METHODS AND KITS FOR ANALYSIS OF HMGB1 ISOFORMS
20200363416 ยท 2020-11-19
Inventors
Cpc classification
G01N33/6863
PHYSICS
G01N2440/10
PHYSICS
C07K16/24
CHEMISTRY; METALLURGY
G01N2800/40
PHYSICS
International classification
C07K16/24
CHEMISTRY; METALLURGY
Abstract
In accordance with some embodiments herein, methods of determining signatures of HMGB1 isoforms in a subject are provided. In some embodiments, antibodies that bind specifically to HMGB1 isoforms are provided. In some embodiments, immunoassay kits are provided.
Claims
1. A method of detecting an HMGB1 isoform signature in a sample of a subject, the method comprising: providing a sample of a subject; detecting, from the sample, a presence and/or a level of three or more HMGB1 isoforms selected from the group consisting of: (a) hyper-acetylated HMGB1; (b) disulfide HMGB1 (HMGB1C23-C45); (c) hypo-acetylated HMGB1; (d) fully reduced HMGB1; (e) hyper-acetylated disulfide HMGB1; (f) hyper-acetylated fully reduced HMGB1; (g) hypo-acetylated disulfide HMGB1; and (h) hypo-acetylated fully-reduced HMGB1; thereby detecting the HMGB1 isoform signature in the sample.
2. The method of claim 1, wherein the three or more isoforms comprise: i) hyper-acetylated HMGB1, disulfide HMGB1, and hypo-acetylated HMGB1; ii) hyper-acetylated HMGB1, disulfide HMGB1, and hyper-acetylated disulfide HMGB1; iii) hyper-acetylated HMGB1, hyper-acetylated fully reduced HMGB1, and hypo-acetylated fully reduced HMGB1; iv) hyper-acetylated HMGB1, hypo-acetylated disulfide HMGB1, and hypo-acetylated fully-reduced HMGB1; or v) hyper-acetylated HMGB1, hyper-acetylated disulfide HMGB1, and hypo-acetylated disulfide HMGB1.
3. The method of claim 1, wherein the three or more isoforms consist of: i) hyper-acetylated HMGB1, disulfide HMGB1, and hypo-acetylated HMGB1; ii) hyper-acetylated HMGB1, disulfide HMGB1, and hyper-acetylated disulfide HMGB1; iii) hyper-acetylated HMGB1, hyper-acetylated fully reduced HMGB1, and hypo-acetylated fully reduced HMGB1; iv) hyper-acetylated HMGB1, hypo-acetylated disulfide HMGB1, and hypo-acetylated fully-reduced HMGB1; or v) hyper-acetylated HMGB1, hyper-acetylated disulfide HMGB1, and hypo-acetylated disulfide HMGB1.
4. The method of claim 1, wherein the three or more isoforms comprise: i) hyper-acetylated HMGB1, disulfide HMGB1, hypo-acetylated HMGB1, and fully reduced HMGB1; ii) hyper-acetylated HMGB1, disulfide HMGB1, fully reduced HMGB1, and hypo-acetylated disulfide HMGB1; or iii) hyper-acetylated HMGB1, disulfide HMGB1, hyper-acetylated disulfide HMGB1, and hypo-acetylated disulfide HMGB1.
5. The method of claim 1, wherein the presence and/or the level of the three or more HMGB1 isoforms is detected with mass spectrometry.
6. The method of claim 5, wherein the mass spectrometry comprises mass spectrometry/mass spectrometry (MS/MS), triple quadrupole mass spectrometry, electrospray ionization liquid chromatography mass spectrometry (ESI-LC-MS), or matrix-assisted laser desorption/ionization (MALDI), or any combination thereof.
7. The method of claim 1, wherein the presence and/or the level of the three or more HMGB1 isoforms is detected with an immunoassay, wherein the immunoassay comprises contacting the sample with at least one antibody that binds specifically to any of the three or more HMGB1 isoforms
8. The method of claim 7, wherein the immunoassay comprises lateral flow assays, no-wash assays, sandwich immunoassays, competition immunoassays, ELISA, immunoblot assays, flow cytometry, immunohistochemistry, surface plasmon resonance, western blots, or immunoblots, or any combination thereof.
9. The method of claim 7, wherein the at least one antibody comprises: an antibody that binds specifically to an acetylated lysine in NLS1 or an acetylated lysine in NLS2 of hyper-acetylated HMGB1; an antibody that binds specifically to one of acetylated K30, acetylated K43, acetylated K90, or acetylated K141 of hyper-acetylated HMGB1; an antibody that binds specifically to a C23 and/C45 of disulfide HMGB1 when C23 and C45 of disulfide HMGB1 are joined by a disulfide bond; an antibody that binds specifically to at least one of reduced C23, reduced C45, or reduced C106 of fully reduced HMGB1; or any combination thereof.
10. The method of claim 7, wherein the at least one antibody that binds specifically to any one of the three or more HMGB1 isoforms further comprises a detectable moiety.
11. The method of claim 1, wherein the sample comprises a sputum, cerebrospinal fluid, blood, serum, plasma, tissue, fine needle biopsy, urine, peritoneal fluid, or pleural fluid sample.
12. A kit for an immunoassay comprising: three or more antibodies selected from the group consisting of: (a) an antibody that binds specifically to hyper-acetylated HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45); (c) an antibody that binds specifically to hypo-acetylated HMGB1; (d) an antibody that binds specifically to fully reduced HMGB1; (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1; (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1.
13. The kit of claim 12, wherein the antibody that binds specifically to hyper-acetylated HMGB1 binds specifically to an acetylated lysine in NLS1 or an acetylated lysine in NLS2 of HMGB1; the antibody that binds specifically to hyper-acetylated HMGB1 binds specifically to one of acetylated K30, acetylated K43, acetylated K90, or acetylated K141 of HMGB1; the antibody that binds specifically to disulfide HMGB1 binds specifically to a C23 and/C45 of HMGB1 when C23 and C45 of HMGB1 are joined by a disulfide bond; the antibody that binds specifically to fully reduced HMGB1 binds specifically to at least one of reduced C23, reduced C45, or reduced C106 of HMGB1.
14. The kit of claim 12, wherein the three or more antibodies are immobilized on a substrate.
15. The kit of claim 12, wherein the three or more antibodies comprise a detectable moiety.
16. The kit of claim 12, additionally comprising an antibody that specifically binds to total HMGB1.
17. The kit of claim 16, additionally comprising an antibody binds specifically to the three or more first antibodies.
18. A kit for mass spectrometry, comprising a standard consisting essentially of three or more isoforms of HMGB1, wherein the three or more isoforms of HMGB1 are selected from the group consisting of: (a) a 24.585 KDa isoform of HMGB1; (b) a 24.587 KDa isoform of HMGB1; (c) a 25.467 KDa isoform of HMGB1; and (d) a 25.469 KDa isoform of HMGB1.
19. The kit of claim 18, wherein the standard consists essentially of: i) the 24.585 KDa isoform of HMGB1, the 24.587 KDa isoform of HMGB1, and the 25.467 KDa isoform of HMGB1; ii) the 24.585 KDa isoform of HMGB1, the 24.587 KDa isoform of HMGB1, and the 25.469 KDa isoform of HMGB1; iii) the 24.585 KDa isoform of HMGB1, the 25.467 KDa isoform of HMGB1, and the 25.469 KDa isoform of HMGB1; iv) the 24.587 KDa isoform of HMGB1, the 25.467 KDa isoform of HMGB1, and the 25.469 KDa isoform of HMGB1; or v) the 24.585 KDa isoform of HMGB1, the 24.587 KDa isoform of HMGB1, the 25.467 KDa isoform of HMGB1, and the 25.469 KDa isoform of HMGB1.
20. The kit of claim 18, further comprising an antibody that binds specifically to HMGB1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
DETAILED DESCRIPTION
[0077] Different isoforms of HMGB1, including hyper-acetylated HMGB1, disulfide HMGB1 (HMGB1C23-C45), hypo-acetylated HMGB1, fully reduced HMGB1, hyper-acetylated disulfide HMGB1, hyper-acetylated fully reduced HMGB1, hypo-acetylated disulfide HMGB1, and hypo-acetylated fully-reduced HMGB1, or signatures based on the presence or levels of some of these isoforms can identify a subject as having asbestos exposure, malignant mesothelioma or an inflammatory cancer. Furthermore, total HMGB1 can be used to differentiate asbestos-exposed individuals from non-exposed people. Moreover, specific HMGB1 isoforms can be used to differentiate malignant mesothelioma (MM) patients from asbestos-exposed individuals. Provided in accordance with some embodiments herein are antibodies that can bind to and detect particular isoforms of HMGB1. Also provided in accordance with some embodiments herein are mass spectrometry methods for identifying HMGB1 isoforms. Such antibodies, kits, and mass spectrometry methods can be useful for identifying HMGB1 isoform signatures characteristic of asbestos exposure, malignant mesothelioma or an inflammatory cancer in a subject. It is contemplated that detection of a level of antibody bound to a HMGB1 isoform or isoform in a sample can also be used to determine a level of HMGB1 isoform(s) in a sample. As such, it will be understood that when detection of a level of antibody bound to an HMGB1 isoform or isoforms is described herein, the skilled artisan can also determine a level of the HMGB1 isoform or isoforms in the sample, for example by comparing the levels to a suitable control or standard, such as a reference sample having a known level of the HMGB1 isoform(s), or a set of electronically stored or written values.
[0078] Early MM detection is associated with better responses to therapy and prolonged survival. The long latency period of 20-60 years between exposure to carcinogenic fibers and MM development provides physicians with a potential window for early detection and intervention. It is contemplated that detection of HMGB1 isoforms in accordance with some embodiments herein, and detection of HMGB1 isoform signatures in accordance with some embodiments herein can be useful in early detection of malignant mesothelioma, as well as inflammatory cancers such as colorectal cancer, pancreatic cancer, breast cancer, liver cancer, and the like.
[0079] Without being limited by any theory, it is contemplated herein that HMGB1 can be involved in asbestos-induced MM initiation and progression, and that serum HMGB1 levels are increased both in asbestos-exposed individuals and in patients with MM compared to healthy controls (see US Pub. No. 2014/0170685, hereby incorporated by reference in its entirety).
[0080] As used herein, subject includes organisms which are capable of suffering from asbestos exposure, mesothelioma, or an inflammatory cancer, such as human and non-human animals. Optionally, the subject comprises a human. The term non-human animals includes all vertebrates, for example, mammals, e.g., rodents (e.g., mice, rats, Guinea Pigs, etc.), rabbits, canines, ruminants (e.g., sheep, cows, etc.), non-human primates, and non-mammals, such as chickens, amphibians, reptiles, etc. In the case of the non-human animals, the subject can be a laboratory animal, including an engineered animal, for example a mouse engineered to have a cancer tissue.
HMGB1 and HMGB1 Isoforms
[0081] HMGB1 is a damage-associated molecular pattern (DAMP) molecule and a mediator of chronic inflammation (Bianchi M E (2007) DAMPs, PAMPs and alarmins: all we need to know about danger. J Leukoc Biol 81: 1-5; 13-15; which is incorporated herein by reference in its entirety). HMGB1 is actively secreted by macrophages and dendritic cells (DCs) and passively released by cells undergoing necrosis. HMGB1 is a nuclear protein, but can be detected in the cytoplasm of cells undergoing necrosis and in cells that actively secrete HMGB1, such as macrophages. HMGB1 binds to the Receptor for Advanced Glycation Endproducts (RAGE) and to the Toll-like Receptors (TLRs) 2 and 4, responsible for inflammatory responses. The activation of RAGE by HMGB1 induces tumor cell proliferation, migration, and invasion. HMGB1 induces migration in certain cell types. Wild-type human HMGB1 has the amino acid sequence:
TABLE-US-00001 (SEQIDNO:1) MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE EDEEDEDEEEDDDDE.
[0082] Without being limited by any theory, it is contemplated that when asbestos is deposited in the pleura, mesothelial cells and reactive macrophages attempt to phagocyte these fibers and as they cannot digest these fibers they undergo programmed cell necrosis and release HMGB1. HMGB1 attracts more mesothelial cells and macrophages and propagates this process that continues over time as asbestos fibers lodge in the tissues. Mesothelioma cells that grow out of a HMGB1 rich environment are often addicted to HMGB1, and accordingly actively secrete and require HMGB1 to sustain their own growth (Carbone and Yang, Molecular pathways: targeting mechanisms of asbestos and erionite carcinogenesis in mesothelioma Clinical Cancer Res 2012, 18: 598-604.).
[0083] A number of different HMGB1 isoforms have been observed, and can be detected in accordance with some embodiments herein. By way of example, HMGB1 can be hyper-acetylated at one or more lysine residues in its two nuclear localization signals NLS1 and NLS2, for example K30, K43, K90, and or K141. As used herein, hyper-acetylated HMGB1 refers to isoforms of HMGB1 with acetylation at two or more positions. HMGB1 can also undergo redox-sensitive modifications of its three cysteines. As used herein, hypo-acetylated HMGB1 is synonymous with non-acetylated HMGB1, these two terms may be used interchangeably. As such, for hypo-acetylated HMGB1 (a.k.a. non-acetylated HMGB1), there is no acetylation of any of the lysine residues in NLS1, and no acetylation of any of the lysine residues of NLS2. An unreduced form of HMGB1 comprises a disulfide bond between C23 and C45 (this form is also referred to herein as HMGB1 C23-C45). On the other hand, this disulfide bond is absent in fully reduced HMGB1 isoforms. Disulfide HMGB1 have been observed to have cytokine activity, while fully reduced HMGB1 has been observed to have chemotactic activity. Accordingly, fully reduced HMGB1 has been referred to as chemokine HMGB1. An additional HMGB1 isoform, HMGB1 with all cysteine residues terminally oxidized to sulphonates (sulphonyl HMGB1) appears to be immunologically inert. Different HMGB1 isoforms in accordance with embodiments herein have also been observed to have characteristic molecular masses. For example, disulfide hypo-acetylated HMGB1 has been observed to have a mass of 24,585.1 Da; fully reduced hypo-acetylated HMGB1 has been observed to have a mass of 24,587.2 Da; disulfide hyper-acetylated HMGB1 has been observed to have a mass of 25,467.1 Da; and fully reduced hyper-acetylated HMGB1 has been observed to have a mass of 25,469.3 (see, e.g.
[0084] It has been observed that different HMGB1 isoforms are present in different stages of asbestos-induced MM pathogenesis. Additionally, primary human mesothelial cells (HM) release negligible amounts of HMGB1, and the total and isoform-specific HMGB1 can be analyzed in concentrated supernatants of cell cultures mimicking different stages of MM pathogenesis (see
[0085] It has been observed herein that hyper-acetylated isoforms of HMGB1 have a greater molecular mass than corresponding hypo-acetylated isoforms (see
Antibodies
[0086] As used herein, antibody refers to a capture agent that comprises at least an epitope binding domain of an antibody. These terms are well understood by those skilled in the art, and refer to a protein comprising one or more polypeptides that specifically binds an antigen. The basic structural unit of a full-length antibody is known, and includes a tetramer and consists of two identical pairs of antibody chains, each pair having one light and one heavy chain. In each pair, the light and heavy chain variable regions are together responsible for binding to an antigen, and the constant regions are responsible for the antibody effector functions. Antibodies useful in accordance with some embodiments herein also encompass immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site, these fragments may or may not be fused to another immunoglobulin domain including but not limited to, an Fc region or fragment thereof. As outlined herein, the terms antibody and antibodies include full length antibodies and Fc variants thereof comprising Fc regions, or fragments thereof, comprising at least one novel amino acid residue described herein fused to an immunologically active fragment of an immunoglobulin or to other proteins as described herein. Such variant Fc fusions include but are not limited to, scFv-Fc fusions, variable region (e.g., VL and VH)-Fc fusions, scFv-scFv-Fc fusions. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass.
[0087] As used herein specifically, specifically bind, preferentially, and preferentially bind, including variations of these root terms denote that the antibody has a dissociation constant (K.sub.D=k.sub.off/k.sub.on) of less than or equal to 10.sup.5 M. As such, in some embodiments, the antibody has a dissociation constant (K.sub.D) for the indicated epitope of less than or equal to 10.sup.5 M, for example less than or equal to 10.sup.6 M, less than or equal to 10.sup.7 M, less than or equal to 10.sup.8 M, less than or equal to 10.sup.9 M, or less than or equal to less than or equal to 10.sup.10 M, including ranges better any two of the listed values. As used herein, an antibody that binds specifically to a particular isoform of HMGB1, or an epitope characteristic of a particular isoform of HMGB1 is understood to not bind to different isoforms of HMGB1 (or epitopes characteristic of those other isoforms). For example, an antibody that binds specifically to hyper-acetylated HMGB1 is understood not to bind specifically to hypo-acetylated HMGB1. For example, an antibody that binds specifically to hypo-acetylated HMGB1 is understood not to bind specifically to hyper-acetylated HMGB1. For example, an antibody that binds specifically to disulfide HMGB1 is understood not to bind specifically to fully reduced HMGB1. For example, an antibody that binds specifically to fully reduced HMGB1 is understood not to bind specifically to disulfide HMGB1.
[0088] Antibodies useful in accordance with methods and kits in accordance with some embodiments herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, intrabodies, multispecific antibodies (including bi-specific antibodies), human antibodies, humanized antibodies, chimeric antibodies, synthetic antibodies, single-chain Fvs (scFv), Fab fragments, Fab fragments, disulfide-linked Fvs (sdFv) (including bi-specific sdFvs), and anti-idiotypic (anti-Id) antibodies, and epitope-binding fragments of any of the above. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.
[0089] Antibodies useful in accordance with some embodiments herein include monospecific antibodies, bispecific antibodies, trispecific antibodies or antibodies of greater multispecificity. Multispecific antibodies can be specific for different epitopes of a polypeptide or may be specific for both a polypeptide as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material. See, e.g., PCT Publication Nos. WO 93/17715; WO 92/08802; WO91/00360; WO 92/05793; Tutt, et al., J. Immunol. 147:60-69 (1991); U.S. Pat. Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920; 5,601,819; and Kostelny et al., J. Immunol. 148:1547-1553 (1992); each of which is incorporated herein by reference in its entirety.
[0090] In some embodiments, the antibodies have half-lives (e.g., serum half-lives) in a mammal, (e.g., a human), of greater than 5 days, greater than 10 days, greater than 15 days, greater than 20 days, greater than 25 days, greater than 30 days, greater than 35 days, greater than 40 days, greater than 45 days, greater than 2 months, greater than 3 months, greater than 4 months, or greater than 5 months. The increased half-lives of the antibodies in a mammal, (e.g., a human), results in a higher serum titer of said antibodies or antibody fragments in the mammal, and thus, reduces the frequency of the administration of said antibodies or antibody fragments and/or reduces the concentration of said antibodies or antibody fragments to be administered. Antibodies having increased in vivo half-lives can be generated by techniques known to those of skill in the art. For example, antibodies with increased in vivo half-lives can be generated by modifying (e.g., substituting, deleting or adding) amino acid residues identified as involved in the interaction between the Fc domain and the FcRn receptor (see, e.g., International Publication Nos. WO 97/34631; WO 04/029207; U.S. Pat. No. 6,737,056 and U.S. Patent Publication No. 2003/0190311); each of which is incorporated herein by reference in its entirety.
[0091] In some embodiments, an antibody is a non-human antibody, for example mouse, rat, guinea pig, rabbit, donkey, goat, horse, pig, and the like. For some uses, for example in vivo use of antibodies in humans and in vitro methods and kits in accordance with some embodiments herein, it may be desirable to use chimeric, humanized, or human antibodies. A chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region. Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Gillies et al., (1989) J. Immunol. Methods 125:191-202; U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816,397; each of which is incorporated herein by reference in its entirety. Humanized antibodies are antibody molecules from non-human species antibody that bind the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and a framework region from a human immunoglobulin molecule. Often, framework residues in the human framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089; Riechmann et al., Nature 332:323 (1988); each of which is incorporated herein by reference in its entirety). Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089; each of which is incorporated herein by reference in its entirety), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 28(4/5):489-498 (1991); Studnicka et al., Protein Engineering 7(6):805-814 (1994); Roguska. et al., PNAS 91:969-973 (1994)), and chain shuffling (U.S. Pat. No. 5,565,332); each of which is incorporated herein by reference in its entirety.
[0092] In some embodiments, the antibody comprises a non-native antibody (i.e. an antibody from a host other than the subject from which a sample came). In some embodiments, the antibody is from a host of the same species as the subject. In some embodiments, the antibody is from a host of a different species than the subject.
[0093] Antibodies in accordance with kits and methods in accordance with some embodiments herein can bind specifically to an HMGB1 isoform of interest. Examples of isoforms that the antibody can specifically bind include hyper-acetylated HMGB1, hypo-acetylated HMGB1, disulfide HMGB1, fully-reduced HMGB1, hyper-acetylated disulfide HMGB1, hypo-acetylated disulfide HMGB1, hyper-acetylated fully-reduced HMGB1, or hypo-acetylated fully-reduced HMGB1. The antibody can bind specifically to one of the indicated isoforms, while not appreciably binding to the other isoforms. Additionally, antibodies that bind to HMGB1 in general, but do not necessarily bind to specific isoforms of HMGB1 can be useful in accordance with some embodiments, for example as capture antibodies (or detection antibodies if a capture antibody binds specifically to a particular isoform), controls, and the like.
[0094] Optionally, the antibody comprises a monoclonal antibody that recognizes an epitope characteristic of the HMGB1 isoform. Optionally, the antibody can bind specifically to the epitope characteristic of the HMGB1 isoform, while not appreciably binding to epitopes characteristic of other HMGB1 isoforms. Examples of epitopes characteristic of hyper-acetylated isoforms of HMGB1 that can be bound by the antibody include epitopes comprising acetylated K30, acetylated K43, acetylated K90, acetylated K141, or two or more of these, for example acetylated K30 and acetylated K43, acetylated K30 and acetylated K90, acetylated K30 and acetylated K141, acetylated K43 and acetylated K90, acetylated K43 and acetylated K141, acetylated K90 and acetylated K141, acetylated K30 and acetylated K43 and acetylated K90, acetylated K30 and acetylated K90 and acetylated K141, acetylated K30 and acetylated K43 and acetylated K141, acetylated K43 and acetylated K90 and acetylated K14, or acetylated K30 and acetylated K43 and acetylated K90 and acetylated K141. Examples of epitopes characteristic of the hypo-acetylated isoforms of HMGB1 can be bound by the antibody in accordance with embodiments herein include epitopes comprising include epitopes comprising hypo-acetylated K30 and hypo-acetylated K43, hypo-acetylated K30 and hypo-acetylated K90, hypo-acetylated K30 and hypo-acetylated K141, hypo-acetylated K43 and hypo-acetylated K90, hypo-acetylated K43 and hypo-acetylated K141, hypo-acetylated K90 and hypo-acetylated K141, hypo-acetylated K30 and hypo-acetylated K43 and hypo-acetylated K90, hypo-acetylated K30 and hypo-acetylated K90 and hypo-acetylated K141, hypo-acetylated K30 and hypo-acetylated K43 and hypo-acetylated K141, hypo-acetylated K43 and hypo-acetylated K90 and hypo-acetylated K14, or hypo-acetylated K30 and hypo-acetylated K43 and hypo-acetylated K90 and hypo-acetylated K141. Examples of epitopes characteristic of the disulfide isoforms of HMGB1 that can be bound by the antibody include epitopes comprising a disulfide bond between C23 and C45. Examples of epitopes characteristic of the fully reduced isoforms of HMGB1 that can be bound by the antibody include reduced C23, reduced C45, or reduced C106, or combinations of these, for example reduced C23 and reduced C45, reduced C23 and reduced C106, reduced C45 and reduced C106, or reduced C23 and reduced C45 and reduced C106.
[0095] In some embodiments, an antibody that binds specifically to a particular isoform of HMGB1 binds to an epitope characteristic of that isoform, for example a hyper-acetylated lysine, a hypo-acetylated lysine, a reduced cysteine, or a disulfide bond as described herein. The antibody can bind specifically to the indicated particular HMGB1 isoform, while not binding appreciably to other isoforms of HMGB1. Optionally, the antibody is a monoclonal antibody. Methods for making monoclonal antibodies are well known in the art. For example, monoclonal antibodies can be created through the recovery (cloning or identification) of the binding domain of an individual immunoglobulin from a larger polyclonal response. Antibodies can be raised in a variety of hosts, for example mouse, rat, guinea pig, rabbit, donkey, goat, horse, pig, and the like, by administering one or more regimens of antigen (for example, a particular HMGB1 isoform) to the host. For example, the predominant heavy chain variable region genes and predominant light chain variable region genes can be recovered from purified antibody-producing cells. These binding domains can be cloned by either immortalizing the cell (e.g., hybridoma fusion to a myeloma, or EBV immortalization), selection for binding from an in vitro display library (f-phage, phagemid, yeast, ribosome display, whole bacterial display, mammalian cell display), or direct cloning from individually sorted cells via RT-PCR amplification (limiting dilution, FACS sorting to wells).
[0096] Hybridoma techniques are well known in the art. A host animal is typically injected with the antigen, and, after a period of time, antibody-making cell can be isolated, usually from the spleen. The antibody-making cell can be fused with myeloma (or other immortalized cell) cells to provide fused cells, referred to as hybridomas. The hybridomas can be separated from unfused antibody-making cells and myeloma cells. Specific hybridomas can be isolated and tested to confirm that the isolated hybridoma produces antibody specific for the antigen used in the immunization step. The hybridoma so produced combines the ability of the parent antibody-making cell to produce a specific single antibody with the ability of its parent myeloma (or other immortalized) cell to continually grow and divide, either in vitro as a cell culture or in vivo as a tumor after injection into the peritoneal cavity of an animal. Hybridoma lines can be used, for example to produce monoclonal antibodies.
[0097] In some embodiments, monoclonal antibodies are created through the recovery (cloning or identification) of the binding domain of an individual immunoglobulin from a larger polyclonal response. For example, recovering the predominant heavy chain variable region genes and predominant light chain variable region genes from purified bulk antibody-producing cells. These binding domains can be cloned by either immortalizing the cell (e.g., Hybridoma fusion to a myeloma, or EBV immortalization), selection for binding from an in vitro display library (f-phage, phagemid, yeast, ribosome display, whole bacterial display, mammalian cell display), or direct cloning from individually sorted cells via RT-PCR amplification (limiting dilution, FACS sorting to wells).
Detectable Moieties
[0098] As used herein, detectable moiety refers to a molecule or complex, the presence or absence of which can be determined by the presence or absence of a signal characteristic of that molecule or complex. A variety of detectable moieties can be suitable in accordance with embodiments herein, for example fluorophores, nanoparticles, radiolabels, enzyme-substrate pairs, members of FRET pairs, and the like.
[0099] In some embodiments, the detectable moiety comprises a fluorophore. Exemplary suitable fluorophores include, but are not limited to: xanthene dyes, e.g., fluorescein and rhodamine dyes, such as fluorescein isothiocyanate (FITC), 2-[ethylamino)-3-(ethylimino)-2-7-dimethyl-3H-xanthen-9-yl]benzoic acid ethyl ester monohydrochloride (R6G)(emits a response radiation in the wavelength that ranges from about 500 to 560 nm), 1,1,3,3,3,3-Hexamethylindodicarbocyanine iodide (HIDC) (emits a response radiation in the wavelength that ranged from about 600 to 660 nm), 6-carboxyfluorescein (commonly known by the abbreviations FAM and F), 6-carboxy-2,4,7,4,7-hexachlorofluorescein (HEX), 6-carboxy-4,5-dichloro-2,7-dimethoxyfluorescein (JOE or J), N,N,N,N-tetramethyl-6-carboxyrhodamine (TAMRA or T), 6-carboxy-X-rhodamine (ROX or R), 5-carboxyrhodamine-6G (R6G5 or G5), 6-carboxyrhodamine-6G (R6G6 or G6), and rhodamine 110; cyanine dyes, e.g. Cy3, Cy5 and Cy7 dyes; coumarins, e.g., umbelliferone; benzimide dyes, e.g. Hoechst 33258; phenanthridine dyes, e.g. Texas Red; ethidium dyes; acridine dyes; carbazole dyes; phenoxazine dyes; porphyrin dyes; polymethine dyes, e.g. cyanine dyes such as Cy3 (emits a response radiation in the wavelength that ranges from about 540 to 580 nm), Cy5 (emits a response radiation in the wavelength that ranges from about 640 to 680 nm), etc.; BODIPY dyes and quinoline dyes. Specific fluorophores of interest include: Pyrene, Coumarin, Diethylaminocoumarin, FAM, Fluorescein Chlorotriazinyl, Fluorescein, R110, Eosin, JOE, R6G, HIDC, Tetramethylrhodamine, TAMRA, Lissamine, ROX, Napthofluorescein, Texas Red, Napthofluorescein, Cy3, and Cy5, and the like.
[0100] In some embodiments, the detectable moiety comprises a quencher. A quencher can absorb electromagnetic radiation and dissipate it as heat, thus remaining dark. Example quenchers that be used in accordance with some embodiments herein include Dabcyl, NFQ's, such as BHQ-1 or BHQ-2 (Biosearch), IOWA BLACK FQ (IDT), and IOWA BLACK RQ (IDT). In some embodiments, the quencher is selected to pair with a fluorophore so as to absorb electromagnetic radiation emitted by the fluorophore. Fluorophore/quencher pairs useful in the compositions and methods disclosed herein are well-known in the art, and can be found, e.g., described in S. Marras, Selection of Fluorophore and Quencher Pairs for Fluorescent Nucleic Acid Hybridization Probes available at the world wide web site molecular-beacons.org/download/marras,mmb06(335)3.pdf. As such, in some embodiments, the detectable moiety comprises a quencher (for example, the presence of the detectable moiety can be ascertained by quenching activity).
[0101] The association of two molecules can be detected by fluorescence resonance energy transfer (FRET). The characteristics of FRET can depend on the FRET pair selected. For example, association of the FRET pair within a FRET radius can permit excitation of a FRET acceptor by a FRET donor. For example, association of a FRET pair within a FRET radius can permit quenching of a fluorophore by a quencher. As such, in some embodiments, for example, in no-wash assays, the detectable moiety comprises a member of a FRET pair. For example, the no wash assay can comprise a first antibody that specifically binds to an HMGB1 isoform of interest, and a second antibody that can simultaneously bind to the HMGB1 isoform, and the first antibody can comprise a first member of a FRET pair while the second antibody can comprise the second member of the fret pair.
[0102] Enzyme-substrate pairs can be used to determine the presence or absence of a molecule in an assay. An enzyme and substrate pair can be selected so that, upon processing of the substrate by the enzyme, a signal can be detected, for example a color change or chemiluminescence. In some embodiments, the detectable moiety comprises an enzyme. The presence or absence of the detectable moiety can be determined by the addition of an appropriate substrate. In some embodiments, the detectable moiety comprises a substrate. The presence or absence of the detectable moiety can be determined by the addition of an appropriate enzyme. In some embodiments, the enzyme comprises alkaline phosphatase (AP) or horseradish peroxidase (HRP). In some embodiments, the substrate comprises a chromagen. Exemplary enzyme-chromagen pairs include AP and p-Nitrophenyl Phosphate, Disodium Salt (PNPP), HRP and any of 3,3,5,5-Tetramethylbenzidine (TMB), o-Phenylenediamine (OPD), or 2,2-Azinobis [3-ethylbenzothiazoline-6-sulfonic acid]-diammonium salt (ABTS), and the like. In some embodiments, the substrate comprises a substrate for chemiluminescence. HRP can catalyze the oxidation of luminol, or a variety of other chemiluminescence substrates (often referred to as ECL or enhanced chemiluminescence substrates), for example QuantaBlu Fluorogenic Peroxidase Substrate substrate (Thermo-Fisher Scientific), NOVEX ECL Chemiluminescent Substrate (Life Technologies), or Clarity Western ECL Substrate (BioRad), thus emitting light. As such, in some embodiments, the enzyme-chemiluminescent substrate pair is HRP and luminol or a derivative or luminol.
[0103] Raman scattering is a laser-based optical spectroscopy that generates a fingerprint-like vibrational spectrum with features that are much narrower than fluorescence. Raman scattering can be excited using monochromatic far-red or near-IR light, photon energies too low to excite the inherent background fluorescence in biological samples. In surface enhanced Raman spectroscopy (SERS), molecules in very close proximity to nanoscale roughness features on noble metal surfaces (e.g., gold, silver copper) give rise to million- to trillion-fold increases in scattering efficiency compared to normal Raman spectroscopy. In some embodiments, the detectable moiety comprises a SERS tag. A SERs tag can comprise any molecule that provides a Raman signal upon exposure to appropriate irradiation. A number of distinct reporter molecules with strong Raman spectra are known and can be used to create distinct flavors' of SERS-active particles to enable multiplexing capabilities (the term flavors indicates particles that provide distinct Raman signatures upon irradiation). Examples of molecules that provide strong Raman signals and are suitable for use in SERs tags include, but are not limited to, 4-mercaptopyridine (4-MP); trans-4,4 bis(pyridyl)ethylene (BPE); quinolinethiol; 4,4-dipyridyl, 1,4-phenyldiisocyanide; mercaptobenzamidazole; 4-cyanopyridine; 1,3,3,3,3-hexamethylindotricarbocymine iodide; 3,3-diethyltiatricarbocyanine; malachite green isothiocyanate; bis-(pyridyl)acetylenes; Bodipy; and isotopes of the foregoing, such as deuterated BPE, deuterated 4,4-dipyridyl, and deuterated bis-(pyridyl)acetylenes; as well as pyridine, pyridine-d5 (deuterated pyridine), and pyridine-.sup.15N. Various SERS-active particles, SERS-reporter probes and techniques to produce those SERS-active particles and SERS-reporter probes for detection of bioagents, such as nucleic acids, are described, for example, in U.S. Pat. Nos. 6,149,868, 6,514,767, 6,861,263, 7,723,100, and US Patent Publication Nos. 2003/0166297, 2003/0166297, 2007/0259437, 2009/0298197, 2009/0121193, and 2011/0275061, which are herein incorporated by references in their entireties.
[0104] In some embodiments, the detectable moiety comprises a nanoparticle. In some embodiments, the nanoparticle comprises at least one noble metal. In some embodiments, the nanoparticle comprises at least one of gold, silver, or copper. In some embodiments, the nanoparticle comprises a metal oxide. In some embodiments, the detectable moiety comprises a quantum dot. In some embodiments, the detectable moiety comprises a radiolabel. For example, the detectable moiety can comprise a gamma-radioactive isotopes of iodine, such as 125-I, attached to tyrosine. Exemplary radioactive substances that can be used as suitable radio labels include, but are not limited to .sup.18F, .sup.18F-FAC, .sup.32P, .sup.33P, .sup.45Ti, .sup.47Sc, .sup.52Fe, 59Fe, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.75Sc, .sup.77As, .sup.86Y, .sup.90Y, .sup.89Sr, .sup.89Zr, .sup.94Tc, .sup.94mTc, .sup.99Mo, .sup.105Pd, .sup.105Rb, .sup.111Ag, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.142Pr, .sup.143Pr, .sup.149Pm, .sup.153Sm, .sup.154-158Gd, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.169Er, .sup.175Lu, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.189Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.211Pb, .sup.212Bi, .sup.212Pb, .sup.213Bi, .sup.223Ra and .sup.225Ac.
[0105] In some embodiments, a detectable moiety is directly conjugated to an antibody. For example, the detectable moiety can be covalently linked to an antibody, for example via peptide linker or crosslinker. As such, in some embodiments, an antibody that binds specifically to an HMGB1 isoform of interest, in which the antibody comprises a detectable moiety is provided.
[0106] In some embodiments, a detectable moiety is associated with a secondary antibody that binds specifically to an antibody that binds specifically to an HMGB1 isoform of interest.
[0107] A secondary antibody can aid in the detection of target antigens by binding to a primary antibody that directly binds to the target molecule of interest, for example HMGB1, through a mechanism that is well known by those skilled in the art. Secondary antibodies increase sensitivity through the signal amplification that occurs as multiple secondary antibodies bind to a single primary antibody.
[0108] Secondary antibodies can be generated by immunizing a host animal with an antibody from a different species. Acceptable secondary antibodies in accordance with some embodiments herein include those with specificity against whole IgG (IgG, IgM, IgA, IgD, IgE), and against specific antibody fragments including but not limited to, heavy and light chains, Fragment crystallizable region, fragment antigen binding, F(ab2 (heavy and light chain regions forming the antigen-binding domains as well as the hinge region), IgM, Fc5 (5 connected Fe regions of 104 including the lower portion of the mu heavy chain), M (mu heavy chain), (gamma heavy chain), (kappa light chain), (lambda light chain), alpha heavy chain, and monovalent Fab fragments.
[0109] The presence or absence of an antibody comprising a detectable moiety can be detected directly. Accordingly, in some embodiments, an antibody that binds to an HMGB1 isoform of interest itself comprises a detectable moiety. The presence of an antibody that binds to an HMGB1 isoform of interest can also be detected indirectly. Accordingly, in some embodiments, the antibody does not comprise a detectable moiety, but the detectable moiety can later be directly or indirectly associated with the antibody. In some embodiments, a secondary antibody that binds specifically to the antibody that binds to an HMGB1 isoform of interest comprises the detectable moiety. In some embodiments, the antibody that binds to an HMGB1 isoform of interest is biotinylated, and the detectable moiety comprises avidin.
Samples
[0110] A number of samples can be used in accordance with embodiments herein. As used herein, a biological sample contemplates a sample obtained from an organism or from components (e.g., cells) of an organism, including cell cultures. The sample may be of any biological tissue or fluid, for example. Usually, the sample is a biological or a biochemical sample. Frequently the sample will be a clinical sample which is a sample derived from a patient. Such samples include, but are not limited to, sputum, cerebrospinal fluid, blood, blood fractions such as serum including fetal serum (e.g., SFC) and plasma, blood cells (e.g., white cells), tissue or fine needle biopsy samples, urine, peritoneal fluid, and pleural fluid, or cells there from. Biological samples may also include sections of tissues such as frozen sections taken for histological purposes. The sample can be, for example, also a physiological sample. In some embodiments, the biological sample comprises serum from a subject. Optionally, the subject can be known to have, or suspected of having mesothelioma, asbestos exposure, or an inflammatory cancer.
[0111] As used herein, a control sample or standard relates to a sample of which the expression level, amount and/or abundance of HMGB1 (or one or more particular isoforms of HMGB1) is known, or has been determined previously. As such, the control sample may be derived from a healthy person, i.e., a person diagnosed previously as not suffering or predisposed from the pathological condition(s) at issue (e.g. mesothelioma or inflammatory cancer). Alternatively, the control sample may be derived from a diseased person, i.e. a person diagnosed previously as suffering or predisposed from a disease other than mesothelioma or inflammatory cancer, or a person diagnosed as having mesothelioma or inflammatory cancer at a particular stage. A control sample or standard can be spiked with a known amount or level of molecules, for example a known amount or level of one or more of hyper-acetylated HMGB1, hypo-acetylated HMGB1, disulfide HMGB1, fully-reduced HMGB1, hyper-acetylated disulfide HMGB1, hypo-acetylated disulfide HMGB1, hyper-acetylated fully-reduced HMGB1, or hypo-acetylated fully-reduced HMGB1. In a further alternative, the control sample may be synthetic, i.e. not derived from a person, but comprising a known number of molecules. In some embodiments, a predetermined level is based upon a control or standard, for example a control known to be characteristic of a subject that has malignant mesothelioma or inflammatory cancer.
Immunological Assays
[0112] Immunological assays (also referred to herein as immunoassays), including radioimmunoassays and enzyme-linked immunoassays, are useful in the methods of several embodiments provided herein. Furthermore, a variety of monoclonal and polyclonal antibodies that bind to HMGB1 isoforms as described herein are useful in immunoassays. A variety of immunoassay formats, including competitive and non-competitive immunoassay formats, antigen capture assays and two antibody sandwich assays also are useful in accordance with the methods and kits of embodiments herein (for a summary of various immunoassays, see Self and Cook, Curr. Opin. Biotechnol. 7:60-65 (1996), which is hereby incorporated by reference in its entirety). Exemplary immunoassays that are suitable in accordance with some embodiments herein include immunoassays, lateral flow assays, no-wash assays, sandwich immunoassays, competition immunoassays, ELISA, immunoblot assays, flow cytometry, immunohistochemistry, surface plasmon resonance, western blots, immunoblots, and the like.
ELISA
[0113] Enzyme-linked immunosorbent assays (ELISAs) can be useful in accordance with some embodiments herein.
[0114] In some embodiments, ELISA comprises a sandwich ELISA. Sandwich ELISA is known to the skilled artisan. In a sandwich ELISA, a capture antibody that binds to the molecule of interest, for example HMGB1, is provided. The capture antibody can be immobilized on a substrate, for example a membrane, a bead, or a well of plate such a microtiter plate. A primary antibody that binds to the molecule of interest can be provided. The presence of bound primary antibody can be detected, for example directly (e.g. if the primary antibody comprises a detectable moiety) or indirectly (e.g. by contacting the assay environment with a secondary antibody comprising the detectable moiety).
[0115] It will be appreciated by the skilled artisan that at least one of the primary antibody or capture antibody binds specifically to a specific isoform of HMGB1 (e.g. hyper-acetylated HMGB1, hypo-acetylated HMGB1, disulfide HMGB1, fully-reduced HMGB1, hyper-acetylated disulfide HMGB1, hypo-acetylated disulfide HMGB1, hyper-acetylated fully-reduced HMGB1, or hypo-acetylated fully-reduced HMGB1).
[0116] Optionally, the capture antibody can comprise a monoclonal antibody that binds specifically to an epitope characteristic of the HMGB1 isoform of interest, and the primary antibody can comprise a polyclonal antibody that binds generally to HMGB1.
[0117] Optionally, the capture antibody can comprise a polyclonal antibody that binds generally to HMGB1, and the primary antibody can comprise a monoclonal antibody that binds specifically to an epitope characteristic of the HMGB1 isoform of interest
[0118] In some embodiments, ELISA comprises competitive ELISA. Known to those skilled in the art, competitive ELISA is a competitive binding process between any molecule of interest in a sample, for example HMGB1, and a competing molecule that competes for binding with the molecule of interest (for example the molecule of interest itself, or an analog thereof). In competitive ELISA, the unlabeled primary antibody is incubated with a sample that possibly comprises the molecule of interest, which is then added to a reaction environment comprising the competing molecule. Optionally, the competing molecule can be immobilized on a substrate, for example coated on the surface of a well in a multi-well plate such as a 96-well plate. Any unbound primary antibody is washed away, and a secondary antibody that is specific to the primary antibody and conjugated with a detectable moiety, for example an enzyme, is added. The detectable moiety can be detected, for example, if the detectable moiety comprises an enzyme, by adding an appropriate substrate for the enzyme so as to produce a chromogenic or fluorescent signal. The higher the concentration of the molecule of interest in the sample, for example an HMGB1 isoform of interest, the weaker the eventual signal from the detectable moiety. It will be appreciated that if the molecule of interest comprises a particular HMGB1 isoform (as in accordance with the methods and kits of various embodiments herein), the primary antibody can bind specifically to a that isoform of HMGB1, for example, hyper-acetylated HMGB1, hypo-acetylated HMGB1, disulfide HMGB1, fully-reduced HMGB1, hyper-acetylated disulfide HMGB1, hypo-acetylated disulfide HMGB1, hyper-acetylated fully-reduced HMGB1, or hypo-acetylated fully-reduced HMGB1.
Competition Immunoassays
[0119] In some embodiments, competition immunoassays (sometimes also referred to a competitive immunoassays and the like) are provided. Competition immunoassays can comprise providing a quantity of binding agent and a quantity of target molecules (e.g. biomarker) labeled with a detectable moiety. In the presence of unlabeled target molecule, for example the presence of biomarker in a sample, the unlabeled target molecule can compete with the labeled target molecule for binding to the binding agent. Accordingly, the greater the quantity unlabeled target molecule that is present in the sample, the greater the quantity of labeled target molecule that gets displaced. As such, a lower amount of label (detectable moiety) associated with the binding agent can indicate a higher amount of unlabeled target molecule in a sample. By way of example, competition immunoassays can be used for The Enzyme-Linked Immunosorbent Assay (ELISA), lateral flow systems, no-wash assays, and the like.
Lateral Flow Systems
[0120] In some embodiments, lateral flow systems are provided. The lateral flow system can comprise a single device of platform on which any of a plurality of different types of assay pellets can be used. The lateral flow system can comprise a substrate. The substrate can be configured for the capillary flow of an analyte over and/or through the substrate. The substrate can be configured to bind specifically to a binding partner that comprises at least one of a biomarker, binding agent, or complex comprising a biomarker and binding agent. Accordingly, when the substrate is contacted with a fluid, complexes of biomarker, binding agent, and detectable moiety, if present in the fluid, can be immobilized on the substrate, while unbound binding agent and/or detectable moiety are not immobilized.
[0121] In some embodiments, a single surface of the substrate is configured to bind to each of the binding agents of the assay pellets. The detectable moiety of each different assay pellet can be different.
[0122] In some embodiments, a lateral flow assay cartridge comprising a single assay pellet, and a substrate configured to bind specifically to the binding agent of the assay pellet or associated biomarker is provided. In some embodiments, a plurality of lateral flow assay cartridges is provided, each of which comprises an assay pellet for a different biomarker. In some embodiments, a reservoir configured for fluid communication with the substrates of two or more lateral flow cartridges is provided.
No-Wash Assays
[0123] In some embodiments, no-wash assays are provided. A no-wash assay can detect the presence or absence of a molecule of interest through the detection of a signal (or the absence of a signal) indicating the association of two different detectable moieties. In some embodiments, the two different detectable moieties are a FRET pair. In some embodiments, the FRET pair comprises a donor moiety and an acceptor moiety. In some embodiments, the two different detectable moieties are a fluorophore quencher pair. The no-wash system can include a first antigen binding molecule (for example an antibody) and a second antigen binding molecule, each of which bind to the same target at a different epitope. As such, in some embodiments, the first antigen binding molecule and the second antigen binding molecule can be bound to the same target at the same time. The signal (or absence of signal) produced by the association of the detectable moiety of the first antigen binding molecule and that of the second antigen binding molecule can indicate that both antigen binding molecules have bound to the target. By way of example, in accordance with some embodiments herein, a no-wash assay (or kit therefor) comprises a first antibody that binds to an HMGB1 isoform of interest, for example a monoclonal antibody that specifically binds to an epitope characteristic of the HMGB1 isoform of interest. The no-wash assay (or kit) can further comprise a second antibody that also binds to the HMGB1 isoform of interest, but does not compete for binding with the first antibody. As such, the second antibody can optionally bind to a second epitope characteristic of the HMGB1 isoform of interest (for example a second monoclonal antibody that binds to a different epitope than the first antibody), or can optionally bind generally to HMGB1 (for example a polyclonal antibody that binds to HMGB1).
[0124] In some embodiments, a no-wash assay includes a plurality of different detection assays in a single reaction environment. In some embodiments a first binding agentdetectable moiety pair each comprising a different member of a first FRET pair, and a second binding agentdetectable moiety pair each comprising a different member of a second FRET pair that is different from the first FRET pair are assessed in the same reaction environment. In some embodiments, at least two different FRET pairs, for example 2, 3, 4, 5, 6, 7, 8, 9, or 10, FRET pairs are assessed in the same reaction environment. As such, a multiplex no-wash assay can be performed.
[0125] In some embodiments, the reaction environment of a no-wash assay comprises a well in a multi-well format plate, a test tube, a cuvette, a flask, or the like. In some embodiments, the reaction environment of a no-wash system is configured for detection by an electromagnetic radiation detector. As such, in some embodiments, at least one surface of the reaction environment is penetrable to electromagnetic radiation. In some embodiments, the electromagnetic radiation has a wavelength in the visible spectrum. In some embodiments, the electromagnetic radiation has a wavelength in a fluorescent excitation and emission spectrum.
Mass Spectrometry
[0126] Mass spectrometry can be used in methods in accordance with some embodiments herein to detect isoforms of HMGB1.
[0127] Example isoforms of HMGB1 include a 24.585 KDa isoform of HMGB1 (e.g. hypo-acetylated disulfide HMGB1); a 24.587 KDa isoform of HMGB1 (e.g. hypo-acetylated fully reduced HMGB1); a 25.467 KDa isoform of HMGB1 (e.g. hyper-acetylated disulfide HMGB1); and a 25.469 KDa isoform of HMGB1 (e.g. hyper-acetylated fully reduced HMGB1). Mass spectrometry is a technique that helps measure the amount and type of chemicals present in a sample. It analyzes the mass-to-charge ratio and presence of gas-phase ions. Known to those skilled in the art, the mass spectrum can be used to determine the elements or isotopes in a sample, the masses of particles of molecules, and thus the structures of molecules can be determined. Mass spectrometry can be used in accordance with embodiments herein to determine the masses and structures of various isoforms of HMGB1.
[0128] In some embodiments, mass spectrometry/mass spectrometry (MS/MS) is used to determine the presence and/or levels of one or more isoform of HMGB1. In MS/MS a particular characteristic peak of a mass spec profile is further analyzed (e.g. sequenced). This is also known as Triple Quadrupole Mass Spectrometry.
[0129] In some embodiments, Electrospray Ionization Liquid Chromatography Mass Spectrometry (ESI-LC-MS) is used to determine the presence and/or levels of one or more isoform of HMGB1. ESI-LC-MS is well known to those skilled in the art. In ESI-LC-MS, molecular ions, as well as structural information of the molecules can be observed, and the solution-phase information can also be retained into the gas-phase if needed.
[0130] In some embodiments, Matrix-assisted Laser desorption/ionization (MALDI) is used to determine the presence and/or levels of one or more isoform of HMGB1. MALDI is a soft ionization technique used in mass spectrometry, and can allows the analysis of proteins and other biomolecules, which tend to be fragile and fragmented when ionized by more conventional ionization methods.
Method of Determining an HMGB1 Isoform Signature of a Subject
[0131] HMGB1 isoform signatures include the presence or level of one or more isoforms of HMGB1 (or presence or level of antibodies bound to one more isoforms of HMGB1) in a sample in the subject relative to a predetermined threshold. For example, the signal can include the presence or level of two or more, three or more, four or more, five or more, or six or more HMGB1 isoforms. The signature can provide information about a condition of the subject. For example, an HMGB1 isoform signature for a subject can comprise hypo-acetylated HMGB1 determined to be above or below a predetermined level. For example, an HMGB1 isoform signature for a subject can comprise hypo-acetylated HMGB1 determined to be above or below a first predetermined level and hyper-acetylated HMGB1 as determined to be present or absent, or above or below a second predetermined level. For example, an HMGB1 isoform signature can comprise disulfide HMGB1 determined to be present or absent, or above or below a predetermined level. For example, and HMGB1 isoform signature can comprise disulfide HMGB1 determined to be present or absent, or above or below a first predetermined level, and fully reduced HMGB1 determined to be above or below a second predetermined level. HMGB1 signatures in accordance with some embodiments herein can be determined by a variety of methods, for example by contacting a biological sample with one or more antibodies that bind specifically to particular HMGB1 isoforms as described herein, or by mass spectrometry. Optionally, the HMGB1 isoform signature comprises a binding pattern of one or more antibodies specific for HMGB1 isoforms, for example a spatial and/or temporal pattern of binding.
[0132] In some embodiments, the HMGB1 signature is compared to a suitable negative control, for example a healthy patient, and/or for example, from a patient with pleural effusions. As shown in Tables 3.1-3.12 and 4.1-4.4, smoking status was observed to vary with total HMGB1 levels. Accordingly, in some embodiments, for example, embodiments in which total HMGB1 is assessed, a suitable negative control comprises a sample of an individual with the same smoking status (e.g. smoker or non-smoker) as the subject being assessed. In some embodiments, for example embodiments in which total HMGB1 is assessed, there is a first predetermined level for non-smokers, and a second predetermined level for smokers. For example, the predetermined level of total HMGB1 for non-smokers can be at least about 9 ng/ml, for example, at least about 9 ng/ml, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 ng/ml. For example, the predetermined level of total HMGB1 for smokers can be at least about 19 ng/ml, for example, at least about 19 ng/ml, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 ng/ml.
[0133] In accordance with some embodiments, methods of determining an HMGB1 isoform signature of a subject are provided. Optionally, the subject is suspected of having mesothelioma or an inflammatory condition. The method can include contacting a biological sample of the subject with an antibody that binds to an HMGB1 isoform of interest, for example hyper-acetylated HMGB1, disulfide HMGB1 (HMGB1C23-C45), hypo-acetylated HMGB1, fully reduced HMGB1, hyper-acetylated disulfide HMGB1, hyper-acetylated fully reduced HMGB1, hypo-acetylated disulfide HMGB1, or hypo-acetylated fully-reduced HMGB1. The method can include detecting a level of the antibody bound to HMGB1 in the biological sample. Bound levels of antibody to the sample can identify a signature characteristic of a condition in the subject. Optionally, the method can include detecting a level of one or more HMGB1 isoforms in the biological sample. Levels of HMGB1 isoforms in the sample can identify a signature characteristic of a condition in the subject
[0134] Optionally, the signature is determined in accordance with the example signatures of Table 1. Example signatures are shown across rows, with optional parameters of the signature shown as -
TABLE-US-00002 TABLE 1 Example signatures Hyper- Hypo- Fully Associated acetylated acetylated Disulfide Reduced Total Condition HMGB1 HMGB1 HMGB1 HMGB1 HMGB1 Healthy Individual >4 ng/ml Healthy Individual Not detected Healthy Individual >4 ng/ml Not detected Asbestos-Exposed >3.00 or MM ng/ml Asbestos-Exposed >3.05 or MM ng/ml Asbestos-Exposed >4 ng/ml or MM Asbestos-Exposed >3.05 ng/ml and <15.75 ng/ml Asbestos-Exposed <10 ng/ml >4 ng/ml Asbestos-Exposed Not detected >4 ng/ml Asbestos-Exposed Not detected >lower detection limit Asbestos-Exposed <10 ng/ml >lower detection limit Asbestos-Exposed Not detected >lower detection limit Asbestos-Exposed >4 ng/ml Not detected Asbestos-Exposed present, but >4 ng/ml <2 ng/ml Asbestos-Exposed present, but >lower <2 ng/ml detection limit MM or >15.75 inflammatory ng/ml cancer MM or >2 ng/ml >15.75 inflammatory ng/ml cancer MM or >5-fold over >15.75 inflammatory lower ng/ml cancer detection MM or >10 ng/ml inflammatory cancer MM or >2 ng/ml inflammatory cancer MM or >5-fold over inflammatory lower cancer detection limit MM or >5-fold over >lower inflammatory lower detection cancer detection limit limit MM or >4 ng/ml >5-fold over inflammatory lower cancer detection limit MM or >10 ng/ml >5-fold over >lower inflammatory lower detection cancer detection limit limit MM or >10 ng/ml >4 ng/ml >5-fold over >lower inflammatory lower detection cancer detection limit limit MM or >10 ng/ml >4 ng/ml >lower inflammatory detection cancer limit MM or >2 ng/ml >5-fold over >lower inflammatory lower detection cancer detection limit limit MM or >2 ng/ml >4 ng/ml >5-fold over >lower inflammatory lower detection cancer detection limit limit MM or >2 ng/ml >4 ng/ml >lower inflammatory detection cancer limit MM or >4 ng/ml >5-fold over >lower inflammatory lower detection cancer detection limit limit MM or >10-fold inflammatory over cancer lower detection limit MM or >5-fold over >10-fold inflammatory lower over cancer detection lower limit detection limit MM or >4 ng/ml >10-fold inflammatory over cancer lower detection limit MM or >10 ng/ml >10-fold inflammatory over cancer lower detection limit MM or >4 ng/ml >5-fold over >10-fold inflammatory lower over cancer detection lower limit detection limit MM or >10 ng/ml >4 ng/ml >10-fold inflammatory over cancer lower detection limit MM or >10 ng/ml >5-fold over >10-fold inflammatory lower over cancer detection lower limit detection limit MM or Present inflammatory cancer MM or Present inflammatory cancer MM or Present Present inflammatory cancer MM (but not >11.35 benign or non-MM ng/ml pleural effusion) MM (but not >9.70 ng/ml benign or non-MM pleural effusion) MM (but not >9.70 ng/ml >11.35 benign or non-MM ng/ml pleural effusion)
[0135] For HMGB1 isoform signatures, the presence or level relative to a predetermined level of one or more isoforms of HMGB1 in a sample in a subject can be useful to indicate the condition of a subject. An HMGB1 isoform signature can include a presence, level, or level of antibody bound to one or more of (a) hyper-acetylated HMGB1, (b) disulfide HMGB1 (HMGB1C23-C45), (c) hypo-acetylated HMGB1, (d) fully reduced HMGB1, (e) hyper-acetylated disulfide HMGB1, (f) hyper-acetylated fully reduced HMGB1, (g) hypo-acetylated disulfide HMGB1, and (h) hypo-acetylated fully-reduced HMGB1. Optionally, an HMGB1 isoform signature can comprise two or more of (a)-(h), for example two, three, four, five six, seven, or eight of (a)-(h), for example (a) and (b), (a) and (c), (a) and (d), (a) and (e), (a) and (f), (a) and (g), (a) and (h), (b) and (c), (b) and (d), (b) and (e), (b) and (f), (b) and (g), (b) and (h), (c) and (d), (c) and (e), (c) and (f), (c) and (g), (c) and (h), (d) and (e), (d) and (f), (d) and (g), (d) and (h), (e) and (f), (e) and (g), or (e) and (h).
[0136] Optionally, the levels of any of (a)-(h) in an HMGB1 isoform signature are compared to a predetermined level, in which the level in the subject below the predetermined level indicates an HMGB1 isoform signature characteristic of a healthy subject. For example, levels of (c) hypo-acetylated HMGB1 below the predetermined level indicates an HMGB1 isoform signature characteristic of a healthy subject. For example, an absence of (d) fully reduced HMGB1, (f) hyper-acetylated fully reduced HMGB1, and (h) hypo-acetylated fully-reduced HMGB1 indicate an HMGB1 isoform signature characteristic of a healthy subject (Table 1). Optionally, an HMGB1 isoform signature can differentiate a malignant mesothelioma patient from a patient with pleural effusions, for example based on the levels of any one of (a)-(h).
[0137] Optionally, the levels of any of (a)-(h) in a subject are compared to a predetermined level, in which the level in the subject above the predetermined level indicates an HMGB1 isoform signature characteristic of a subject that has at least one of asbestos exposure, malignant mesothelioma or an inflammatory cancer. For example, the levels of (c) hypo-acetylated HMGB1 above a first predetermined level and binding of (a) hyper-acetylated HMGB1 above a second predetermined level can identify an HMGB1 isoform signature characteristic of a subject that has malignant mesothelioma or an inflammatory cancer. Optionally, the level of binding of (c) hypo-acetylated HMGB1 above a first predetermined level and binding of (a) hyper-acetylated below a second predetermined level identifies an HMGB1 isoform signature characteristic of a subject that has asbestos exposure, but not malignant mesothelioma. For example, the level of binding of (d) fully reduced HMGB1 above a first predetermined level and binding of (b) disulfide HMGB1 (HMGB1C23-C45) above a second predetermined level can identify an HMGB1 isoform characteristic of a subject that has malignant mesothelioma or an inflammatory cancer. Optionally, the level of binding of (d) fully reduced HMGB1 above a first predetermined level and binding of (b) disulfide HMGB1 (HMGB1C23-C45) below a second predetermined level identifies an HMGB1 isoform signature characteristic of a subject that has asbestos exposure, but not malignant mesothelioma. For example, the level of binding of (c) hypo-acetylated HMGB1 above a first predetermined level and binding of (a) hyper-acetylated HMGB1 above a second predetermined level can identify an HMGB1 isoform signature characteristic of a subject that has an inflammatory cancer. Furthermore, optionally the level of binding of (d) fully reduced HMGB1 above a first predetermined level and binding of (b) disulfide HMGB1 (HMGB1C23-C45) above a second predetermined level can identify an HMGB1 isoform signature characteristic of a subject that has an inflammatory cancer Inflammatory cancers that can be detected, detected, or diagnosed by the methods in accordance with these methods include, but are not limited to, mesothelioma, colorectal cancer, pancreatic cancer, breast cancer, liver cancer, and the like.
[0138] Optionally, the antibody that binds specifically to hyper-acetylated HMGB1 binds specifically to an acetylated lysine in NLS1 or an acetylated lysine in NLS2 of HMGB1. Optionally, the antibody that binds specifically hyper-acetylated HMGB1 binds specifically to acetylated K30, acetylated K43, acetylated K90, and/or acetylated K141 of HMGB1. Optionally, the antibody that binds specifically to reduced HMGB1 binds specifically to recued C23, reduced C45, and/or reduced C106 of HMGB1. Optionally, the antibody that binds specifically to disulfide HMGB1 binds specifically to an epitope comprising C23 bonded to C45 by a disulfide bond.
[0139] Optionally, the predetermined level of (a) hyper-acetylated HMGB1 is at least about 0.1 ng/ml (or an antibody bound to at least about 0.1 ng/ml of hyper-acetylated HMGB1), for example at least about 0.1 ng/ml, 0.3, 0.4, 0.5, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 34, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/mL of hyper-acetylated HMGB1. Optionally, the subject is identified as having MM or an inflammatory cancer if the level falls within a range any two of the listed values, for example, about 3-23 ng/ml of hyper-acetylated HMGB1, for example about, 3-21 ng/ml, 3-19 ng/ml, 3-17 ng/ml, 3-15 ng/ml, 3-13 ng/ml, 3-11 ng/ml, 3-9 ng/ml, 3-7 ng/ml, 3-5 ng/ml, 5-23 ng/ml, 7-23 ng/ml, 9-23 ng/ml, 11-23 ng/ml, 13-23 ng/ml, 15-23 ng/ml, 17-23 ng/ml, 19-23 ng/ml, 21-23 ng/ml, 5-21 ng/ml, 7-19 ng/ml, 5-13 ng/ml, 7-13 ng/ml, 9-13 ng/ml. Optionally, a presence or absence of hyper-acetylated HMGB1 is determined.
[0140] Optionally, the predetermined level of (b) disulfide HMGB1 is at least about 0.1 ng/ml (or an antibody bound to at least about 0.1 ng/ml of disulfide HMGB1), for example at least about 0.1 ng/ml, 0.2, 0.3, 0.4, 0.5, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 34, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/ml of disulfide HMGB1. Optionally, the predetermined level of (b) disulfide HMGB1 is at least about 5 ng/ml. Optionally, the subject is identified as having MM or an inflammatory cancer if the level falls within a range of any two of the listed values, for example, about 3-23 ng/ml of disulfide HMGB1, for example about, 3-21 ng/ml, 3-19 ng/ml, 3-17 ng/ml, 3-15 ng/ml, 3-13 ng/ml, 3-11 ng/ml, 3-9 ng/ml, 3-7 ng/ml, 3-5 ng/ml, 5-23 ng/ml, 7-23 ng/ml, 9-23 ng/ml, 11-23 ng/ml, 13-23 ng/ml, 15-23 ng/ml, 17-23 ng/ml, 19-23 ng/ml, 21-23 ng/ml, 5-21 ng/ml, 7-19 ng/ml, 5-13 ng/ml, 7-13 ng/ml, 9-13 ng/ml. Optionally, the predetermined level of (b) disulfide HMGB1 represents a fold increase (FI) over the lower limit of detection (LLD) for the antibody. In some embodiments, the predetermined level of (c) disulfide HMGB1 comprises a FI of at least about 0.5 FI over LLD, for example, about 0.5 FI over LLD, 0.7, 1, 1.5, 2, 2.5, 3, 3.5, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 5000, or 10,000 FI over LLD, including ranges between any two of the listed values. In some embodiments, an individual is identified as having MM or an inflammatory cancer when the level of antibody bound to disulfide HMGB1 is within about 3-41 Fl over LLD, 3-39 Fl over LLD, 3-37 Fl over LLD, 3-35 Fl over LLD, 3-33 Fl over LLD, 3-31 Fl over LLD, 3-29 Fl over LLD, 3-27 Fl over LLD, 3-25 Fl over LLD, 3-23 Fl over LLD, 5-21 Fl over LLD, 5-19 Fl over LLD, 7-17 Fl over LLD, 9-15 Fl over LLD, 11-13 Fl over LLD, 7-31 Fl over LLD, 9-29 Fl over LLD, 11-27 Fl over LLD, 7-33 Fl over LLD, 9-27 Fl over LLD, 9-25 Fl over LLD. Optionally, a presence or absence of disulfide HMGB1 is determined.
[0141] Optionally, the predetermined level of (c) hypo-acetylated HMGB1 is at least about 0.1 ng/ml (or an antibody bound to at least about 0.1 ng/ml of hypo-acetylated HMGB1), for example at least about 0.1 ng/ml, 0.3, 0.4, 0.5, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 34, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/ml of hypo-acetylated HMGB1. Optionally, the subject is identified as having MM or asbestos exposure or an inflammatory cancer if the level falls within a range any two of the listed values, for example, about 3-23 ng/ml of hypo-acetylated HMGB1, for example about, 3-21 ng/ml, 3-19 ng/ml, 3-17 ng/ml, 3-15 ng/ml, 3-13 ng/ml, 3-11 ng/ml, 3-9 ng/ml, 3-7 ng/ml, 3-5 ng/ml, 5-23 ng/ml, 7-23 ng/ml, 9-23 ng/ml, 11-23 ng/ml, 13-23 ng/ml, 15-23 ng/ml, 17-23 ng/ml, 19-23 ng/ml, 21-23 ng/ml, 5-21 ng/ml, 7-19 ng/ml, 5-13 ng/ml, 7-13 ng/ml, 9-13 ng/ml. In some embodiments, the subject is determined to not have MM or inflammatory cancer or asbestos exposure if the level of hypo-acetylated HMGB1 falls below the predetermined level.
[0142] Optionally, the predetermined level of (d) fully reduced HMGB1 is at least about 0.1 ng/ml (or an antibody bound to at least about 0.1 ng/ml of fully reduced HMGB1), for example at least about 0.1 ng/ml, 0.3, 0.4, 0.5, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 34, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/ml of fully reduced HMGB1. Optionally, the predetermined level of (d) fully reduced HMGB1 is at least about 7 ng/ml (Optionally, the subject is identified as having MM or an inflammatory cancer if the level falls within a range any two of the listed values, for example, about 3-23 ng/ml of disulfide HMGB1, for example about, 3-21 ng/ml, 3-19 ng/ml, 3-17 ng/ml, 3-15 ng/ml, 3-13 ng/ml, 3-11 ng/ml, 3-9 ng/ml, 3-7 ng/ml, 3-5 ng/ml, 5-23 ng/ml, 7-23 ng/ml, 9-23 ng/ml, 11-23 ng/ml, 13-23 ng/ml, 15-23 ng/ml, 17-23 ng/ml, 19-23 ng/ml, 21-23 ng/ml, 5-21 ng/ml, 7-19 ng/ml, 5-13 ng/ml, 7-13 ng/ml, 9-13 ng/ml. Optionally, the predetermined level of (d) fully reduced HMGB1 represents a fold increase (FI) over the lower limit of detection (LLD) for the antibody. In some embodiments, the predetermined level of (d) fully reduced HMGB1 comprises a FI of at least about 0.5 FI over LLD, for example, about 0.5 FI over LLD, 0.7, 1, 1.5, 2, 2.5, 3, 3.5, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 5000, or 10,000 FI over LLD, including ranges between any two of the listed values. In some embodiments, an individual is identified as having MM or an inflammatory cancer when the level of antibody bound to fully reduced HMGB1 is within about 3-41 Fl over LLD, 3-39 Fl over LLD, 3-37 Fl over LLD, 3-35 Fl over LLD, 3-33 Fl over LLD, 3-31 Fl over LLD, 3-29 Fl over LLD, 3-27 Fl over LLD, 3-25 Fl over LLD, 3-23 Fl over LLD, 5-21 Fl over LLD, 5-19 Fl over LLD, 7-17 Fl over LLD, 9-15 Fl over LLD, 11-13 Fl over LLD, 7-31 Fl over LLD, 9-29 Fl over LLD, 11-27 Fl over LLD, 7-33 Fl over LLD, 9-27 Fl over LLD, 9-25 Fl over LLD.
Methods of Diagnosing or Identifying Malignant Mesothelioma in a Subject
[0143] It is contemplated that levels and presence of some HMGB1 isoforms can be useful for identifying or diagnosing mesothelioma. In accordance with some embodiments herein, methods of diagnosing or identifying malignant mesothelioma in a subject are provided. The method can comprise providing a biological sample of the subject, contacting the biological sample with at least one antibody that binds to an HMGB1 isoform of interest. Optionally, the method comprises contacting the biological sample with one or more of: an antibody that binds specifically to hyper-acetylated HMGB1, an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45), an antibody that binds specifically to hypo-acetylated HMGB1, or an antibody that binds specifically to fully reduced HMGB1. The method can comprise detecting a level of the antibody bound to HMGB1 in the sample. The method can comprise comparing the level of bound antibody to a predetermined level. The method can comprise diagnosing the subject as having malignant mesothelioma when the level of antibody bound to HMGB1 is greater than the predetermined level. Optionally, the method can comprise detecting a level of HMGB1 in the sample. The method can comprise diagnosing the subject as having malignant mesothelioma when the level of HMGB1 isoform is greater than the predetermined level.
[0144] Optionally, the biological sample is contacted with two, three, or four of: of antibody that binds specifically to hyper-acetylated HMGB1, an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45), an antibody that binds specifically to hypo-acetylated HMGB1, or an antibody that binds specifically to fully reduced HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to hyper-acetylated HMGB1 and an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45). Optionally, the biological sample is contacted with an antibody that binds specifically to hyper-acetylated HMGB1 and an antibody that binds specifically to hypo-acetylated HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to hyper-acetylated HMGB1 and an antibody that binds specifically to fully reduced HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and an antibody that binds specifically to hypo-acetylated HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and an antibody that binds specifically to fully reduced HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to hypo-acetylated HMGB1 and an antibody that binds specifically to fully reduced HMGB1.
[0145] Optionally, the biological sample is contacted with an antibody that binds specifically to hyper-acetylated HMGB1, an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45), and an antibody that binds specifically to hypo-acetylated HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to hyper-acetylated HMGB1, an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45), and an antibody that binds specifically to fully reduced HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to hyper-acetylated HMGB1, and an antibody that binds specifically to hypo-acetylated HMGB1, an antibody that binds specifically to fully reduced HMGB1. Optionally, the biological sample is contacted with an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45), an antibody that binds specifically to hypo-acetylated HMGB1, and an antibody that binds specifically to fully reduced HMGB1.
[0146] Optionally, the subject is identified as having MM when the level of hyper-acetylated HMGB1 (or level of antibody bound to hyper-acetylated HMGB1) in the sample is greater than a level of hyper-acetylated HMGB1 (or the antibody bound to hyper-acetylated HMGB1) of about 0.1 ng/ml of hyper-acetylated HMGB1, for example greater than about 0.1, 0.2, 0.3, 0.4, 0.5, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/mL, including ranges between any two of the listed values. Optionally, the subject is identified as having MM if the level falls within a range any two of the listed values, for example, 3-23 ng/ml, 3-21 ng/ml, 3-19 ng/ml, 3-17 ng/ml, 3-15 ng/ml, 3-13 ng/ml, 3-11 ng/ml, 3-9 ng/ml, 3-7 ng/ml, 3-5 ng/ml, 5-23 ng/ml, 7-23 ng/ml, 9-23 ng/ml, 11-23 ng/ml, 13-23 ng/ml, 15-23 ng/ml, 17-23 ng/ml, 19-23 ng/ml, 21-23 ng/ml, 5-21 ng/ml, 7-19 ng/ml, 5-13 ng/ml, 7-13 ng/ml, 9-13 ng/ml. In some embodiments, a presence or absence of hyper-acetylated HMGB1 can be determined. Accordingly, the predetermined level can optionally be 0. In some embodiments, the predetermined level can be a level that is at least 10% above the level of a control subject, for example, a healthy individual, or an asbestos-exposed individual. In some aspects the predetermined level can be a level that is at least 5% up to about 100% or up to about 200% or more, greater than the level of the comparison subject, or any value or subrange therebetween.
[0147] Optionally, the subject is identified as having MM when the level of disulfide HMGB1 (or level of antibody bound to disulfide HMGB1) in the sample is greater than a level of disulfide HMGB1 (or level of antibody bound to disulfide HMGB1) of about 0.1 ng/ml of disulfide HMGB1, for example greater than about 0.1, 0.2, 0.3, 0.4, 0.5, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/mL disulfide HMGB1, including ranges between any two of the listed values. Optionally, a level of antibody bound to about 5 ng/ml of disulfide HMGB1 indicates a presence of MM. Optionally, a level of antibody bound to about 3-23 ng/ml of disulfide HMGB1 indicates a presence of MM, for example about, 3-21 ng/ml, 3-19 ng/ml, 3-17 ng/ml, 3-15 ng/ml, 3-13 ng/ml, 3-11 ng/ml, 3-9 ng/ml, 3-7 ng/ml, 3-5 ng/ml, 5-23 ng/ml, 7-23 ng/ml, 9-23 ng/ml, 11-23 ng/ml, 13-23 ng/ml, 15-23 ng/ml, 17-23 ng/ml, 19-23 ng/ml, 21-23 ng/ml, 5-21 ng/ml, 7-19 ng/ml, 5-13 ng/ml, 7-13 ng/ml, 9-13 ng/ml disulfide HMGB1. Optionally, the subject is diagnosed as having MM when the level of antibody bound to disulfide HMGB1 in the sample is greater than two-fold above the lower limit of detection for the antibody, for example greater than two-, three-, four-, five-, six-, seven-, eight-, nine-, ten-, twenty-, thirty-, forty-, or fifty-fold.
[0148] Optionally, the subject is identified as having MM when the level of fully reduced HMGB1 (or antibody bound to fully reduced HMGB1) in the sample is greater than a level of fully reduced HMGB1 (or the antibody bound to fully reduced HMGB1) of about 3 ng/ml of fully reduced HMGB1, for example greater than about 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/mL fully reduced HMGB1, including ranges between any two of the listed values. It is noted that subjects that were exposed to asbestos have been observed to have higher levels of fully reduced HMGB1 than healthy controls, and that subjects with MM were observed to have even higher levels of HMGB1 (see
[0149] It has been observed that both asbestos-exposed individuals and MM patients have higher levels of hypo-acetylated HMGB1 than healthy controls (see
[0150] It has been observed that both asbestos-exposed individuals and MM patients have higher levels of total HMGB1 than healthy controls (see Tables 3.1-3.2). Accordingly, in some embodiments, the method further comprises contacting the sample with an antibody that binds specifically to HMGB1, but detects total HMGB1 (e.g. an antibody that binds to an epitope common to all of the HMGB1 isoforms, or a polyclonal antibody against HMGB1). Optionally, the method comprises comparing the level of total HMGB1 to a predetermined level. The predetermined level can comprise at least 2 ng/mL of total HMGB1, for example at least about 2 ng/mL, 2.5, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, or 200 ng/mL, including ranges between any two of the listed values. It is noted that the predetermined level of total HMGB1 may be higher if the subject is a smoker rather than a non-smoker (see Tables 3.1-3.2). For example, in some embodiments, if the subject is a smoker, the predetermined level can be increased (compared to a non-smoker subject) by at least 5 ng/mL, for example, 5 ng/mL, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 ng/mL. In some embodiments, the predetermined level of total HMGB1 is 11.35 ng, and can differentiate subjects with MM (greater than 11.35 ng/ml) from subject with benign or malignant non-MM pleural effusions (less than 11.35 ng/ml). In some embodiments, the predetermined level of total HMGB1 is 15.75 ng/ml, and can differentiate subjects with MM (greater than 15.75 ng/ml) from subjects with benign or malignant non-MM pleural effusions (less than 15.75 ng/ml).
[0151] In some embodiments, if the HMGB1 or isoform(s) of HMGB1 are above the predetermined level, the method further comprises recommending or prescribing a treatment regimen for malignant mesothelioma or inflammatory cancer. Examples of treatment regimens include chemotherapy and radiation therapy.
Methods of Differentiating Malignant Mesothelioma from Asbestos Exposure
[0152] It has been observed herein that the presence and or levels of HMGB1 isoforms can differ between asbestos-exposed individuals and MM patients. It has been observed by mass spectrometry that the total amount of HMGB1 is significantly higher in MM patients than in asbestos-exposed individuals (see
[0153] In some embodiments, a method of differentiating between malignant mesothelioma and asbestos-exposure in a subject is provided. The method can comprise providing a biological sample from a subject suspected of having malignant mesothelioma. The methods can comprise contacting the biological sample with at least one antibody that binds to an HMGB1 isoform of interest, for example, an antibody that binds specifically to hyper-acetylated HMGB1, an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45), or an antibody that binds specifically to fully reduced HMGB1. The method can comprise detecting a level of the antibody bound to hyper-acetylated HMGB1, disulfide HMGB1 (HMGB1C23-C45) or chemokine HMGB1. The method can comprise comparing the level of antibody bound to hyper-acetylated HMGB1, disulfide HMGB1, or chemokine HMGB1 to a predetermined level, in which a level of hyper-acetylated HMGB1, disulfide HMGB1, or chemokine HMGB1 greater than a predetermined level indicates a presence of malignant mesothelioma in the subject.
[0154] Optionally, the subject is determined to have MM instead of being exposed to asbestos, when the level of hyper-acetylated HMGB1 (or level of antibody bound to hyper-acetylated HMGB1) from the sample is greater than a predetermined level, below which is characteristic of a healthy population and/or asbestos-exposed individuals. Example predetermined levels include levels of hyper-acetylated HMGB1 (or antibody bound to hype-acetylated HMGB1) of at least 0.1 ng/ml of hyper-acetylated HMGB1, for example 0.1 ng/ml, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, or 200 ng/ml hyper-acetylated HMGB1, including ranges between any two of the listed values. Optionally, a level of antibody bound to about 0.1-2 ng/ml, 0.1-1.8 ng/ml, 0.1-1.6 ng/ml, 0.1-1.4 ng/ml, 0.1-1.2 ng/mL, 0.1-1 ng/ml, 0.1-0.8 ng/ml, 0.1-0.6 ng/ml, 0.1-0.4 ng/ml, 0.1-0.2 ng/mL, 0.2-0.3 ng/ml, 0.2-0.5 ng/ml, 0.3-0.5 ng/ml, 0.3-0.7 ng/mL, 0.3-1 ng/ml, 0.5-1.2 ng/ml hyper-acetylated HMGB1 indicates that the subject has MM instead of asbestos. The term about as used herein when referring to a measurable value such as an amount, is meant to encompass variations of +/20%, +/10%, +/5%, +/1%, +/0.5%, or +/0.1%, or any number in between these percentages, from the specified value. In some aspects the level of antibody bound to hypo-acetylated HMGB1 includes ranges between any of the two listed values.
[0155] Optionally, a subject is identified as having MM when the level of disulfide HMGB1 (or antibody bound to disulfide HMGB1) is above a predetermined level. Example predetermined levels include levels disulfide HMGB1 (or antibody bound to disulfide HMGB1) of at least 0.1 ng/ml of disulfide HMGB1, for example 0.1 ng/ml, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, or 200 ng/ml disulfide HMGB1, including ranges between any two of the listed values. Optionally, a level of antibody bound to about 0.1-2 ng/ml, 0.1-1.8 ng/ml, 0.1-1.6 ng/ml, 0.1-1.4 ng/ml, 0.1-1.2 ng/mL, 0.1-1 ng/ml, 0.1-0.8 ng/ml, 0.1-0.6 ng/ml, 0.1-0.4 ng/ml, 0.1-0.2 ng/mL, 0.2-0.3 ng/ml, 0.2-0.5 ng/ml, 0.3-0.5 ng/ml, 0.3-0.7 ng/mL, 0.3-1 ng/ml, 0.5-1.2 ng/ml disulfide HMGB1 indicates that the subject has MM instead of asbestos. Optionally, the predetermined level of disulfide HMGB1 (or antibody bound to HMGB1) represents a fold increase (FI) over the lower limit of detection (LLD) for the antibody. In some embodiments, the predetermined level is a FI of at least about 0.5 FI over LLD, for example, about 0.5 FI over LLD, 0.7, 1, 1.5, 2, 2.5, 3, 3.5, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 5000, or 10,000 FI over LLD, including ranges between any two of the listed values. In some embodiments, an individual is identified as having MM when the level of antibody bound to disulfide HMGB1 is within about 3-41 Fl over LLD, 3-39 Fl over LLD, 3-37 Fl over LLD, 3-35 Fl over LLD, 3-33 Fl over LLD, 3-31 Fl over LLD, 3-29 Fl over LLD, 3-27 Fl over LLD, 3-25 Fl over LLD, 3-23 Fl over LLD, 5-21 Fl over LLD, 5-19 Fl over LLD, 7-17 Fl over LLD, 9-15 Fl over LLD, 11-13 Fl over LLD, 7-31 Fl over LLD, 9-29 Fl over LLD, 11-27 Fl over LLD, 7-33 Fl over LLD, 9-27 Fl over LLD, 9-25 Fl over LLD.
[0156] Optionally, the subject is determined to have asbestos exposure, when the level of fully reduced HMGB1 in the sample is greater than a predetermined level, below which is characteristic of healthy individuals, but below a level characteristic of MM. Accordingly, a range of fully reduced HMGB1 can identify an individual with asbestos exposure, for example a level of, or a level of fully-reduced HMGB1 (or antibody bound to fully reduced HMGB1) about 1-11 Fl over LLD, 1-10 Fl over LLD, 1-9 Fl over LLD, 1-8 Fl over LLD, 1-7 Fl over LLD, 1-6 Fl over LLD, 1-5 Fl over LLD, 1-4 Fl over LLD, 1-3 Fl over LLD, 2-9 Fl over LLD, 2-8 Fl over LLD, 2-7 Fl over LLD, 2-6 Fl over LLD, 2-5 Fl over LLD, 3-8 Fl over LLD, or 3-7 Fl over LLD.
Methods of Identifying Asbestos Exposure, Malignant Mesothelioma, or Inflammatory Cancer
[0157] In some embodiments, a method of identifying asbestos exposure, malignant mesothelioma, or inflammatory cancer in a subject is provided. The method can comprise determining a presence or level of an isoform of HMGB1 in a biological sample of the subject. The isoform of HMGB1 can be selected from a 24.585 KDa isoform of HMGB1, a 24.587 KDa isoform of HMGB1, a 25.467 KDa isoform of HMGB1; or a 25.469 KDa isoform of HMGB1. In some embodiments, the presence of one or more of the listed isoforms is determined. In some embodiments, the presence of two, three, or four of the listed isoforms is determined. In some embodiments, the level of one or more of the listed isoforms is determined. In some embodiments, the level of two, three, or four of the listed isoforms is determined. The method can comprise comparing an amount of the isoform of HMGB1 to a predetermined level, wherein an amount greater than the predetermined level identifies asbestos exposure, malignant mesothelioma, or inflammatory cancer in the subject. Optionally, the method can comprise comparing an amount of the isoform of HMGB1 to an amount of the same isoform in a negative control sample from an individual known not to have mesothelioma and/or inflammatory cancer.
[0158] Optionally, the isoform or isoforms of HMGB1 are detected by mass spectrometry. Optionally, the isoform or isoforms of HMGB1 are detected by contacting the biological sample with an antibody that binds specifically to any of the isoforms, as described herein. Optionally, the isoform or isoforms of HMGB1 are detected by contacting the biological sample with an antibody that binds specifically to any of the isoforms as described herein and by performing mass spectrometry.
[0159] Optionally, mass spectrometry is performed to detect isoforms of HMGB1. Mass spectrometry is a technique that helps measure the amount and type of chemicals present in a sample. It analyzes the mass-to-charge ratio and presence of gas-phase ions. Optionally, Mass Spectrometry/Mass Spectrometry (MS/MS), in which a particular characteristic peak of a mass spec profile is further analyzed (e.g. sequenced). This is also known as Triple Quadrupole Mass Spectrometry. In some aspects, Electrospray Ionization Liquid Chromatography Mass Spectrometry (ESI-LC-MS) can be used to observe the molecular ions as well as structural information of HMGB1 isoforms. And optionally, Matrix-assisted Laser desorption/ionization (MALDI) can be used to detect HMGB1 isoforms.
[0160] In some embodiments, an amount of an isoform of HMGB1 in a biological sample of the subject, including a) a 24.585 KDa isoform of HMGB1, b) a 24.587 KDa isoform of HMGB1, c) a 25.467 KDa isoform of HMGB1 or d) a 25.469 KDa isoform of HMGB1, is compared to an amount of the isoform of HMGB1 to a predetermined level, wherein an amount greater than the predetermined level identifies asbestos exposure, malignant mesothelioma, or inflammatory cancer in the subject. For example, a level of (c) 25.467 KDa isoform of HMGB1 or (d) 25.469 KDa isoform of HMGB1 greater than 5 ng/mL can indicate a presence of mesothelioma, and wherein a level of (a) 24.585 KDa isoform of HMGB1 or (d) 25.469 KDa isoform of HMGB1 greater than 5-fold of a lower limit of detection indicates a presence of mesothelioma or inflammatory cancer.
[0161] Optionally, the subject is identified as having an inflammatory cancer when the amount of HMGB1 isoform is above a predetermined level. Example inflammatory cancers include, but are not limited to, mesothelioma, colorectal cancer, pancreatic cancer, breast cancer, liver cancer, and the like.
Kits
[0162] Some embodiments relate to immunoassay kits. The kits can comprise one or more antibodies that bind specifically to an isoform of HMGB1. The kit can further include a detectable moiety. By way of example, such kits can be useful for diagnosing or detecting MM and exposure to asbestos. The kits can be for use in any of a variety of immunoassays, for example, ELISA, Western Blot, later flow assays, no-wash assays, and the like, and can include reagents for any of these assays.
[0163] The kits can comprise at least one of the following antibodies, for example, one, two, three, four, five, six, seven, or eight of the antibodies: (a) an antibody that binds specifically to hyper-acetylated HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45); (c) an antibody that binds specifically to hypo-acetylated HMGB1; (d) an antibody that binds specifically to fully reduced HMGB1; (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1; (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; or (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1.
[0164] Optionally, the kit further comprises an antibody that binds to HMGB1, but does not necessarily bind to a particular isoform, for example, polyclonal antibody against HMGB1.
[0165] The kits can comprise one or more detectable moieties. Example detectable moieties include fluorophores, radiolabels, FRET pairs, enzyme-substrate pairs, enzyme, and the like as described herein. Optionally, any of the antibodies of (a), (b), (c), (d), (e), (f), (g), or (h) comprises a detectable moiety. Optionally, the kit comprises a secondary antibody that binds specifically to any of the antibodies of (a), (b), (c), (d), (e), (f), (g), or (h), and the secondary antibody comprises a detectable moiety. In some embodiments, for example in embodiments that contain two of more of the antibodies of (a), (b), (c), (d), (e), (f), (g), or (h), a first of the antibodies comprises a first detectable moiety, and a second of the antibodies comprises a second detectable moiety. Optionally, the second detectable moiety is different from the first detectable moiety. In some embodiments, each primary antibody of the kit (for example, antibodies of (a), (b), (c), (d), (e), (f), (g), or (h)) comprises a different detectable moiety. In some embodiments, the kit comprises secondary antibodies, and each secondary antibody of the kit comprises a different detectable moiety.
[0166] Optionally, the kit comprises a combination or panel of two antibodies that bind to different HMGB1 isoforms. Example combinations include (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45); (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (c) an antibody that binds specifically to hypo-acetylated HMGB1; (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (d) an antibody that binds specifically to fully reduced HMGB1; (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1; (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; (a) an antibody that binds specifically to hyper-acetylated HMGB1 and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and (c) an antibody that binds specifically to hypo-acetylated HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and (d) an antibody that binds specifically to fully reduced HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; (b) an antibody that binds specifically to disulfide HMGB1 (HMGB1C23-C45) and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1; (c) an antibody that binds specifically to hypo-acetylated HMGB1 and (d) an antibody that binds specifically to fully reduced HMGB1; (c) an antibody that binds specifically to hypo-acetylated HMGB1 and (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1; (c) an antibody that binds specifically to hypo-acetylated HMGB1 and (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (c) an antibody that binds specifically to hypo-acetylated HMGB1 and (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; (c) an antibody that binds specifically to hypo-acetylated HMGB1 and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1; (d) an antibody that binds specifically to fully reduced HMGB1 and (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1; (d) an antibody that binds specifically to fully reduced HMGB1 and (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (d) an antibody that binds specifically to fully reduced HMGB1 and (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; (d) an antibody that binds specifically to fully reduced HMGB1 and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1; (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1 and (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1; (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1 and (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; (e) an antibody that binds specifically to hyper-acetylated disulfide HMGB1 and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1; (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1 and (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1; (f) an antibody that binds specifically to hyper-acetylated fully reduced HMGB1 and (h) an antibody that binds specifically to hypo-acetylated fully-reduced HMGB1; or (g) an antibody that binds specifically to hypo-acetylated disulfide HMGB1.
[0167] Optionally, the kit comprises a combination or panel of three antibodies. Example combinations include antibodies that bind to (a) hyper-acetylated HMGB1, (b) disulfide HMGB1 (HMGB1C23-C45), and (c) hypo-acetylated HMGB1; antibodies that bind to (a) hyper-acetylated HMGB1, (b) disulfide HMGB1 (HMGB1C23-C45), and (e) hyper-acetylated disulfide HMGB1; antibodies that bind to (a) hyper-acetylated HMGB1, (f) hyper-acetylated fully reduced HMGB1, (h) hypo-acetylated fully-reduced HMGB1; antibodies that bind to (a) hyper-acetylated HMGB1 and (g) hypo-acetylated disulfide HMGB1, and (h) hypo-acetylated fully-reduced HMGB1; antibodies that bind to (a) hyper-acetylated HMGB1, (e) hyper-acetylated disulfide HMGB1, and (g) hypo-acetylated disulfide HMGB1.
[0168] Optionally, the kit comprises a combination or panel of four antibodies. Example combinations include antibodies that bind to (a) hyper-acetylated HMGB1, (b) disulfide HMGB1 (HMGB1C23-C45), (c) hypo-acetylated HMGB1, and (d) fully reduced HMGB1; antibodies that bind to (a) hyper-acetylated HMGB1, (b) disulfide HMGB1 (HMGB1C23-C45), (d) fully reduced HMGB1, (g) hypo-acetylated disulfide HMGB1; antibodies that bind to (a) hyper-acetylated HMGB1, (b) disulfide HMGB1 (HMGB1C23-C45), (e) hyper-acetylated disulfide HMGB1, and (g) hypo-acetylated disulfide HMGB1.
[0169] In some embodiments, kit comprises a mass spectrometry kit. The kit can comprise a standard known to comprise or consist essentially of an isoform of HMGB1, for example (a) a 24.585 KDa isoform of HMGB1, (b) a 24.587 KDa isoform of HMGB1, (c) a 25.467 KDa isoform of HMGB1, (d) a 25.469 KDa isoform of HMGB1. In some embodiments, the standard comprises or consists essentially of two, three, or four HMGB1 isoforms, for example, (a) and (b), (a) and (c), (a) and (d), (b) and (c), (b) and (d), (c) and (d), (a) and (b) and (c), (a) and (b) and (d), (a) and (c) and (d), (b) and (c) and (d), or (a) and (b) and (c) and (d). In some embodiments, the standard comprises a known level or quantity of the indicated HMGB1 isoform(s). Optionally, the kit can comprise an antibody that binds specifically to HMGB1.
[0170] A subject kit may further include positive and negative controls. An example of a positive control is a sample, for example a biological sample, known to comprise the HMGB1 isoform (or isoforms) of interest. An example of a negative control is a sample for example a biological sample, which does not comprise the HMGB1 isoform (or isoforms) of interest. In some embodiments, the kits are useful in diagnostic applications, as described in detail herein. In some embodiments, the kit comprises a positive control, for example a substance comprising, or consisting essentially of only a single isoform of HMGB1, for example a 24.585 KDa isoform of HMGB1, a 24.587 KDa isoform of HMGB1, a 25.467 KDa isoform of HMGB1, or a 25.469 KDa isoform of HMGB1, or any two, three, or four of the above-referenced isoforms. The positive control can comprise known concentration or quantity of the indicated HMGB1 isoform(s). In some embodiments, the kit comprises a negative control, for example a substance known not to comprise one or more HMGB1 isoforms. Optionally, the negative control does not comprise any HMGB1.
[0171] A subject kit can further include, if desired, one or more of various conventional components, such as, for example, containers with one or more buffers (e.g., wash buffers), detection reagents or antibodies. Printed instructions, either as inserts or as labels, indicating quantities of the components to be used and guidelines for their use, can also be included in the kit. In the present disclosure it should be understood that the specified materials and conditions can be useful in accordance with some embodiments herein, but that unspecified materials and conditions are not excluded so long as they do not prevent the benefits of the invention from being realized.
[0172] A kit will in some embodiments provide a standard for normalization of a level of a target polypeptide to a standard, e.g., a level of an actin polypeptide, a level of a GAPDH polypeptide, etc. A kit will in some embodiments further include negative controls, e.g., antibodies specific for a non-target polypeptide; and the like.
[0173] Optionally, the kits can also include reagents for carrying out ELISAs (e.g., multi-well plates, 96-well plates; plates containing wells in multiples of 96, and the like). Optionally, the kits can also include substrates for lateral flow assays. Optionally, the kits can also include reagents for western blot. Optionally, the kits can also include components for conducting immunohistochemical analysis of a tissue sample (e.g. fixative, slides); and the like.
[0174] In addition to above-mentioned components, the subject kits typically further include instructions for using the components of the kit to practice the subject methods. The instructions for practicing the subject methods are generally recorded on a suitable recording medium. For example, the instructions may be printed on a substrate, such as paper or plastic, etc. As such, the instructions may be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (i.e., associated with the packaging or subpackaging) etc. In other embodiments, the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g. flash drive, DVD-ROM, CD-ROM, etc. In yet other embodiments, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g. via the internet, are provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate.
Additional Embodiments
[0175] Provided herein are embodiments based on the surprising and unexpected discovery that HMGB1 is highly expressed in malignant mesothelioma (MM) serum samples of MM patients and subjects exposed to asbestos. Also provided herein are embodiments drawn to the discovery that different HMGB1 isoforms are present in different stages of asbestos-induced MM pathogenesis. HMGB1 can be heavily regulated via post-translational modifications, in particular acetylation of lysines residues in its two nuclear localization signals (NLS1 or NLS2) and redox-sensitive modifications of its three cysteines. Upon exposure to asbestos fibers, HM passively released hypo-acetylated HMGB1 mostly in the fully reduced chemokine form. Supernatant from MM cells grown under hypoxic conditions to better mimic the tumor microenvironment presented conspicuous amount of actively secreted hyper-acetylated HMGB1, with the prevalent redox isoform being disulfide HMGB1. The long latency period between exposure to carcinogenic fibers and MM development provides physicians with a window for early diagnosis. As such, additional serological markers to differentiate asbestos-exposure and MM can be useful, since proposed biomarkers for MMsoluble mesothelin-related peptides (SMRPs), osteopontin, and fibulin-3lack in sensitivity, specificity, or reproducibility.
[0176] Hyper-acetylated and disulfide HMGB1 isoforms have only been detected in non-malignant conditions like alcoholic liver disease (ALD), acute acetaminophen-induced liver failure, and severe macrophage activation syndrome. In larger cohorts of asbestos-exposed individuals, ALD might represent a relevant confounding factor. However, ALD patients present in their sera also a phosphorylated version of HMGB1, which is not present in healthy individuals, individuals exposed to asbestos, or MM patients. The levels of this phosphorylated isoform, together with accurate clinical history, physical examination, and other biochemical tests of liver function, can provide a further tool to distinguish ALD from MM in asbestos-exposed individuals with high HMGB1 levels. In some embodiments, a presence or level of phosphorylated HMGB1 isoforms above a predetermined level can identify a subject with Alcoholic Liver Disease (ALD).
EXAMPLES
[0177] The following examples which are provided herein for purposes of illustration, and are not intended to be limiting.
[0178] For Examples 1-4, plasma samples from 19 MM patients, 20 asbestos-exposed individuals and 20 healthy controls were collected. HMGB1 isoforms were analyzed by ESI-LC-MS. Total and acetylated HMGB1 isoforms were expressed in ng/mL (median, 1st quartile-3rd quartile); redox HMGB1 isoforms were expressed as fold increase over lower limit of detection (FI over LLD) (median, 1st quartile-3rd quartile). Plasma osteopontin and fibulin-3 levels were measured in MM patients and asbestos-exposed individuals. The ability of these markers to distinguish cohorts was evaluated by the Mann-Whitney test for independent samples, without correction for multiple comparisons, and Receiver-Operating-Characteristic (ROC) curves. The area under the ROC curve (AUC) was calculated.
[0179] For Example 8, HMGB1 levels in supernatants of HM and MM cells in tissue culture were measured.
[0180] For Examples 9-11, serum samples from 20 unexposed healthy controls, 22 MM patients who had been diagnosed following the development of pleural effusion, 20 insulator workers that were exposed to asbestos due to their occupational history, and included individuals with 10 or more years of occupational asbestos exposure were collected and measured, 13 patients with cytologically benign pleural effusions, and 25 serum samples from patients with pleural effusions due to non-MM malignancy were measured. HMGB1 isoforms were analyzed by ESI-LC-MS. Total and acetylated HMGB1 isoforms were expressed in ng/mL (median, 1st quartile-3rd quartile). Plasma fibulin-3, mesothelin, and OPN levels were measured in MM patients, asbestos-exposed individuals, patients with benign pleural effusions, and patients with non-MM malignant pleural effusions. The ability of these markers to distinguish cohorts was evaluated by the Mann-Whitney test for independent samples, without correction for multiple comparisons, and Receiver-Operating-Characteristic (ROC) curves. The area under the ROC curve (AUC) was calculated.
Example 1: Total and Isoform-Specific HMGB1 Levels
[0181] Total and isoform-specific HMGB1 in all three cohorts (healthy controls, MM patients, and asbestos-exposed individuals) were measured. Both a commercially available ELISA kit and a mass spectrometry protocol in accordance with methods and kits of some embodiments herein were used. The total levels of HMGB1 measured using these two different methods were very similar, (R.sup.2=0.92, P<0.0001) (
[0182] In the healthy control cohort, total HMGB1 was barely detectable (1.510.64 ng/mL). Levels significantly higher were measured in asbestos-exposed individuals (9.024.13 ng/mL, p<0.001) and MM patients, which showed the highest HMGB1 levels (30.5117.30 ng/mL, p<0.001 when compared to either other group) (
[0183] Total levels of HMGB1 for healthy individuals (H), asbestos-exposed individuals (Asb), and MM patients (MM) are also depicted in are also shown in
[0184] The HMGB1 isoform signature was highly consistent among all the individuals belonging to the same cohort. In asbestos-exposed individuals, fully reduced or chemokine HMGB1 was detected. This isoform was also characterized as being hypo-acetylated at NLS1 or NLS2 (
[0185] MM patients had also very high levels of hyper-acetylated HMGB1 (19.2810.47 ng/mL), while healthy controls (0.470.23 ng/mL) and asbestos-exposed individuals (0.480.43 ng/mL) were virtually devoid of it (p<0.001 for both comparisons) (
[0186] Disulfide cytokine HMGB1 was exclusively detected in sera from MM patients (19.1211.42 FI over LLD) but could not be detected in sera from either asbestos-exposed or non-exposed healthy individuals since it is below the limit of detection (
[0187] Compared to controls (1.860.73 FI over LLD), fully reduced chemokine HMGB1 levels were significantly higher in asbestos-exposed individuals (5.732.69 FI over LLD, p<0.001), and even more so in MM patients (10.498.72 FI over LLD, p<0.001 vs. healthy controls, p<0.05 vs. asbestos-exposed individuals). Disulfide HMGB1 was exclusively detected in serum from MM patients (18.7611.23 FI over LLD) (
[0188] Levels of disulfide HMGB1 and fully reduced HMGB1 for healthy individuals (H), asbestos-exposed individuals (Asb), and MM patients (MM) are also depicted in
[0189] The in vivo results described herein significantly overlapped with results previously observed in in vitro experiments. It has been observed that isoform-specific HMGB1 released from concentrated supernatants of primary mesothelial cells (HM) exposed to asbestos and MM cell lines. It has been observed herein that HM in normal tissue culture (unexposed controls) does not release detectable HMGB1 into extra-cellular space. Upon exposure to asbestos fibers, HM undergo programmed cell necrosis and passively released hypo-acetylated HMGB1 is observed (
[0190] Accordingly, different HMGB1 isoforms can be used to differentiate between populations of subjects in accordance with some embodiments herein. In some embodiments, levels of hyper-acetylated HMGB1 above a predetermined level indicate that a subject has MM, while levels of hyper-acetylated HMGB1 below the predetermined level indicates that a subject does not have MM (but rather can be a healthy control or asbestos-exposed, non-MM subject).
Example 2: Discrimination Between MM and Asbestos-Exposure
[0191] The performance of total and isoform-specific HMGB1 to discriminate asbestos-exposed individuals from MM patients was evaluated. Total and isoform-specific HMGB1 to proposed biomarkers such as mesothelin, osteopontin and fibulin-3 were compared.
[0192] The plasma levels of mesothelin were measured using a commercially available ELISA kit (R&D Systems, Minneapolis, Minn.) according to the manufacturer's instructions, and compared to the soluble mesothelin related peptides (0.4, 0.3-0.6 ng/ml) MESOMARK kit (Fujirebio Diagnostics Inc., Malvern, Pa.). These two testing methods show a very good correlation between the two kits (R2=0.75, P<0.0001) (
[0193] The AUC of total HMGB1 was 0.91 (0.80-1.00) (
TABLE-US-00003 TABLE 2 Sensi- Speci- tivity ficity No. of at 100% at 100% Partici- AUC Speci- Sensi- Marker pants (95% CI) Cutof ficity tivity Total 20 vs. 20 0.91 15.75 85% 10% HMGB1 (0.80-1.00) ng/mL Hyper- 1.00 2.15 100% 100% acetylated (1.00-1.00) ng/mL HMGB1 Disulfide 1.00 2.55 100% 100% HMGB1 (1.00-1.00) Fl over LLD Osteopontin 0.95 (0.90-1.00) Fibulin-3 0.95 (0.89-1.00) SMRP 0.96 (0.91-1.00)
[0194] In this sample set, HMGB1 isoforms performed better in discriminating MM patients from asbestos-exposed individuals compared to osteopontin (see
[0195] In this sample set, the levels of isoform-specific HMGB1 in MM patients do not correlate with levels of osteopontin, fibulin-3, and SMRP. Without being limited by any theory, it is contemplated that these three molecules have independent roles in MM pathogenesis and progression of these molecules (see
[0196] Accordingly, detection of HMGB1 isoforms in accordance with some embodiments herein provides a greater sensitivity and greater specificity for differentiating between asbestos-exposed individuals and MM patients than total HMGB1 levels, or than levels of other markers such as osteopontin, fibulin-3, and/or SMRP.
Example 3: Univariate and Multivariate Analyses of Total and Isoforms of HMGB1
[0197] Univariate and multivariate analyses were conducted to identify demographic variables that could influence levels of isoform-specific HMGB1 (see Tables 3.1-3.13).
[0198] For the statistical analysis, two age groups were defined: 55 years and less (N=30), and more than 55 years (n=29). Active and former smokers were grouped together and compared to non-smokers. When exposure to asbestos was known, exposed (long and short exposure) were grouped and compared to non-exposed. Using Barlett's test, it was found that HMGB1 and its isoforms presented significant heterogeneous variances between groups. Consequently, Mann and Whitney non-parametric test was used to compare two groups, and the Kruskall-Wallis non-parametric test was used to compare more than two groups. The significance was set to a p-value<0.05. The multivariate analysis of HMGB1 total and isoforms was carried out using a linear regression, after analyzing all interactions between the studied factors and the possible confounding due to each significant factor. Smoking status was found to be a confounding factor for total HMGB1; consequently, the multivariate analysis of this variable was stratified on smoking status (see Tables 4.1-4.6). All statistical analyses were run using STATA.
[0199] Hyper-acetylated HMGB1 was strongly associated with MM, although its levels were slightly influenced by other factors (e.g. sex, age, smoking)(see Tables 3.3-3.4). Disulfide HMGB1 was strongly associated with MM, independently of demographic variables (see Tables 3.11-3.12).
[0200] In this sample set, the level of hyper-acetylated HMGB1 in 14 female subjects was 8.5611.55 ng/mL, while the level of hyper-acetylated HMGB1 in 45 male subjects was 5.9310.37 ng/mL (p<0.2529 for the comparison). The level of hyper-acetylated HMGB1 in 29 subjects older than 55 years old was 10.7412.55 ng/mL, while the level of hyper-acetylated HMGB1 in 30 subjects younger than 55 years old was 2.466.19 ng/mL (p<0.0102 for the comparison). The level of hyper-acetylated HMGB1 in 25 subjects who are previous or currently active smokers was 10.4811.99 ng/mL, while the level of hyper-acetylated HMGB1 in 33 non-smokers was 3.558.66 ng/mL (p<0.0436 for the comparison) (Tables 3.3-3.4).
[0201] In this sample set, the level of disulfide HMGB1 in 14 female subjects was 8.6812.47 ng/mL, while the level of disulfide HMGB1 in 45 male subjects was 5.3910.58 ng/mL (p<0.3730 for the comparison). The level of disulfide HMGB1 in 29 subjects older than 55 years old was 10.4012.93 ng/mL, while the level of disulfide HMGB1 in 30 subjects younger than 55 years old was 2.096.87 ng/mL (p<0.0041 for the comparison). The level of disulfide HMGB1 in 25 subjects who are previous or currently active smokers was 9.7512.33 ng/mL, while the level of disulfide HMGB1 in 33 non-smokers was 3.509.45 ng/mL (p<0.0445 for the comparison) (Table 3.11-3.12).
TABLE-US-00004 TABLE 3.1 Univariate analyses of total HMGB1 Total HMGB1 Mean Univariate analysis N (ng/mL) [s.d.] p value Sex 0.5040 Male 45 13.56 [15.66] Female 14 12.87 [16.86] Age 0.0003 <=55 years 30 6.84 [9.52] >55 years 29 20.18 [18.16] Smoking status 0.0001 Non-smoker 33 7.23 [12.89] Previous/active smoker 25 21.76 [15.99] Asbestos exposure 0.0001 Never 21 2.58 [4.93] <=20 yrs 15 26.12 [19.44] >20 yrs 20 12.14 [8.91] unknown 3 33.83 [22.70] MM 0.0001 No 40 5.27 [4.79] Yes 19 30.50 [17.30] MM vs asbestos exposed 0.0001 Non exposed vs 0.0001 asbestos exposed MM 19 30.50 [17.30] Asb. exposed 20 9.02 [4.12] Non exposed 20 1.51 [0.64]
TABLE-US-00005 TABLE 3.2 Multivariate analyses of total HMGB1 Total HMGB1 Multivariate analysis Coef. 95% CI p value In non-smokers-N = 33 Linear regression R.sup.2 = 0.5779 MM 19.40 9.67-29.12 <0.001 Asbestos 6.67 1.31-14.64 0.098 Sex 3.91 3.42-11.24 0.284 constant 10.60 27.28-6.08 0.204 In smokers-N = 25 Linear regression R.sup.2 = 0.6809 MM 28.03 19.54-36.51 <0.001 Sex 16.32 29.36-3.28 0.017 constant 26.58 12.46-40-71 0.001
TABLE-US-00006 TABLE 3.3 Univariate analyses of Hyper-acetylated HMGB1 Hyper-acetylated HMGB1 Mean Univariate analysis N (ng/mL) [s.d.] p value Sex 0.2529 Male 45 5.93 [10.37] Female 14 8.56 [11.55] Age 0.0102 <=55 years 30 2.46 [6.19] >55 years 29 10.74 [12.55] Smoking status 0.0436 Non-smoker 33 3.55 [8.66] Previous/active smoker 25 10.48 [11.99] Asbestos exposure 0.0237 Never 21 1.27 [3.68] <=20 yrs 15 14.29 [13.21] >20 yrs 20 3.76 [7.03] unknown 3 23.00 [14.65] MM 0.0001 No 40 0.475 [0.34] Yes 19 19.28 [10.47] MM vs asbestos exposed 0.0001 Non exposed vs 0.4249 asbestos exposed MM 19 19.28 [10.47] Asb. exposed 20 0.48 [0.43] Non exposed 20 0.47 [0.23]
TABLE-US-00007 TABLE 3.4 Multivariate analyses of Hyper-acetylated HMGB1 Hyper-acetylated HMGB1 Multivariate analysis Coef. 95% CI p value Patients with known smoking Linear regression status-N = 58 R.sup.2 = 0.7290 MM 19.13 MM 19.13 Smoking status 1.23 Smoking status 1.23 constant 9.15 1.31-16.99 0.024
TABLE-US-00008 TABLE 3.5 Univariate analyses of Hypo-acetylated HMGB1 Hypo-acetylated HMGB1 Mean Univariate analysis N (ng/mL) [s.d.] p value Sex 0.0705 Male 45 7.63 [6.51] Female 14 4.41 [5.36] Age 0.0025 <=55 years 30 4.37 [4.83] >55 years 29 9.44 [6.80] Smoking status 0.0001 Non-smoker 33 3.67 [4.89] Previous/active smoker 25 11.27 [5.54] Asbestos exposure 0.0001 Never 21 1.30 [1.35] <=20 yrs 15 11.83 [6.98] >20 yrs 20 8.38 [4.52] unknown 3 10.83 [8.06] MM 0.0005 No 40 4.79 [4.78] Yes 19 11.23 [7.17] MM vs asbestos exposed 0.3252 Non exposed vs 0.0001 asbestos exposed MM 19 11.23 [7.17] Asb. exposed 20 8.54 [4.10] Non exposed 20 1.04 [0.61]
TABLE-US-00009 TABLE 3.6 Multivariate analyses of Hypo-acetylated HMGB1 Hypo-acetylated HMGB1 Multivariate analysis Coef. 95% CI p value Patients with known Linear regression smoking status-N = 58 R.sup.2 = 0.5471 Asbestos exposure 5.22 1.85-8.58 0.003 MM 3.53 0.75-6.32 0.014 Smoking status 3.22 0.11-6.34 0.043 constant 7.30 11.69-2.92 0.002
TABLE-US-00010 TABLE 3.7 Univariate analyses of Hypo-acetylated HMGB1 Fully reduced HMGB1 Mean Univariate analysis N (ng/mL) [s.d.] p value Sex 0.2223 Male 45 6.48 [6.79] Female 14 4.56 [4.57] Age 0.0089 <=55 years 30 4.10 [4.00] >55 years 29 8.02 [7.67] Smoking status 0.0001 Non-smoker 33 3.71 [4.41] Previous/active smoker 25 9.27 [7.22] Asbestos exposure 0.0001 Never 21 2.11 [1.35] <=20 yrs 15 10.61 [9.72] >20 yrs 20 6.09 [3.27] unknown 3 10.03 [6.82] MM 0.0001 No 40 3.80 [2.76] Yes 19 10.71 [8.90] MM vs asbestos exposed 0.0163 Non exposed vs asbestos exposed 0.0001 MM 19 10.71 [8.90] Asb. exposed 20 5.73 [2.69] Non exposed 20 1.86 [0.73]
TABLE-US-00011 TABLE 3.8 Multivariate analyses of Hypo-acetylated HMGB1 Multivariate analysis Hypo-acetylated HMGB1 Patients with known Coef. 95% CI p value smoking statusN = 58 Linear regression R.sup.2 = 0.4046 MM 6.42 2.85-9.99 0.001 Smoking status 2.48 1.21-6.17 0.183 Asbestos exposure 2.14 2.27-6.56 0.334 Sex 1.61 5.20-1.97 0.371 Age 1.11 4.67-2.45 0.534 constant 0.71 7.78-9.20 0.868
TABLE-US-00012 TABLE 3.9 Univariate analyses of Percentage of Hyper-acetylated HMGB1 Percentage of hyper-acetylated HMGB1 Univariate analysis N Mean (%) [s.d.] p value Sex 0.0108 Male 45 31.9% [28.9%] Female 14 50.2% [24.1%] Age 0.2430 <=55 years 30 31.7% [28.5%] >55 years 29 28.7% [28.7%] Smoking status 0.4653 Non-smoker 33 37.0% [27.9%] Previous/active smoker 25 33.6% [29.7%] Asbestos exposure 0.4379 Never 21 38.7% [26.7%] <=20 yrs 15 42.2% [27.3%] >20 yrs 20 24.3% [29.5%] unknown 3 68.9% [2.2%] MM 0.0001 No 40 22.8% [25.2%] Yes 19 64.5% [6.2%] MM vs asbestos exposed 0.0013 Non exposed vs asbestos exposed 0.0001 MM 19 64.5% [6.2%] Asb. exposed 20 8.6% [14.0%] Non exposed 20 37.0% [26.2%]
TABLE-US-00013 TABLE 3.10 Multivariate analyses of Percentage of Hyper-acetylated HMGB1 Percentage of Hyper-acetylated HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.6198 MM 0.53 0.42-0.64 <0.001 Asbestos exposure 0.27 0.37-0.16 <0.001 constant 0.63 0.46-0.80 <0.001
TABLE-US-00014 TABLE 3.11 Univariate analyses of Disulfide HMGB1 Disulfide HMGB1 Mean Univariate analysis N (ng/mL) [s.d.] p value Sex 0.3730 Male 45 5.39 [10.58] Female 14 8.68 [12.47] Age 0.0041 <=55 years 30 2.09 [6.87] >55 years 29 10.40 [12.93] Smoking status 0.0445 Non-smoker 33 3.50 [9.45] Previous/active smoker 25 9.75 [12.33] Asbestos exposure 0.0036 Never 21 0.97 [4.45] <=20 yrs 15 14.72 [13.94] >20 yrs 20 2.95 [6.44] unknown 3 21.30 [13.32] MM 0.0001 No 40 0.00 Yes 19 19.17 [11.38] MM vs asbestos exposed 0.0001 Non exposed vs asbestos exposed 1.000 MM 19 19.17 [11.38] Asb. exposed 20 0.00 Non exposed 20 0.00
TABLE-US-00015 TABLE 3.12 Multivariate analyses of Disulfide HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.6944 MM 19.96 16.46-23.45 <0.001 constant 0.00 1.95-1.95 <0.001 s.d.: standard deviation MM: malignant mesothelioma All R.sup.2 are very significant with a p-value < 0.0001
TABLE-US-00016 TABLE 3.13 Multivariate analyses of all cohorts Total HMGB1 Hyper-acetylated F actor N (ng/mL) HMGB1 (ng/mL) Sex p = 0.4885 NS p = 0.0621 NS Male 67 11.47 13.36 5.97 8.74 Female 33 9.49 11.41 6.89 7.77 Age P = 0.0005*** P = 0.0001*** <55 years 37 6.79 8.73 3.00 5.86 >55 years 63 13.18 14.11 8.20 9.09 Smoking P = 0.0001*** P = 0.0127* No 54 6.93 10.31 4.24 7.07 Yes 41 16.19 14.46 8.87 9.79 Asbestos No vs Exposed P = 0.0001*** P = 0.0001*** Never 22 3.51 6.51 1.95 4.81 <20 yrs 17 27.66 20.08 15.71 13.84 >20 yrs 20 12.14 8.91 3.76 7.03 unknown 41 7.11 3.83 5.91 3.35 No vs short exp. p = 0.0001*** p = 0.0024** No vs long exp. p = 0.0001*** p = 6413 NS Short vs long exp. p = 0.0080** P = 0.0055** MM MM vs others p = 0.0001*** p = 0.0001*** No 78 6.16 4.33 3.11 3.51 Yes 22 27.34 18.12 17.49 10.90 Non-MM Exposed 58 MM vs other exposed p = 0.0001*** p = 0.0001*** Stage P = 0.3673NS P = 0.3673NS 1-2 9 29.2 13.43 18.44 7.93 3-4 13 26.05 21.22 16.83 12.83 Effusion No vs Yes p = 0.0001*** p = 0.0001*** No 40 5.27 4.79 0.47 0.34 Yes 60 15.04 15.45 10.43 9.30 Benign 13 6.82 2.91 5.57 2.48 Malignant 47 17.34 16.73 11.79 10.05 Benign vs Malignant p = 0.0594 NS p = 0.0762 NS MM: malignant mesothelioma NS: non-significant *p < 0.05 **p < 0.01 ***p < 0.001
[0202] Tables 4.1-4.6 provide multivariate models for total and isoforms of HMGB1.
TABLE-US-00017 TABLE 4.1 Multivariate models for total HMGB1 Total HMGB1 Multivariate analysis Coef. 95% CI p value In non-smokersN = 33 Linear regression R.sup.2 = 0.5779 MM 19.40 9.67-29.12 <0.001 Asbestos 6.67 1.31-14.64 0.098 Sex 3.91 3.42-11.24 0.284 constant 10.60 27.28-6.08 0.204 In smokersN = 25 Linear regression R.sup.2 = 0.6809 MM 28.03 19.54-36.51 <0.001 Sex 16.32 29.36-3.28 0.017 constant 26.58 12.46-40-71 0.00/
TABLE-US-00018 TABLE 4.2 Multivariate models for Hyper-acetylated HMGB1 Hyper-acetylated HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.7290 MM 19.13 15.72-22.53 <0.001 Smoking status 1.23 1.96-4.41 0.443 constant 1.15 5.73-3.43 0.617
TABLE-US-00019 TABLE 4.3 Multivariate models for Hypo-acetylated HMGB1 Hypo-acetylated HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.5471 Asbestos exposure 5.22 1.85-8.58 0.003 MM 3.53 0.75-6.32 0.014 Smoking status 3.22 0.11-6.34 0.043 constant 7.30 11.69-2.92 0.002
TABLE-US-00020 TABLE 4.4 Multivariate models for Fully reduced HMGB1 Fully reduced HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.4046 MM 6.42 2.85-9.99 0.001 Smoking status 2.48 1.21-6.17 0.183 Asbestos exposure 2.14 2.27-6.56 0.334 Sex 1.61 5.20-1.97 0.371 Age 1.11 4.67-2.45 0.534 constant 0.71 7.78-9.20 0.868
TABLE-US-00021 TABLE 4.5 Multivariate models for Percentage of hyper-acetylated HMGB1 Percentage of hyper-acetylated HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.6198 MM 0.53 0.42-0.64 <0.001 Asbestos exposure 0.27 0.37-0.16 <0.001 constant 0.63 0.46-0.80 <0.001
TABLE-US-00022 TABLE 4.6 Multivariate models for Disulfide HMGB1 Disulfide HMGB1 Multivariate analysis Patients with known smoking Coef. 95% CI p value statusN = 58 Linear regression R.sup.2 = 0.6944 MM 19.96 16.46-23.45 <0.001 constant 0.00 1.95-1.95 <0.001 MM: malignant mesothelioma All R.sup.2 are very significant with a p-value < 0.0001
Example 4: Diagnosis of Malignant Mesothelioma
[0203] A method for diagnosing malignant mesothelioma is accordance with some embodiments herein is performed. A biological sample comprising serum of a subject at risk for malignant mesothelioma is provided. The serum sample is contacted with a mouse monoclonal antibody that binds specifically to hyper-acetylated HMGB1. The serum sample is contacted with a mouse monoclonal antibody that binds specifically to disulfide HMGB1 (the two antibody reactions are spatially separated). A secondary (goat anti-mouse) antibody that binds to the mouse primary antibodies is also contacted with the sample. The levels of antibodies that bind to hyper-acetylated HMGB1 and disulfide HMGB1 in the serum sample of the subject are detected. The levels of bound antibody (from which levels of hyper-acetylated HMGB1 and disulfide HMGB1 in the sample can be inferred) are then compared to a predetermined level. The bound levels of bound hyper-acetylated HMGB1 antibody and bound hyper-acetylated disulfide HMGB1 antibody are above the respective predetermined levels, and indicate that the subject has malignant mesothelioma. Subsequent appropriate treatments for malignant mesothelioma are then prescribed for the subject.
Example 5: Differentiating Between Malignant Mesothelioma and Asbestos Exposure
[0204] A method for differentiating between malignant mesothelioma and asbestos exposure in a subject in accordance with some embodiments herein is performed. A lateral flow assay kit is provided, comprising an antibody that binds specifically to hyper-acetylated HMGB1 and an antibody that binds specifically to fully reduced HMGB1. A biological sample comprising serum from a subject suspected of having malignant mesothelioma is provided. The serum sample is contacted with the antibodies from the kit. The level of antibody bound to each of the two isoforms of HMGB1 (hyper-acetylated and disulfide) is detected via the lateral flow assay and compared to a predetermined level. The level of antibody bound to hyper-acetylated HMGB1 is greater than a predetermined level, and the level of antibody bound to fully reduced HMGB1 is greater than a predetermined level and indicates a presence of malignant mesothelioma in the subject rather than asbestos exposure. An appropriate therapy regiment for malignant mesothelioma is prescribed for the subject.
Example 6: Differentiating Between Malignant Mesothelioma and Asbestos Exposure
[0205] A method for differentiating between malignant mesothelioma and asbestos exposure in a subject in accordance with some embodiments herein is provided. A biological sample comprising serum from a subject suspected of having malignant mesothelioma is provided. Levels of HMGB1 isoforms in the sample are detected by Electrospray Ionization Liquid Chromatography Mass Spectrometry. 10 ng/mL of disulfide HMGB1 are detected in the serum of the subject. This level of disulfide HMGB1 is greater than a predetermined level of 5 ng/mL. The subject is diagnosed as having malignant mesothelioma. An appropriate therapy regiment for malignant mesothelioma is prescribed for the subject.
Example 7: Levels of HMGB1 Isoforms in the Serum of Various Subjects
[0206] Serum levels of HMGB1 isoforms for various patients were determined by Electrospray Ionization Liquid Chromatography Mass Spectrometry (ESI-LC-MS). The levels of each isoform are shown for healthy controls (Tables 7.1-7.2), mesothelioma patients (Tables 7.3-7.4), and asbestos-exposed individuals (Table 7.5-7.6). Levels of Total HMGB1, Hyper-acetylated HMGB1 and Hypo-acetylated HMGB1 are shown in ng/mL. Levels of fully reduced HMGB1 and Disulfide HMGB1 are shown as fold increase above lower limit of detection.
TABLE-US-00023 TABLE 7.1 Characteristics of healthy controls SMOKING PACK CURRENT ID AGE SEX YEARS SMOKING ASBESTOS MM 01 38 M 0 NO NO NO 02 42 F 0 NO NO NO 03 21 M 0 NO NO NO 04 36 F 0 NO NO NO 05 44 M 0 NO NO NO 06 26 M 0 NO NO NO 07 56 F 0 NO NO NO 08 27 M 0 NO NO NO 09 37 M 0 NO NO NO 010 41 M 0 NO NO NO 011 49 M 0 NO NO NO 012 41 M 0 NO NO NO 013 25 F 0 NO NO NO 014 64 F 0 NO NO NO 015 29 F 0 NO NO NO 016 47 M 0 NO NO NO 017 23 F 0 NO NO NO 018 49 M 0 NO NO NO 019 41 M 0 NO NO NO 020 33 F 0 NO NO NO
TABLE-US-00024 TABLE 7.2 Levels of HMGB1 isoforms in healthy controls Fully SMOK- reduced Disulfide ING Total Hyperac Hypoac HMGB HMGB1 PACK ASBES- HMGB1 HMGB1 HMGB1 (FI-AUC- (FI-AUC- ID YEARS TOS MM (ng/ml) (ng/ml) (ng/mL) LLD) LLD) 01 0 NO NO 1.1 0.5 0.6 1.3 ND 02 0 NO NO 2.6 0.6 2 3.3 ND 03 0 NO NO 1.9 0.3 1.6 3.1 ND 04 0 NO NO 0.8 0.7 0.1 1.8 ND 05 0 NO NO 2.3 0.8 1.5 2.8 ND 06 0 NO NO 0.87 0.4 0.47 1.1 ND 07 0 NO NO 0.81 0.1 0.71 1.1 ND 08 0 NO NO 1.78 0.1 1.68 2.6 ND 09 0 NO NO 0.32 0.2 0.12 1.2 ND 010 0 NO NO 2.01 0.5 1.512 1.7 ND 011 0 NO NO 2.29 0.9 1.388 1.9 ND 012 0 NO NO 0.62 0.7 0.084 1.4 ND 013 0 NO NO 1.41 0.6 0.808 1.2 ND 014 0 NO NO 1.32 0.4 0.92 1.5 ND 015 0 NO NO 1.76 0.3 1.46 1.5 ND 016 0 NO NO 1.32 0.2 1.12 1.3 ND 017 0 NO NO 1.98 0.6 1.38 1.4 ND 018 0 NO NO 1.23 0.3 0.932 2.1 ND 019 0 NO NO 2.36 0.5 1.864 3.2 ND 020 0 NO NO 1.41 0.7 0.708 1.8 ND
TABLE-US-00025 TABLE 7.3 Characteristics of mesothelioma patients SMOKING PACK CURRENT ID AGE SEX YEARS SMOKING ASBESTOS MM 1107S 61 F 0 NO <20 years YES 1336A 66 F 0 NO <20 years YES 939S 50 F 15 NO NO YES 851S 58 F 1 NO <20 years YES 1189S 76 M 30 NO <20 years YES 1283 71 M 30 NO <20 years YES 1306 73 F 5 NO <20 years YES 1336 66 F 0 NO <20 years YES 1338 80 M 0 NO <20 years YES 1353 81 M 15 NO <20 years YES 1356 73 M UNK UNK 20 years YES 1363 64 M 20 NO <20 years YES 1373 55 M 0 NO <20 years YES 1396 59 M 30 NO 20 years YES 1419 25 F 0 NO NO YES 1621 89 M 0 NO 20 years YES 1633 77 M 10 NO 20 years YES 1672 75 M 30 NO 20 years YES 1744 59 M 7 NO <20 years YES 1755 74 M 30 NO <20 years YES
TABLE-US-00026 TABLE 7.4 Levels of HMGB1 in mesothelioma patients Fully reduced Disulfide Total Hyperac- Hypoac- HMGB HMGB1 HMGB1 HMGB1 HMGB1 (FI-AUC- (FI-AUC- ID MM (ng/m1) (ng/ml) (ng/mL) LLD) LLD) 1107S YES 59.9 39.8 20.1 17.9 41.3 1336S YES 16.4 12.4 4 6.6 11.5 939S YES 23.2 16.3 6.9 5.9 11.6 851S YES 16.6 10.7 5.9 4.8 16.7 1189S YES 36.1 21.9 14.2 10.3 23.4 1283 YES 63.4 40.2 23.2 17.1 30.6 1306 YES 26.1 17.4 8.7 8.3 20.5 1336 YES 20.5 13.4 7.1 6.1 10.5 1338 YES 11.4 6.1 5.3 3.4 5.4 1353 YES 45.7 27.9 17.8 11.4 44.1 1356 YES 7.8 5.9 1.9 1.2 5.1 1363 YES 36.6 20.7 15.9 9.8 20.3 1373 YES 44.1 26.8 17.3 20.6 30.8 1396 YES 36.3 20.9 15.4 9.4 25.6 1419 YES 23.9 17.3 6.6 7.1 20.4 1621 YES 3.6 2.4 1.2 0.8 6.5 1633 YES 27.3 19.7 7.6 10.7 10.4 1672 YES 27.8 18.7 9.1 8.3 11.5 1744 YES 15.8 10.3 5.5 9.7 18.6 1755 YES 55.6 30.4 25.2 40.5 10.5
TABLE-US-00027 TABLE 7.5 Characteristics of asbestos-exposed individuals SMOKING PACK CURRENT ID AGE SEX YEARS SMOKING ASBESTOS MM 1-S 42 M 5 NO <20 years NO 10-S 56 M 11.1 NO 20 years NO 2-S 49 M 0 NO <20 years NO 6-S 65 M 64 NO 20 years NO 14-5 47 M 0 NO 20 years NO 15 56 M 5 NO 20 years NO 16 62 M 12 NO 20 years NO 17 52 M 0 NO 20 years NO 18 44 M 29 YES 20 years NO 19 56 M 0 NO 20 years NO 20 58 M 0 NO 20 years NO 21 55 M 0.75 NO 20 years NO 22 53 M 13.6 NO <20 years NO 23 70 M 12 NO 20 years NO 24 56 M 4.5 NO 20 years NO 25 63 M 54 NO 20 years NO 26 55 M 0 NO <20 years NO 27 65 M 0 NO 20 years NO 28 42 M 5 NO <20 years NO 29 70 M 1.8 NO 20 years NO
TABLE-US-00028 TABLE 7.6 Levels of HMGB1 in asbestos-exposed individuals Fully reduced Disulfide Total Hyperac- Hypoac- HMGB HMGB1 HMGB1 HMGB1 HMGB1 (FI-AUC- (FI-AUC- ID ASBESTOS MM (ng/ml) (ng/ml) (ng/mL) LLD) LLD) 1-5 <20 years NO 11.1 0.4 10.7 6.7 ND 10-5 20 years NO 15.7 0.2 15.5 9.2 ND 2-S <20 years NO 4.9 0.3 4.6 2.8 ND 6-S 20 years NO 13.8 0.4 13.4 8.1 ND 14-S 20 years NO 11.4 0.6 10.8 6.1 ND 15 20 years NO 6.4 0.1 6.3 4.2 ND 16 20 years NO 3.5 0.8 2.7 1.3 ND 17 20 years NO 9.9 0.1 9.8 6.5 ND 18 20 years NO 12.5 0.1 12.4 10.5 ND 19 20 years NO 5.6 0.3 5.3 5.9 ND 20 20 years NO 10.4 0.3 10.1 4.7 ND 21 20 years NO 11.7 1.9 9.8 8.4 ND 22 <20 years NO 14.2 0.6 13.6 6.4 ND 23 20 years NO 8.3 0.4 7.9 6.9 ND 24 20 years NO 10.5 0.2 10.3 7.4 ND 25 20 years NO 13.6 1.2 12.4 8.5 ND 26 <20 years NO 3.8 0.3 3.5 2.6 ND 27 20 years NO 1.1 0.7 0.4 0.5 ND 28 <20 years NO 6.4 0.3 6.1 4.7 ND 29 20 years NO 5.7 0.4 5.3 3.3 ND
[0207] As such, levels of one or more HMGB1 isoforms can be detecting in individual patients in accordance with some embodiments herein. Additionally, it is contemplated that particular levels of particular HMGB1 isoforms can provide signatures characteristics of various populations.
Example 8: HMGB1 Levels in Supernatants of HM and MM Cells in Tissue Culture
[0208] HMGB1 levels from concentrated supernatant of HM and MM cells in tissue culture were measured. Unexposed HM cells did not release detectable HMGB1 into the extracellular space (
[0209] When HM cells are exposed to 5 g/cm.sup.2 of crocidolite asbestos, 60-70% of them undergo programmed necrosis within 48 hours. In the supernatant of HM cells exposed to asbestos (Asb-HM), high levels of hypo-acetylated HMGB1 were consistently detected, as expected from cells undergoing necrosis (
[0210] As such, measurements of levels of hypo-acetylated and/or hyper-acetylated HMGB1 in accordance with kits and/or methods of some embodiments herein can differentiate malignant mesothelioma cells from (i) asbestos-exposed cells and from (ii) cells that are neither asbestos-exposed nor have malignant mesothelioma. Additionally, measurements of total levels HMGB1 in accordance with kits and/or methods in accordance with some embodiments herein can differentiate malignant mesothelioma cells from (i) asbestos-exposed cells and from (ii) cells that are neither asbestos-exposes nor have malignant mesothelioma.
Example 9: Discriminating Individuals with Asbestos-Exposure and/or MM from Healthy Controls Using HMGB1
[0211] In another experiment, total and isoform-specific HMGB1 in the sera from all three cohorts (asbestos-unexposed healthy controls, MM patients, and individuals with asbestos exposure) were measured. In the (unexposed) healthy control cohort, total levels of HMGB1 detected were very low (1.4, 0.8-2.2 ng/ml). Total HMGB1 serum levels were significantly higher in asbestos-exposed individuals (10.2, 5.7-12.1 ng/ml) compared to the levels in unexposed controls (P<0.001). MM patients had the highest levels of total HMGB1 (25.0, 15.7-36.6 ng/ml) when compared to either other group (P<0.001) (
[0212] The sensitivity and specificity of total and hyper-acetylated HMGB1 as potential biomarkers to discriminate MM patients from asbestos-exposed individuals and healthy controls were assessed. Both, total and hyper-acetylated HMGB1, showed exceptional accuracy in discriminating MM patients from healthy controls with a receiver operating characteristic (ROC) area under the curve (AUC) of 0.999 (95% CI 0.994-1.000) and 1.000 (95% CI 1.000-1.000), respectively. Comparing asbestos-exposed individuals to healthy controls, the AUC of total and hyper-acetylated HMGB1 were 0.964 (95% CI 0.893-1.000) and 0.574 (95% CI 0.392-0.756), respectively (
TABLE-US-00029 TABLE 8 AUC of total and hyper-acetylated HMGB1 comparing healthy controls, asbestos-exposed individuals, and MM patients. Total HMGB1 Hyper-acetylated HMGB1 AUC Cut-off AUC Cut-off (95% CI) (ng/ml) (95% CI) (ng/ml) MM vs. 0.999 (0.994-1.000) 3.00 1.000 (1.000-1.000) 1.50 Healthy Asbestos- 0.964 (0.893-1.000) 3.05 0.574 (0.392-0.756) 0.45 exposed vs. Healthy MM vs. 0.830 (0.687-0.972) 15.75 1.000 (1.000-1.000) 2.00 Asbestos- exposed
TABLE-US-00030 TABLE 9 Full demographic characterization of individuals involved in the study. Hyper- Professional Total acetylated Asbestos Pleura1 HMGB1 HMGB1 Fibulin-3 OPN MRP ID Age Sex Smoking Exposure Cancer Stage Effusions (ng/mL) (ng/mL) (ng/mL) (ng/mL) (ng/mL) H1 38 M NO NO NO NO 1.1 0.5 H2 42 F NO NO NO NO 2.6 0.6 H3 21 M NO NO NO NO 1.9 0.3 H4 36 F NO NO NO NO 0.8 0.7 H5 44 M NO NO NO NO 2.3 0.8 H6 26 M NO NO NO NO 0.87 0.4 H7 56 F NO NO NO NO 0.81 0.1 H8 27 M NO NO NO NO 1.78 0.1 H9 37 M NO NO NO NO 0.32 0.2 H10 41 M NO NO NO NO 2.01 0.5 H11 49 M NO NO NO NO 2.29 0.9 H12 41 M NO NO NO NO 0.62 0.7 H13 25 F NO NO NO NO 1.41 0.6 H14 64 F NO NO NO NO 1.32 0.4 H15 29 F NO NO NO NO 1.76 0.3 H16 47 M NO NO NO NO 1.32 0.2 H17 23 F NO NO NO NO 1.98 0.6 H18 49 M NO NO NO NO 1.23 0.3 H19 41 M NO NO NO NO 2.36 0.5 H20 33 F NO NO NO NO 1.41 0.7 Asb 1 42 M YES <20 years NO NO 11.1 0.4 21.4756 34.96 12.50882 Asb 2 56 M YES 20 years NO NO 15.7 0.2 13.2877 21.399725 23.8244 Asb 3 49 M NO <20 years NO NO 4.9 0.3 40.1556 53.95 16.31582 Asb 4 65 M YES 20 years NO NO 13.8 0.4 51.8484 17.590575 18.53108 Asb 5 47 M NO 20 years NO NO 11.4 0.6 22.8123 17.49605 19.13404 Asb 6 56 M YES 20 years NO NO 6.4 0.1 18.5905 37.324 17.02064 Asb 7 62 M YES 20 years NO NO 3.5 0.8 14.6779 35.54375 9.52488 Asb 8 52 M NO 20 years NO NO 9.9 0.1 21.123 8.80555 11.65856 Asb 9 44 M YES 20 years NO NO 12.5 0.1 16.8203 44.3125 30.5134 Asb 10 56 M NO 20 years NO NO 5.6 0.3 17.8959 29.4095 29.0932 Asb 11 58 M NO 20 years NO NO 10.4 0.3 25.5682 56.24175 16.6412 Asb 12 55 M YES 20 years NO NO 11.7 1.9 15.004 12.75392 15.82444 Asb 13 53 M YES <20 years NO NO 14.2 0.6 56.3542 27.009 13.547 Asb 14 70 M YES 20 years NO NO 8.3 0.4 5.25956 3.9168 19.66094 Asb 15 56 M YES 20 years NO NO 10.5 0.2 2.8734 36.77525 16.3464 Asb 16 63 M YES 20 years NO NO 13.6 1.2 18.9485 2.669475 10.44004 Asb 17 55 M NO <20 years NO NO 3.8 0.3 6.12838 35.12675 9.04916 Asb 18 65 M NO 20 years NO NO 1.1 0.7 7.69722 10.9303 21.813 Asb 19 42 M YES <20 years NO NO 6.4 0.3 3.31255 28.37825 17.5944 Asb 20 70 M YES 20 years NO NO 5.7 0.4 3.00255 46.46775 9.05864 MM 1 61 F NO <20 years MM 3 YES 59.9 39.8 46.2541 54.55 44.1934 MM 2 66 F NO <20 years MM 3 YES 16.4 12.4 88.1786 76.4015 58.9668 MM 3 50 F YES NO MM 4 YES 23.2 16.3 151.144 70.12875 108.1566 MM 4 58 F YES <20 years MM 3 YES 16.6 10.7 111.936 77.84725 141.83 MM 5 76 M YES <20 years MM 2 YES 36.1 21.9 49.8787 119.8525 45.6438 MM 6 71 M YES <20 years MM 3 YES 63.4 40.2 36.7745 409.495 192.2712 MM 7 73 F YES <20 years MM 2 YES 26.1 17.4 41.5634 56.46175 29.5894 MM 8 80 M NO <20 years MM 3 YES 11.4 6.1 83.8305 155.24525 22.6902 MM 9 81 M YES <20 years MM 2 YES 45.7 27.9 37.3635 150.93375 34.05 MM 10 73 M 20 years MM 3 YES 7.8 5.9 56.2035 75.0035 92.116 MM 11 64 M YES <20 years MM 3 YES 36.6 20.7 128.071 139.99275 220.984 MM 12 55 M NO <20 years MM 2 YES 44.1 26.8 38.8566 44.186 17.80812 MM 13 59 M YES 20 years MM 1 YES 36.3 20.9 87.6252 33.795 25.8422 MM 14 25 F NO NO MM 3 YES 23.9 17.3 200.554 84.887 59.3842 MM 15 89 M NO 20 years MM 1 YES 3.6 2.4 60.8523 95.50625 30.8464 MM 16 77 M YES 20 years MM 2 YES 27.3 19.7 119.358 172.11375 27.619 MM 17 75 M YES 20 years MM 1 YES 27.8 18.7 101.575 60.24375 42.1062 MM 18 59 M YES <20 years MM 2 YES 15.8 10.3 45.0645 45.1065 66.6734 MM 19 74 M YES <20 years MM 3 YES 55.6 30.4 59.2125 106.4402 43.5086 MM 20 56 M NO MM 3 YES 15.7 13.3 240.10325 240.10325 106.305 MM 21 65 F NO MM 3 YES 3.4 3.2 145.10725 145.10725 174.222 MM 22 65 M YES MM 4 YES 2.6 2.1 164.38425 164.38425 12.8443 Ben 1 M 67 YES NO YES 6.5 5.2 63.3642 97.84775 16.4524 Ben 2 F 78 NO YES 10.4 8.1 39.4971 255.8175 102.003 Mal 1 F 82 YES LYMPHOMA YES 12.6 11.3 41.9381 56.72775 34.028 Mal 2 M 86 NO LYMPHOMA YES 6.9 5.9 9.08033 99.64375 30.1432 Mal 3 M 18 NO NSCLC YES 1.5 1.1 0.2 69.33175 8.47577 Ben 3 F 43 NO NO YES 12.8 10.6 22.2148 75.675 10.4681 Ben 4 M 74 YES NO YES 10.6 8.9 21.2225 74.47075 21.3811 Mal 4 M 65 NO NSCLC YES 3.4 2.9 8.67527 121.3458 38.209 Ben 5 F 47 NO NO YES 4.8 3.9 30.4874 105.444 28.4325 Ben 6 M 84 YES NO YES 8.9 7.5 23.8493 56.364 35.5268 Ben 7 M 66 YES NO YES 6.4 5.1 39.0355 137.0808 25.9947 Ben 8 M 63 YES NO YES 3.3 2.6 40.6437 65.47375 21.3165 Ben 9 M 67 YES NO YES 5.5 4.1 18.6413 57.0265 23.9214 Ben 10 F 73 YES NO YES 6.4 5.7 2.4003 63.373 20.7841 Mal 5 M 65 YES NSCLC YES 17.8 15.7 15.1932 148.5098 22.1066 Ben 11 F 93 NO NO YES 8.7 6.9 53.3543 51.13475 20.9697 Ben 12 F 60 YES NO YES 4.5 3.4 26.2048 126.5385 18.7316 Ben 13 M 59 NO NO YES 3.4 2.9 19.0393 96.8095 49.0096 Mal 6 F 68 BREAST YES 6.6 5.7 9.27292 81.02375 27.3833 Mal 7 F 40 NO BREAST YES 1.4 1.3 63.2857 431.475 215.512 Mal 8 F 45 CHOLANGIO YES 7.7 5.9 64.4723 433.8425 23.0554 Mal 9 M 75 NO MELANOMA YES 5.1 4.2 23.0104 195.906 78.7056 Mal 10 M 62 NO NSCLC YES 10.2 9.1 32.9417 137.4518 26.3117 Mal 11 M 66 YES SCLC YES 12.4 11.6 56.1929 229.431 41.0153 Mal 12 F 77 YES NSCLC YES 5.1 4.8 25.2506 214.0833 31.3136 Mal 13 F 85 NO SARCOMA YES 6.7 5.4 22.7689 51.42775 26.1407 Mal 14 M 86 NO LYMPHOMA YES 2.3 1.9 11.4095 78.43475 25.5605 Mal 15 F 78 YES NSCLC YES 3.8 2.5 18.5142 66.14925 16.9944 Mal 16 F 79 NO NSCLC YES 9.8 7.9 0.2 59.29125 4.389 Mal 17 M 56 NO NSCLC YES 4.5 3.7 14.6286 31.606 22.6945 Mal 18 M 67 YES NSCLC YES 7.5 6.4 2.20185 82.04775 8.40764 Mal 19 M 49 NO SFTP YES 6.7 5.4 0.29129 53.919 32.2524 Mal 20 F 87 NO LYMPHOMA YES 8.7 6.4 15.7883 88.08575 10.9371 Mal 21 M 50 SARCOMA YES 11.3 9.1 1.44303 129.4805 19.6771 Mal 22 F 61 NO UNKNOWN YES 2.3 1.7 2.464 183.872 15.0376 Mal 23 F 63 NO BREAST YES 10.6 8.5 0.2 32.558 4.20473 Mal 24 F 67 NO PANCREAS YES 6.7 5.7 39.7719 155.856 27.5158 Mal 25 M 78 YES EMCa YES 5.9 4.7 0.2 93.71525 3.41595 Abbreviations for Table 8: H: healthy individuals Asb: asbestos-exposed individuals MM: malignant mesothelioma patients Ben: patients with benign pleural effusions Mal: patients with malign non-MM pleural effusions NSCLC: non-small cell lung carcinoma SCLC: small cell lung carcinoma SFTP: solitary fibrous tumor of the pleura EMCa: epithelial-myoepithelial carcinoma
[0213] Comparing MM patients and asbestos-exposed individuals, the AUC of total HMGB1 was 0.830 (95% CI 0.687-0.972). At specificity 100%, the sensitivity was 72.73% (for values>15.75 ng/ml, which also corresponded to the cut-off value); at sensitivity 100%, the specificity was 5%. (
[0214] The differences in serum levels of total HMGB1 and hyper-acetylated HMGB1 in MM patients in their early stage (Stage I-II) and late stage (Stage III-IV) were measured (
[0215] As such, measurement of serum levels of hyper-acetylated HMGB1 and total HMGB1 in accordance with kits and/or methods of some embodiments herein can be useful for early detection of MM among asbestos-exposed cohorts.
Example 10: Discriminating MM Patients and Patients with Pleural Effusions Due to Other Causes
[0216] Total and hyper-acetylated HMGB1 in MM patients and patients with pleural effusions due to other causes were measured. Additionally, sensitivity and specificity of total and hyper-acetylated HMGB1 were measured to discriminate MM patients from patients with pleural effusions due to other causes.
[0217] Thirteen serum samples from patients with cytologically benign pleural effusions and 25 serum samples from patients with pleural effusions due to non-MM malignancy were available for these studies. MM patients had significantly higher levels of total HMGB1 compared to patients with cytologically benign pleural effusions (6.4, 4.7-9.7 ng/ml; P<0.001) and malignant (non-MM) pleural effusions (6.7, 4.2-10.0 ng/ml; P<0.001) (
[0218] The sensitivity and specificity of total and hyper-acetylated HMGB1 to discriminate MM patients from patients with pleural effusions due to other causes were also assessed. The AUC of total HMGB1 was 0.860 (95% CI 0.736-0.984) (
[0219] Very low levels of hyper-acetylated HMGB1 (<2.00 ng/ml) were found both in asbestos-exposed individuals and healthy controls.
Example 11: Levels of Other Possible MM Biomarkers
[0220] The levels of three additional possible MM biomarkers (fibulin-3, mesothelin, and OPN) from the same asbestos-exposed individuals and MM patients were measured and compared to total and hyper-acetylated HMGB1. All three biomarkers were significantly higher in MM patients than those in the asbestos-exposed individuals (P<0.001) (
TABLE-US-00031 TABLE 10 Levels of additional biomarkers in studied cohorts Fibulin-3, ng/ml OPN, ng/ml Mesothelin, ng/ml (median, (median, (median, 1.sup.st quartile-3.sup.rd 1.sup.st quartile-3.sup.rd 1.sup.st quartile-3.sup.rd quartile) quartile) quartile) Asbestos- 17.36, 6.91-22.14 28.89, 15.12-37.05 16.49, 12.08-19.40 exposed MM 85.73, 46.25-128.07 90.20, 60.24-150.93 44.92, 29.59-06.31 Benign 26.20, 20.13-40.07 75.68, 60.20-115.99 21.38, 19.76-31.98 Pleural Effusion Malignant 14.63, 1.82-29.10 93.71, 62.72-169.86 25.56, 12.99-31.78 (non-MM) Pleural Effusion
[0221] The levels of all three biomarkers (fibulin-3, mesothelin, and OPN) were also measured and compared in MM patients to patients with pleural effusions due to other causes. The levels of fibulin-3 were significantly higher in MM patients than those in patients with either benign pleural effusion or malignant non-MM effusion (P<0.001) (
[0222] Accordingly, measurement of hyper-acetylated HMGB1 in accordance with methods and/or kits of some embodiments herein discriminates subjects with MM from subject with pleural effusions with a greater degree of sensitivity and specificity than fibulin-3, mesothelin, and/or OPN.
[0223] While various aspects and embodiments have been disclosed herein, other aspects and embodiments will be apparent to those skilled in the art. The various aspects and embodiments disclosed herein are for purposes of illustration and are not intended to be limiting, with the true scope and spirit being indicated by the following claims. One skilled in the art will appreciate that, for this and other processes and methods disclosed herein, the functions performed in the processes and methods can be implemented in differing order. Furthermore, the outlined steps and operations are only provided as examples, and some of the steps and operations can be optional, combined into fewer steps and operations, or expanded into additional steps and operations without detracting from the essence of the disclosed embodiments.
[0224] While various aspects and embodiments have been disclosed herein, other aspects and embodiments will be apparent to those skilled in the art. The various aspects and embodiments disclosed herein are for purposes of illustration and are not intended to be limiting, with the true scope and spirit being indicated by the following claims.
[0225] With respect to the use of substantially any plural and/or singular terms herein, those having skill in the art can translate from the plural to the singular and/or from the singular to the plural as is appropriate to the context and/or application. The various singular/plural permutations may be expressly set forth herein for sake of clarity.
[0226] It will be understood by those within the art that, in general, terms used herein, and especially in the appended claims (e.g., bodies of the appended claims) are generally intended as open terms (e.g., the term including should be interpreted as including but not limited to, the term having should be interpreted as having at least, the term includes should be interpreted as includes but is not limited to, etc.). It will be further understood by those within the art that if a specific number of an introduced claim recitation is intended, such an intent will be explicitly recited in the claim, and in the absence of such recitation no such intent is present. For example, as an aid to understanding, the following appended claims may contain usage of the introductory phrases at least one and one or more to introduce claim recitations. However, the use of such phrases should not be construed to imply that the introduction of a claim recitation by the indefinite articles a or an limits any particular claim containing such introduced claim recitation to embodiments containing only one such recitation, even when the same claim includes the introductory phrases one or more or at least one and indefinite articles such as a or an (e.g., a and/or an should be interpreted to mean at least one or one or more); the same holds true for the use of definite articles used to introduce claim recitations. In addition, even if a specific number of an introduced claim recitation is explicitly recited, those skilled in the art will recognize that such recitation should be interpreted to mean at least the recited number (e.g., the bare recitation of two recitations, without other modifiers, means at least two recitations, or two or more recitations). Furthermore, in those instances where a convention analogous to at least one of A, B, and C, etc. is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (e.g., a system having at least one of A, B, and C would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). In those instances where a convention analogous to at least one of A, B, or C, etc. is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (e.g., a system having at least one of A, B, or C would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). It will be further understood by those within the art that virtually any disjunctive word and/or phrase presenting two or more alternative terms, whether in the description, claims, or drawings, should be understood to contemplate the possibilities of including one of the terms, either of the terms, or both terms. For example, the phrase A or B will be understood to include the possibilities of A or B or A and B.
[0227] In addition, where features or aspects of the disclosure are described in terms of Markush groups, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the Markush group.
[0228] As will be understood by one skilled in the art, for any and all purposes, such as in terms of providing a written description, all ranges disclosed herein also encompass any and all possible subranges and combinations of subranges thereof. Any listed range can be easily recognized as sufficiently describing and enabling the same range being broken down into at least equal halves, thirds, quarters, fifths, tenths, etc. As a non-limiting example, each range discussed herein can be readily broken down into a lower third, middle third and upper third, etc. As will also be understood by one skilled in the art all language such as up to, at least, and the like include the number recited and refer to ranges which can be subsequently broken down into subranges as discussed above. Finally, as will be understood by one skilled in the art, a range includes each individual member. Thus, for example, a group having 1-3 cells refers to groups having 1, 2, or 3 cells. Similarly, a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.
[0229] From the foregoing, it will be appreciated that various embodiments of the present disclosure have been described herein for purposes of illustration, and that various modifications may be made without departing from the scope and spirit of the present disclosure. Accordingly, the various embodiments disclosed herein are not intended to be limiting, with the true scope and spirit being indicated by the following claims.