Springer, 2001; Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1988; F. Breitling and S. Dbel, Recombinant Antibodies, John Wiley & Sons, New York, 1999; H. Zola, Monoclonal Antibodies: Preparation and Use of Monoclonal Antibodies and Engineered Antibody Derivatives, Basics: From Background to Bench, BIOS Scientific Publishers, 2000; Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002; J. D. Pound (Ed.) Immunochemical Protocols, Methods in Molecular Biology, Humana Press, 2nd ed., 1998; B. K. C. Lo (Ed.), Antibody Engineering: Methods and Protocols, Methods in Molecular Biology, Humana Press, 2003; and Kohler, G. and Milstein, C., Nature, 256:495-497 (1975). Antibodies for target analytes can be produced in animals, synthesized, produced by recombinant methods and/or obtained commercially.

[0255] Aptamers can be used to assay a target analyte. The term aptamer refers to a peptide and/or nucleic acid that substantially specifically binds to a specified substance. In the case of a nucleic acid aptamer, the aptamer is characterized by binding interaction with a target other than Watson/Crick base pairing or triple helix binding with a second and/or third nucleic acid. Such binding interaction may include Van der Waals interaction, hydrophobic interaction, hydrogen bonding and/or electrostatic interactions, for example. Similarly, peptide-based aptamers are characterized by specific binding to a target wherein the aptamer is not a naturally occurring ligand for the target. Techniques for identification and generation of peptide and nucleic acid aptamers and their use are known in the art as described, for example, in F. M. Ausubel et al., Eds., Short Protocols in Molecular Biology, Current Protocols, Wiley, 2002; S. Klussman, Ed., The Aptamer Handbook: Functional Oligonucleotides and Their Applications, Wiley, 2006; and J. Sambrook and D. W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 3rd Ed., 2001.

[0256] Detecting binding between a target analyte present in a sample and a binding partner is achieved by any of various methods known in the art, illustratively including detection of a detectable label directly or indirectly attached to the target analyte or the binding partner. The term detectable label refers to a material capable of producing a signal indicative of the presence of the detectable label by any appropriate method illustratively including spectroscopic, optical, photochemical, biochemical, enzymatic, electrical and/or immunochemical. Examples of detectable labels illustratively include a fluorescent moiety, a chemiluminescent moiety, a bioluminescent moiety, an electron dense particle, a magnetic particle, an enzyme, a substrate, a radioisotope and a chromophore.

[0257] The identity of a particular detectable label or labels used depends on the detection process used. Such detection processes are incorporated in particular assay formats illustratively including ELISA, Western blot, immunoprecipitation, immunocytochemistry, immuno-fluorescence assay, liquid chromatography, flow cytometry, other detection processes known in the art, or combinations thereof.

[0258] A binding assay can incorporate a binding partner attached to a support. A support with attached binding partner used in a binding assay can be solid or semi-solid and can be any of various materials such as glass, silicon, paper, a synthetic or naturally occurring polymer, such as polystyrene, polycarbonate, polypropylene, PVDF, nylon, cellulose, agarose, dextran, and polyacrylamide or any other material to which a binding partner can be stably attached for use in a binding assay.

[0259] A support used can include functional groups for binding to binding partners, such as, but not limited to carboxyl, amine, amino, carboxylate, halide, ester, alcohol, carbamide, aldehyde, chloromethyl, sulfur oxide, nitrogen oxide, epoxy and/or tosyl functional groups. Attachment of binding partners to a support is achieved by any of various methods, illustratively including adsorption and chemical bonding. In one example, 1-Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride, EDC or EDAC chemistry, can be used to attach binding partners to particles. The binding partners can be bonded directly or indirectly to the material of the support, for example, via bonding to a coating or linker disposed on the support. Functional groups, modification thereof and attachment of a binding partner to a support are known in the art, for example as described in Fitch, R. M., Polymer Colloids: A Comprehensive Introduction, Academic Press, 1997.

[0260] Such supports can be in any of a variety of forms and shapes including, but not limited to, microtiter plates, microtiter wells, pins, fibers, beads, slides, silicon chips and membranes such as a nitrocellulose or PVDF membrane.

[0261] Any of various spectroscopy methods can be used to assay a target analyte according to aspects of the present invention, including, but not limited to, gas chromatography, liquid chromatography, ion mobility spectrometry, mass spectrometry, liquid chromatography-mass spectrometry (LC-MS or HPLC-MS), ion mobility spectrometry-mass spectrometry, tandem mass spectrometry, gas chromatography-mass spectrometry, matrix-assisted desorption ionization time-of-flight (MALDI-TOF) mass spectrometry, surface-enhanced laser desorption ionization (SELDI) and nuclear magnetic resonance spectroscopy, all of which are well-known to the skill artisan.

[0262] Optionally, spectrometric analysis is used to assay a sample for a target analyte. Mass analysis can be used in an assay according to aspects of the present invention. Mass analysis is conducted using, for example, time-of-flight (TOF) mass spectrometry or Fourier transform ion cyclotron resonance mass spectrometry. Mass spectrometry techniques are known in the art and exemplary detailed descriptions of methods for protein and/or peptide assay are found in Li J., et al., Clin Chem., 48(8):1296-304, 2002; Hortin, G. L., Clinical Chemistry 52: 1223-1237, 2006; A. L. Burlingame, et al. (Eds.), Mass Spectrometry in Biology and Medicine, Humana Press, 2000; and D. M. Desiderio, Mass Spectrometry of Peptides, CRC Press, 1990.

[0263] Assays for evaluation of effect of an anti-cancer therapeutic antibody or putative anti-cancer therapeutic antibody on xenograft tumor cells.

[0264] Assays performed on living animals for evaluation of effect of an anti-cancer therapeutic antibody or putative anti-cancer therapeutic antibody on xenograft tumor cells can be used such as survival studies, measurement of tumor size and animal weight.

[0265] Tumor biopsies can be assessed for proliferation and viability of xenograft cells by any of various assays known in the art, such as by staining with trypan blue or propidium iodide.

[0266] Analysis of animal tissues and/or blood samples can be performed to determine toxicity of the anti-cancer therapeutic as well as the therapeutic effect of an anti-cancer therapeutic.

[0267] Tumor burden and metastasis can be evaluated by any of various methods such as flow cytometry and/or immunohistochemistry.

[0268] Binding assays such as those described herein can be used to evaluate the effect of an anti-cancer therapeutic on a xenograft, such as assays to detect one or more tumor biomarkers.

[0269] The term anti-cancer therapeutic antibody refers to an antibody known to have an anti-cancer effect at least partly mediated by complement dependent cytotoxicity on at least one type of cancer cell. Such antibodies are known in the art and illustratively include rituximab, trastuzumab, alemtuzumab, cetuximab, panitumumab, catumaxomab, and ofatumumab.

[0270] The term putative anti-cancer therapeutic antibody refers to an antibody for which an anti-cancer effect may be at least partly mediated by complement dependent cytotoxicity on at least one type of cancer cell. Methods for assessing the effect of an anti-cancer therapeutic provided according to aspects of the present invention allow for determination of whether the putative anti-cancer therapeutic antibody has an anti-cancer effect may be at least partly mediated by complement dependent cytotoxicity on at least one type of cancer cell.

[0271] An anti-cancer therapeutic antibody or putative anti-cancer therapeutic antibody can be an antibody of any type appropriate for mediating an anti-cancer effect by complement dependent cytotoxicity, illustratively including an antibody derived from any species of animal such as mouse, rat, guinea pig, rabbit, goat, sheep, pig, cow, horse, chicken, dog, camel, human and non-human primate. The anti-cancer therapeutic antibody or putative anti-cancer therapeutic antibody can be any type of antibody capable of mediating an anti-cancer effect by complement dependent cytotoxicity such as a monoclonal antibody, polyclonal antibody, bispecific antibody, multispecific antibody, human antibody, humanized antibody, chimeric antibody, camelized antibody, single domain antibody, single-chain Fvs (scFv), single chain antibody, disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibody and fragments of any of the above capable of mediating an anti-cancer effect by complement dependent cytotoxicity. In particular, antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules mediating lysis of a target cell, i.e. an anti-cancer effect on a target cancer cell, by complement dependent cytotoxicity. Such antibodies are of any type, e.g., IgG and IgM, class e.g., IgG1, IgG2, IgG3, IgG4, or subclass capable of mediating lysis of a target cell, i.e. an anti-cancer effect on a target cancer cell, by complement dependent cytotoxicity.

[0272] Standards

[0273] Standards suitable for assays are well-known in the art and the standard used can be any appropriate standard.

[0274] In one example, a standard is a result of an assay of the one or more tumor biomarkers in a comparable sample from a control animal.

[0275] A standard may be a reference level of the one or more tumor biomarkers previously determined in a sample of an individual control animal or in a population of control animals and stored in a print or electronic medium for recall and comparison to a result of an assay of the one or more tumor biomarkers in an animal to which an anti-cancer therapeutic is administered.

[0276] A standard can be an average level of one or more indicators in comparable samples obtained from one or more populations. The average level is determined by assay of the one or more indicators in comparable samples obtained from each animal of the population. The term comparable sample is used to indicate that the samples are of the same type, i.e. each of the comparable samples is a serum sample, for example.

[0277] A difference detected in levels or expression of one or more target analytes in assays of the present invention compared to a standard can be an increase or decrease in level or expression of the one or more target analytes. The magnitude of the increase or decrease can be, for example, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more, of the standard level.

[0278] Assay results can be analyzed using statistical analysis by any of various methods, exemplified by parametric or non-parametric tests, analysis of variance, analysis of covariance, logistic regression for multivariate analysis, Fisher's exact test, the chi-square test, Student's T-test, the Mann-Whitney test, Wilcoxon signed ranks test, McNemar test, Friedman test and Page's L trend test. These and other statistical tests are well-known in the art as detailed in Hicks, CM, Research Methods for Clinical Therapists: Applied Project Design and Analysis, Churchill Livingstone (publisher); 5th Ed., 2009; and Freund, R J et al., Statistical Methods, Academic Press; 3rd Ed., 2010.

[0279] Aspects of inventive genetically modified non-human animals, compositions and methods are illustrated in the following examples. These examples are provided for illustrative purposes and are not considered limitations on the scope of inventive compositions and methods.

EXAMPLES

Example 1

[0280] Generation of sufficient complement NSG.

[0281] Absence of hemolytic complement lytic activity in NOD mice results from a 2 base pair deletion in the Hc gene encoding the C5 complement component. The termination codon UGA is present 4 bp downstream from the deletion that causes the lack of C5 protein expression. The defective Hc.sup.0 allele expressed by NOD/Lt mice (Hc locus Chr 2) was replaced by a wild-type Hc.sup.1 allele from CBA by outcrossing a CBA/Ls female to a NOD/Lt male mice, followed by ten backcrosses to NOD/Lt mice and fixation of sex chromosomes from NOD/Lt mice. A homozygous congenic mouse strain, designated NOD-Hc.sup.1, was obtained carrying Chr 2 alleles derived from CBA/Ls including Hc.sup.1 allele, i.e. NOD.CBALs-Hc.sup.1/Lt (stock #004306), from The Jackson Laboratory bio-repository. Male NOD.CBALs-Hc.sup.1/Lt mice were mated with female NSG mice from the Jackson Laboratory biorepository (stock #005557).

[0282] cDNA from F1 offspring mice were subjected to targeted Sanger sequencing capturing up to 0.21 kb region on exon 5 of the Hc gene. The F1 mice were heterozygous for the wild type Hc gene (Hc.sup.0/Hc.sup.1), the Prkdc.sup.scid mutation and the Il2rg.sup.null allele. These heterozygous F1 mice were then intercrossed to produce NSG mice homozygous for the Prkdc.sup.scid, IL2rg.sup.tmlWjl and Hc.sup.1 alleles, i.e. NSG-Hc.sup.1 mice, FIG. 1A. The colony is maintained by sib matings of NSG-Hc.sup.1 mice.

[0283] The C5 normal allele to the NSG strain. Primers used were:

TABLE-US-00001 Primer:Oligonucleotide947,Oligonucleotide945 Primer1sequence: (SEQIDNO:2) CAATTAAAGCTTACTATAAGAAGGATTTTACAA Primer2sequence: (SEQIDNO:3) CAAGTTAGATCTAAGCACTAGCTACTCAAACAA
Product size: 0.21kb

MGI Accession ID: MGI:6305

212 bp: BALB/cJ, DBA/1J, B10.D2-H2<d>/nSnJ, C57BL/6J

210 bp AKR/J, A/HeJ, B10.D2-H2<d>/oSnJ, NZB/B1NJ, SWR/J, DBA/2.

[0284] For Sanger sequencing and genotyping, total genomic DNA was prepared from 2 mm slices of tails of 4-6 week old mice using a 95 degrees 50 mM NaOH heat step followed by neutralization and centrifugation to pellet the debris. A 210 bp product containing exon 5 of the Hc gene was amplified using the following primer set; Forward: CAATTAAAGCTTACTATAAGAAGGATTTTACAA (SEQ ID NO:2) and Reverse: CAAGTTAGATCTAAGCACTAGCTACTCAAACAA (SEQ ID NO:3). Bands of interest were excised and gel extracted using the QIAquick Gel Extraction kit (Qiagen) and eluted in 30 l double distilled water. If gel extraction was not necessary to separate multiple bands, PCR products were directly cleaned using ExoSAP-It (USB, Cleveland, Ohio). DNA samples were quantitated using the Nanodrop ND-1000 UV spectrophotometer (Nanodrop Technologies, Wilmington, Del.). Sequencing reactions with gene-specific primers were carried out using the BigDye Terminatory Cycle Sequencing chemistry and resolved on the AB3703x1 (Applied Biosystems Life Technologies, Carlsbad, Calif.). cDNA was sequenced from both strands of NSG and NSG-Hc.sup.1 mice. Sequencher 4.9 (Gene Codes, Ann Arbor, Mich.) was used to assemble DNA sequences.

[0285] All mice were reared on NIH 31 M diet and acidified water ad libitum under modified barrier conditions at The Jackson Laboratory in a 12-hr dark/12-hr light cycle.

Example 2

[0286] In vitro characterization of complement dependent cytotoxicity in NSG-Hc.sup.1 mice.

[0287] Sera from 9-10 month old male BALB/cBy, NSG and NSG-Hc.sup.1 mice were collected and the level of complement activity in mouse sera was determined by examining the capacity of 1:5 diluted mouse sera to lyse antibody coated sheep RBCs, i.e. sensitized cells (EA cells). Sheep RBCs (Cat #10H72) and rabbit antiserum to sheep RBCs (Cat #10K945), were purchased form Grainger. Sheep RBCs (SRBC) were washed and maintained in HBSS medium. Whole mouse blood was collected directly into Becton Dickinson microtainer tubes with serum separator and allowed to clot by leaving undisturbed for 15 minutes at room temperature. The clots were removed by centrifugation and the sera were removed using a sterile pipette. Complement activity in mouse sera was determined by measuring the lysis of antibody-coated SRBC in various serum dilutions. Briefly, SRBC cells incubated with anti-SRBC antibody (EA cells) were prepared by mixing an equal volume of RBCs (110.sup.9 cells/ml) and 1:10 diluted anti-sheep RBC rabbit Ab in HBSS and incubating at 37 C. for 30 min. The complement activity was determined by mixing 25 l of EA cells at 10.sup.9/ml in HBSS medium with 175 ul of 1:5 diluted mouse sera in a V-bottom 96 well plate. EA cells incubated either with ACK lysis buffer or only HBSS medium were used as positive and negative controls, respectively. EA cells and sera were incubated for 1 hour at 37 C., centrifuged for 10 min at 2,500g and the OD 405 of the supernatant measured to assess EA cell lysis. Percentage complement-dependent lysis in mouse sera was calculated relative to cells lysed in ACK lysis buffer (100% lysis) and cells incubated with HBSS only (0% lysis).

[0288] Sera from NSG-Hc.sup.1 mice produced similar level lysis of EA cells as sera from BALB/cBy mice carrying wild-type Hc.sup.1 gene, FIG. 1B. However, <0.1% of EA cells lysis was observed when incubated with sera from NSG mice carrying the mutant Hc.sup.0 allele, FIG. 1B. This result validated that the congenic Hc.sup.1 allele in NSG-Hc.sup.1 mice transcribes a functional C5 protein.

Example 3

[0289] In vivo characterization of complement dependent cytotoxicity in NSG-Hc.sup.1 mice.

[0290] On day 0 age-matched female NSG and NSG-Hc.sup.1 mice were divided into five groups (5-7 mice in each group) and injected with 110.sup.5 viable Daudi Burkitt's lymphoma cells via the tail vein. Daudi cells were purchased from the ATCC (CCL-213). Daudi cells were thawed and cultured in RPMI-1640 Medium (GIBCO #21870) with 10% FBS, 2 mM L-Glutamine, 100 units/ml penicillin, and 100 ug/ml streptomycin (GIBCO #15140-122). Daudi cells were incubated at 37 C. in a humidified atmosphere containing 5% CO2. RPMI growth medium was changed and cultures were split at a ratio of 1:10 every two to three days. Daudi cell viability was determined by Trypan blue exclusion. Rituximab (Cat #680563) was purchased from Biogen Idec. Mice that were not injected with tumor cells or with rituximab were used as additional controls. At 10 days post-engraftment, cohorts of mice were injected intraperitoneally (IP) with either with rituximab (25 g/g) in 200 uL of PBS or with 200 uL of PBS only. Tumor engrafted mice were monitored three times per week and euthanized by CO2 asphyxiation followed by thoracic puncture, when they exhibited hind leg paralysis or showed >20% weight loss. Tumor burden and tumor invasiveness in mice were evaluated via flow cytometry, histology, and immunohistochemistry. Statistical differences in survival between the treated and control groups were analyzed by Kaplan-Meier plots provided using Prism statistical software. Statistical analysis was performed using the Log-Rank test and differences were considered significant at the P-value of <0.05.

[0291] Body Weight and Hind Limb Paralysis

[0292] At 38 days post-injection of Daudi cells, a significant weight loss and hind limb paralysis was observed in the PBS treated mice when compared to rituximab treated mice, FIG. 2A. All mice in the PBS treated cohorts had either >20% weight loss or showed hind limb paralysis and were euthanized by 42 days post-engraftment. Rituximab treatment resulted in a significant complement-independent delayed loss of body weight and hind limb paralysis, when compared to PBS treated mice cohorts, (p<0.05), FIG. 2A. On the other hand, no loss of body weight was observed in rituximab treated NSG-Hc.sup.1 mice throughout the study period, i.e. 52 days post-engraftment, suggesting that functional complement system in NSG-Hc.sup.1 mice when treated with Rituximab mice significantly hindered weight loss and hind limb paralysis by mediating effective CDC activity against human tumor cells FIG. 2A.

[0293] Survival

[0294] At 38 days post-injection of Daudi cells, no significant difference in overall survival was observed between PBS treated NSG mice (median survival=36 days) and PBS treated NSG-Hc.sup.1 mice (median survival=38 days), FIG. 2B. Rituximab treatment resulted in a significant complement-independent increase in the overall survival in NSG mice (median survival=46 days), when compared to PBS treated mice cohorts, (p<0.05), FIG. 2B. On the other hand, there was 100 percent survival observed in rituximab treated NSG-Hc.sup.1 mice throughout the study period, i.e. 52 days post-engraftment, suggesting that functional complement system in NSG-Hc.sup.1 mice when treated with rituximab mice significantly improved mouse survival by mediating effective CDC activity against human tumor cells, FIG. 2B.

[0295] Distant Metastasis

[0296] For flow cytometry analysis, peripheral blood was collected from mice by puncture of the retro-orbital venous plexus directly into flow tubes containing FACS buffer (PBS containing 2% FBS and 0.01% NaN.sub.3). Mice were then euthanized by CO2 asphyxiation or cervical dislocation. Bone marrow was collected by flushing from femur. Spleen cells were collected following mechanical disaggregation. Single-cell suspensions prepared from blood, spleen and bone marrow were subjected to RBC lysis using ACK lysis buffer and washed twice before blocking in rabbit immunoglobulin commercially purchased form Sigma-Aldrich. Blocked RBC depleted cells were stained using fluorescently conjugated antibodies to anti-human CD45 antibody from BD Biosciences (clone HI30), anti-mouse CD45 antibody (clone A20) and anti-human CD20 antibody (clone 2H7) from BioLegend. All phenotyping analyses were carried out by flow cytometry using FACSCalibur (Becton Dickinson) and data were processed by FlowJo software.

[0297] Flow cytometry analysis of circulating human CD45.sup.+ Daudi cells in peripheral blood and bone marrow at 38 days post-engraftment also confirmed the CDC mediated antitumor active in NSG-Hc.sup.1 mice as we observed significantly lower numbers of human CD45.sup.+ Daudi cells in peripheral blood and bone marrow of the rituximab treated NSG-Hc.sup.1 mice when compared to rituximab treated NSG mice, (p<0.05), FIG. 3A and FIG. 3B.

[0298] For histology analysis, mice were euthanized by CO2 asphyxiation followed by either cervical dislocation or thoracic puncture. Complete necropsy of the animals was performed and tissues were fixed in 10% neutral buffered formalin (NBF) solution, embedded in paraffin and sectioned at 3-5 m. Slides were stained with either Mayer's hematoxylin and eosin (H&E) or anti-human CD45 antibody from Dako (clone 2B11+PD7/26). Qualitative detection of human CD45 antigen was done using DISCOVERY DAB Map Detection Kit (RUO) from Ventana and photographs were taken with a photomicroscope (Olympus BX41)

[0299] Moreover, as expected histological analysis of various organs, including ovary, kidney, liver, spleen, lungs, lymph nodes etc., of mice at 38 days post-engraftment demonstrated reduced numbers of Daudi cells in tissues from rituximab treated NSG-Hc.sup.1 mice compared to other groups of mice, FIG. 4A and FIG. 4B.

SEQUENCES

[0300] Mus musculus C5 complement component structural protein amino acid sequence (SEQ ID NO:1):

TABLE-US-00002 MGLWGILCLLIFLDKTWGQEQTYVISAPKILRVGSSENVVIQVHGYTEAF DATLSLKSYPDKKVTFSSGYVNLSPENKFQNAALLTLQPNQVPREESPVS HVYLEVVSKHFSKSKKIPITYNNGILFIHTDKPVYTPDQSVKIRVYSLGD DLKPAKRETVLTFIDPEGSEVDIVEENDYTGIISFPDFKIPSNPKYGVWT IKANYKKDFTTTGTAYFEIKEYVLPRFSVSIELERTFIGYKNFKNFEITV KARYFYNKVVPDAEVYAFFGLREDIKDEEKQMMHKATQAAKLVDGVAQIS FDSETAVKELSYNSLEDLNNKYLYIAVTVTESSGGFSEEAEIPGVKYVLS PYTLNLVATPLFVKPGIPFSIKAQVKDSLEQAVGGVPVTLMAQTVDVNQE TSDLETKRSITHDTDGVAVFVLNLPSNVTVLKFEIRTDDPELPEENQASK EYEAVAYSSLSQSYIYIAWTENYKPMLVGEYLNIMVTPKSPYIDKITHYN YLILSKGKIVQYGTREKLFSSTYQNINIPVTQNMVPSARLLVYYIVTGEQ TAELVADAVWINIEEKCGNQLQVHLSPDEYVYSPGQTVSLDMVTEADSWV ALSAVDRAVYKVQGNAKRAMQRVFQALDEKSDLGCGAGGGHDNADVFHLA GLTFLTNANADDSHYRDDSCKEILRSKRNLHLLRQKIEEQAAKYKHSVPK KCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKP VQLGRIHIKTLLPVMKADIRSYFPESWLWEIHRVPKRKQLQVTLPDSLTT WEIQGIGISDNGICVADTLKAKVFKEVFLEMNIPYSVVRGEQIQLKGTVY NYMTSGTKFCVKMSAVEGICTSGSSAASLHTSRPSRCVFQRIEGSSSHLV TFTLLPLEIGLHSINFSLETSFGKDILVKTLRVVPEGVKRESYAGVILDP KGIRGIVNRRKEFPYRIPLDLVPKTKVERILSVKGLLVGEFLSTVLSKEG INILTHLPKGSAEAELMSIAPVFYVFHYLEAGNHWNIFYPDTLSKRQSLE KKIKQGVVSVMSYRNADYSYSMWKGASASTWLTAFALRVLGQVAKYVKQD ENSICNSLLWLVEKCQLENGSFKENSQYLPIKLQGTLPAEAQEKTLYLTA FSVIGIRKAVDICPTMKIHTALDKADSFLLENTLPSKSTFTLAIVAYALS LGDRTHPRFRLIVSALRKEAFVKGDPPIYRYWRDTLKRPDSSVPSSGTAG MVETTAYALLASLKLKDMNYANPIIKWLSEEQRYGGGFYSTQDTINAIEG LTEYSLLLKQIHLDMDINVAYKHEGDFHKYKVTEKHFLGRPVEVSLNDDL VVSTGYSSGLATVYVKTVVHKISVSEEFCSFYLKIDTQDIEASSHFRLSD SGFKRIIACASYKPSKEESTSGSSHAVMDISLPTGIGANEEDLRALVEGV DQLLTDYQIKDGHVILQLNSIPSRDFLCVRFRIFELFQVGFLNPATFTVY EYHRPDKQCTMIYSISDTRLQKVCEGAACTCVEADCAQLQAEVDLAISAD SRKEKACKPETAYAYKVRITSATEENVFVKYTATLLVTYKTGEAADENSE VTFIKKMSCTNANLVKGKQYLIMGKEVLQIKHNFSFKYIYPLDSSTWIEY WPTDTTCPSCQAFVENLNNFAEDLFLNSCE

Example 3

[0301] Complement Assay

[0302] Reagents [0303] Sheep RBCs from Grainger, cat #10H72, 20 mLs [0304] Rabbit anti sheep RBC from Grainger, Cat #10K945, 2 mL, Reconstitute with 2 mLs H2O, aliquot and freeze at 80. [0305] Guinea Pig Complement from Grainger, Cat #10H654, 5 mLs. Reconstitute with 5 mLs distilled H.sub.2O, aliquot and freeze at 80. [0306] HBSS from Gibco, #14025

[0307] Overvieweach well will have a total of 200 Ls: 175 Ls of lysis control or diluted serum, and 25 Ls of antibody coated sheep RBCs.

[0308] Complement assay protocol: [0309] Wash Sheep RBCs (2.5 mL/plate, 25 Ls/well) in HBSS. [0310] Prepare EA (antibody sensitized sheep red blood cells) [0311] Add 1*10{circumflex over ()}9 RBC (1 mL) to eppendorf tube and mix with anti-SRBC antibody @ 1:10 dilution (scale up for the number of wells; 25 L/well) [0312] Incubate at 37 C for 30 min, then spin down 5 min @ 350g and resuspend in the original volume of HBSS Prepare samples [0313] Add 120 L serum to 405 L HBSS. After adding the SRBC, this will be a 1:5 dilution. This is enough serum for triplicate wells. [0314] Lysis controls: for 0% lysis use HBSS; for 100% lysis, use ACK buffer

[0315] Prepare plate [0316] 1. Will need three wells for each control, serum, and blank. [0317] 2. Controls: HBSS for 0%, ACK for 100%, Guinea Pig Complement diluted 1:10, HBSS alone for a plate blank. [0318] 3. Add 175 L of lysis controls or diluted serum to their respective wells of a V-bottom plate [0319] 4. Add 25 L EA suspension to every well except for the blanks. [0320] 5. Cover with a plate sealer for lid and incubate for 1 hr at 37 C with gentle tapping/shaking every 10 min or so [0321] 6. Centrifuge the plate for 5 min @ 1250g to pellet cells. [0322] 7. Transfer 100 L supernatant from each well to its corresponding well on a 96-well ELISA plate and read @ OD540.

[0323] Calculate results (expressed as % lysis)


Find relative absorbance (RA) as RA=(abs of sample)(abs of 0% lysis well)


Find % lysis as Percent RBC lysis=((RA of sample well)/(RA of 100% lysis well))*100

Serums from LDS 6564 diluted 1:5 in HBSS (120 Ls serum+405 Ls HBSS) and run in triplicate.

TABLE-US-00003 1 2 3 4 5 6 7 8 9 10 11 12 HBSS (0%) 10 NSG H.sub.2O (100%) 12 NSG ACK (100%) 14 NSG GPC 1:5 HBSS (blank) HBSS (blank) 31 NSG-Hc 1 Balb 32 NSG-Hc 2 Balb 33 NSG-Hc 3 Balb HBSS (blank)
Enough space to run 24 samples in triplicate, or 80 samples in duplicate

[0324] Additional information:

[0325] Strain Name:

[0326] NOD.CBALs-Hc.sup.1/LtJ

[0327] Common Name: NOD.Hc.sup.1

[0328] Appearance: albino, pink eyed

[0329] Related Genotype: A/A Tyrc/Tyrc

[0330] Description: This NOD/Lt congenic strain is carrying Chr 2 alleles derived from CBA/Ls including Hc.sup.1. Diabetes onset and incidence is the same as NOD/Lt.

[0331] Development: C5 hemolytic complement located on Chr. 2 was transferred from CBA/Ls to NOD/Lt for 10 generations replacing the defective Hc.sup.0 allele expressed in NOD/Lt. T1DR has homozygous NOD.CBALs-Hc.sup.1/Lt at generation N10F11.

[0332] Items

[0333] Item 1.

[0334] A genetically modified immunodeficient non-human animal, wherein the genome of the non-human animal comprises a repaired C5 complement component structural gene such that the genetically modified immunodeficient non-human animal expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0335] Item 2. The genetically modified immunodeficient non-human animal of item 1 wherein the animal has severe combined immunodeficiency.

[0336] Item 3. The genetically modified immunodeficient non-human animal of item 1 or 2, wherein the animal has an IL2 receptor gamma chain deficiency.

[0337] Item 4. The genetically modified immunodeficient non-human animal of any of items 1, 2 or 3, wherein the animal has a recombination activating gene 1 deficiency.

[0338] Item 5. The genetically modified immunodeficient non-human animal of any of items 1 to 4, wherein the animal has a recombination activating gene 2 deficiency.

[0339] Item 6. The genetically modified immunodeficient non-human animal of any of items 1 to 5, wherein the animal is a mouse.

[0340] Item 7. The genetically modified immunodeficient non-human animal of item 6, wherein the mouse is a NOD mouse comprising a scid mutation.

[0341] Item 8. The genetically modified immunodeficient non-human animal of item 7, wherein the NOD mouse is homozygous for the scid mutation.

[0342] Item 9. The genetically modified immunodeficient non-human animal of any of items 6, 7 or 8, wherein the mouse is a NOD mouse comprising a Rag1 mutation.

[0343] Item 10. The genetically modified immunodeficient non-human animal of any of items 6 to 9, wherein the NOD mouse is homozygous for the Rag1 mutation.

[0344] Item 11. The genetically modified immunodeficient non-human animal of any of items 6 to 10, wherein the mouse is a NOD mouse comprising a Rag1.sup.tm1Mom mutation.

[0345] Item 12. The genetically modified immunodeficient non-human animal of any of items 6 to 11, wherein NOD mouse is homozygous for the Rag1.sup.tm1Mom mutation.

[0346] Item 13. The genetically modified immunodeficient non-human animal of item 1, wherein the genetically modified immunodeficient non-human animal is an NSG-Hc.sup.1 mouse comprising a repaired C5 complement component structural gene such that the genetically modified NSG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0347] Item 14. The genetically modified immunodeficient non-human animal of item 1, wherein the genetically modified immunodeficient non-human animal is an NRG-Hc.sup.1 mouse comprising a repaired C5 complement component structural gene such that the genetically modified NRG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0348] Item 15. The genetically modified immunodeficient non-human animal of item 1, wherein the genetically modified immunodeficient non-human animal is a NOG-Hc.sup.1 mouse comprising a repaired C5 complement component structural gene such that the genetically modified NOG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system.

[0349] Item 16. The genetically modified immunodeficient non-human animal of any of items 1 to 15, further comprising xenograft tumor cells.

[0350] Item 17. The genetically modified immunodeficient non-human animal of any of items 1 to 16, further comprising human xenograft tumor cells.

[0351] Item 18. The genetically modified immunodeficient non-human animal of any of items 1 to 17, further comprising xenograft tumor cells of a cell line.

[0352] Item 19. A method for producing a non-human animal model system for assessment of an anti-cancer therapeutic or putative anti-cancer therapeutic, comprising: providing a non-human genetically modified immunodeficient animal comprising a repaired C5 complement component structural gene such that the non-human genetically modified immunodeficient animal expresses the C5 complement component structural gene and is characterized by an intact complement system; and administering xenograft tumor cells to the non-human genetically modified immunodeficient animal.

[0353] Item 20. The method of item 19, wherein the non-human genetically modified immunodeficient animal has severe combined immunodeficiency.

[0354] Item 21. The method of item 19 or 20, wherein the non-human genetically modified immunodeficient animal has an IL2 receptor gamma chain deficiency.

[0355] Item 22. The method of any of items 19, 20 or 21, wherein the non-human genetically modified immunodeficient animal has a recombination activating gene 1 deficiency.

[0356] Item 23. The method of any of items 19 to 22, wherein the non-human genetically modified immunodeficient animal has a recombination activating gene 2 deficiency.

[0357] Item 24. The method of any of items 19 to 23, wherein the non-human genetically modified immunodeficient animal is a mouse.

[0358] Item 25. The method of item 24, wherein the mouse is a NOD mouse comprising the scid mutation and having a severe combined immunodeficiency.

[0359] Item 26. The method of item 25, wherein the NOD mouse is homozygous for the scid mutation and has a severe combined immunodeficiency.

[0360] Item 27. The method of any of items 24, 25 or 26, wherein the mouse is a NOD mouse comprising a Rag1 mutation and having a RAG 1 deficiency.

[0361] Item 28. The method of any of items 24 to 27, wherein the NOD mouse is homozygous for the Rag1 mutation and has a RAG 1 deficiency.

[0362] Item 29. The method of any of items 24 to 28, wherein the mouse is a NOD mouse comprising a Rag1.sup.tm1Mom mutation and having a RAG 1 deficiency.

[0363] Item 30. The method of any of items 24 to 29, wherein the NOD mouse is homozygous for the Rag1.sup.tm1Mom mutation and has a RAG 1 deficiency.

[0364] Item 30. The method of any of items 24 to 26, wherein the mouse is a NSG-Hc.sup.1 mouse.

[0365] Item 31. The method of any of items 24 and 27 to 30, wherein the mouse is a NRG-Hc.sup.1 mouse.

[0366] Item 32. The method of item 24, wherein the mouse is a NOG-Hc.sup.1 mouse.

[0367] Item 33. The method of any of items 19 to 32, wherein the xenograft tumor cells are human xenograft tumor cells

[0368] Item 34. The method of any of items 19 to 33, wherein the xenograft tumor cells are xenograft tumor cells of a cell line.

[0369] Item 35. A method for assessing the effect of an anti-cancer therapeutic or putative anti-cancer therapeutic, comprising: providing a non-human genetically modified immunodeficient animal comprising a repaired C5 complement component structural gene such that the non-human genetically modified immunodeficient animal expresses the C5 complement component structural gene and is characterized by an intact complement system; administering xenograft tumor cells to the non-human genetically modified immunodeficient animal; administering an anti-cancer therapeutic or putative anti-cancer therapeutic to the animal; and assaying a response of the xenograft tumor cells to the anti-cancer therapeutic.

[0370] Item 36. The method of item 35 wherein the anti-cancer therapeutic or putative anti-cancer therapeutic is an antibody.

[0371] Item 37. The method of item 35 or 36, wherein the non-human genetically modified immunodeficient animal has severe combined immunodeficiency.

[0372] Item 38. The method of item 35, 36 or 37, wherein the non-human genetically modified immunodeficient animal has an IL2 receptor gamma chain deficiency.

[0373] Item 39. The method of any of items 35 to 38, wherein the non-human genetically modified immunodeficient animal has a recombination activating gene 1 deficiency.

[0374] Item 40. The method of any of items 35 to 39, wherein the non-human genetically modified immunodeficient animal has a recombination activating gene 2 deficiency.

[0375] Item 41. The method of any of items 35 to 40, wherein the non-human genetically modified immunodeficient animal is a mouse.

[0376] Item 42. The method of item 41, wherein the mouse is a NOD mouse comprising a scid mutation and having a severe combined immunodeficiency.

[0377] Item 43. The method of item 41 or 42, wherein the NOD mouse is homozygous for the scid mutation and has a severe combined immunodeficiency.

[0378] Item 44. The method of any of items 41, 42 or 43, wherein the mouse is a NOD mouse comprising a Rag1.sup.tm1Mom mutation and having a RAG 1 deficiency.

[0379] Item 45. The method of any of items 41 to 44, wherein NOD mouse is homozygous for the Rag1.sup.tm1Mom mutation and has a RAG 1 deficiency.

[0380] Item 46. The method of any of items 41, 42 or 43, wherein the mouse is an NSG-Hc.sup.1 mouse.

[0381] Item 47. The method of any of items 41, 44 or 45, wherein the mouse is a NRG-Hc.sup.1 mouse.

[0382] Item 48. The method of any of items 35 to 47, wherein the xenograft tumor cells are human xenograft tumor cells.

[0383] Item 49. The method of any of items 35 to 48, wherein the xenograft tumor cells are xenograft tumor cells of a cell line.

[0384] Item 50. A genetically modified NSG mouse, wherein the genome of the non-human animal comprises a repaired C5 complement component structural gene such that the genetically modified NSG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system substantially as described herein.

[0385] Item 51. A genetically modified NRG mouse, wherein the genome of the non-human animal comprises a repaired C5 complement component structural gene such that the genetically modified NRG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system substantially as described herein.

[0386] Item 52. A genetically modified NOG mouse, wherein the genome of the non-human animal comprises a repaired C5 complement component structural gene such that the genetically modified NOG mouse expresses the C5 complement component structural gene and is characterized by an intact complement system substantially as described herein.

[0387] Item 53. A method for producing a non-human animal model system for assessment of an anti-cancer therapeutic substantially as described herein.

[0388] Item 54. A method for assessing the effect of an anti-cancer therapeutic in a non-human animal model system substantially as described herein.

[0389] Any patents or publications mentioned in this specification are incorporated herein by reference to the same extent as if each individual publication is specifically and individually indicated to be incorporated by reference.

[0390] The non-human animals, compositions and methods of the present invention described herein are presently representative of preferred embodiments, exemplary, and not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art. Such changes and other uses can be made without departing from the scope of the invention as set forth in the claims.