RECOMBINANT FSH COMPOSITION FOR TREATMENT OF INFERTILITY

20200353053 ยท 2020-11-12

Assignee

Inventors

Cpc classification

International classification

Abstract

Preparations including FSH, for example recombinant FSH, for use in the treatment of infertility.

Claims

1-19. (canceled)

20. A method of treating infertility, comprising administering a follicle stimulating hormone (FSH) composition at a dose of or equivalent to from 9 to 24 g FSH to a patient identified prior to treatment as having variant Ser/Ser at position 680 of the FSH receptor

21. The method of claim 20, wherein the patient is identified prior to treatment as having a serum AMH level of 15.0 to 44.9 pmol/L.

22. The method of claim 20, wherein the method comprises daily administration of the FSH composition.

23. The method of claim 20, wherein the method further comprises, prior to administering the FSH composition, identifying the patient as having variant Ser/Ser at position 680 of the FSH receptor.

24. The method of claim 20, wherein the method comprises administering the FSH composition at a dose of or equivalent to from greater than 12 to 24 g FSH.

25. The method of claim 20, wherein the FSH composition is administered starting on day one of treatment and continuing for from six to sixteen days.

25. The method of claim 20, wherein the FSH is recombinant FSH.

26. The method of claim 20, wherein the FSH is recombinant FSH that includes 2,3-sialylation and 2,6-sialylation.

27. The method of claim 20, wherein the FSH is recombinant FSH that includes 2,3-sialylation and 2,6-sialylation, wherein from 1 to 99% of the total sialylation is 2,6-sialylation and from 99% to 1% of the total sialylation is 2,3-sialylation.

28. The method of claim 20, wherein the FSH is recombinant FSH that includes 2,3-sialylation and 2,6-sialylation, wherein from 1 to 50% of the total sialylation is 2,6-sialylation and from 50% to 99% of the total sialylation is 2,3-sialylation.

29. A method of treating infertility, comprising administering a follicle stimulating hormone (FSH) composition at a dose of or equivalent to from 10 to 12 g FSH to a patient identified prior to treatment as having variant Asn/Asn or variant Asn/Ser at position 680 of the FSH receptor.

30. The method of claim 29, wherein the patient is identified prior to treatment as having a serum AMH level of 15.0 to 44.9 pmol/L.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0067] The present invention will now be described in more detail with reference to the attached drawings in which:

[0068] FIG. 1 shows a plasmid map of the pFSHalpha/beta expression vector;

[0069] FIG. 2 shows the 2,3-sialyltransferase (ST3GAL4) expression vector;

[0070] FIG. 3 shows the 2,6-sialyltransferase (ST6GAL1) expression vector;

[0071] FIG. 4 is a schematic diagram of the FSH Receptor, indicating the position of polymorphisms at amino acid positions 307 and 680 of exon 10, and position 29 in the promoter;

[0072] FIG. 5 shows the distribution of SNP Haplotypes at the FSH receptor gene for the 222 patients treated with FSH in the study of Example 8;

[0073] FIG. 6 is a table of results showing, for the full analysis set, the observed duration of gonadotropin (FSH) treatment (days) and total gonadotropin (FSH) dose delivered (g) to patients/subjects having AMH <15 pmol/L in each of the three distinct FSH receptor genotypes with regard to position 680: Asn/Asn, Asn/Ser and Ser/Ser; and

[0074] FIG. 7 is a table of results showing, for the full analysis set, the expected duration of gonadotropin (FSH) treatment (days) delivered to patients/subjects having AMH <15 pmol/L in each of the three distinct FSH receptor genotypes with regard to position 680: Asn/Asn, Asn/Ser and Ser/Ser, adjusted for dose.

Sequence Selection

Human FSH

[0075] The coding region of the gene for the FSH alpha polypeptide was used to according to Fiddes and Goodman. (1981). The sequence is banked as AH007338 and at the time of construction there were no other variants of this protein sequence. The sequence is referred herein as SEQ ID NO:1.

[0076] The coding region of the gene for FSH beta polypeptide was used according to Keene et al (1989). The sequence is banked as NM_000510 and at the time of construction there were no other variants of this protein sequence. The sequence is referred herein as SEQ ID NO: 2

Sialyltransferase

[0077] 2,3-SialyltransferaseThe coding region of the gene for beta-galactoside alpha-2,3-sialyltransferase 4 (2,3-sialyltransferase, ST3GAL4) was used according to Kitagawa and Paulson (1994). The sequence is banked as L23767 and referred herein as SEQ ID NO: 3.

[0078] 2,6-SialyltransferaseThe coding region of the gene for beta-galactosamide alpha-2,6-sialyltransferase 1 (2,6-sialyltransferase, ST6GAL1) was used according to Grundmann et al. (1990). The sequence is banked as NM_003032 and referred herein as SEQ ID NO: 4.

EXAMPLES

Example 1 Construction of the FSH Expression Vector

[0079] The coding sequence of FSH alpha polypeptide (AH007338, SEQ ID NO: 1) and FSH beta polypeptide (NM_003032, SEQ ID NO: 2) were amplified by PCR using the primer combinations FSHa-fw and FSHa-rev and FSHb-fw and FSHb-rec respectively.

TABLE-US-00001 FSHa-fw (SEQIDNO:9) 5-CCAGGATCCGCCACCATGGATTACTACAGAAAAATATGC-3 FSHa-rev (SEQIDNO:10) 5-GGATGGCTAGCTTAAGATTTGTGATAATAAC-3 FSHb-fw (SEQIDNO:11) 5-CCAGGCGCGCCACCATGAAGACACTCCAGTTTTTC-3 FSHb-rev (SEQIDNO:12) 5-CCGGGTTAACTTATTATTCTTTCATTTCACCAAAGG-3

[0080] The resulting amplified FSH beta DNA was digested with the restriction enzymes AscI and HpaI and inserted into the AscI and HpaI sites on the CMV driven mammalian expression vector carrying a neomycin selection marker. Similarly the FSH alpha DNA was digested with BamHI and NheI and inserted into the sites BamHI and NheI on the expression vector already containing the FSH beta polypeptide DNA.

[0081] The vector DNA was used to transform the DH5 strain of E. coli. Colonies were picked for amplification. Colonies containing the vector containing both FSH alpha and beta were selected for sequencing and all contained the correct sequences according to SEQ ID NO: 1 and SEQ ID NO: 2. Plasmid pFSH A+B#17 was selected for transfection (FIG. 1).

Example 2 Construction of the ST3 Expression Vector

[0082] The coding sequence of beta-galactoside alpha-2,3-sialyltransferase 4 (ST3, L23767, SEQ ID NO: 3) was amplified by PCR using the primer combination 2,3STfw and 2,3STrev.

TABLE-US-00002 2,3STfw (SEQIDNO:13) 5-CCAGGATCCGCCACCATGTGTCCTGCAGGCTGGAAGC-3 2,3STrev (SEQIDNO:14) 5-TTTTTTTCTTAAGTCAGAAGGACGTGAGGTTCTTG-3

[0083] The resulting amplified ST3 DNA was digested with the restriction enzymes BamHI and AflII and inserted into the BamHI and AflII sites on the CMV driven mammalian expression vector carrying a hygromycin resistance marker. The vector was amplified as previously described and sequenced. Clone pST3#1 (FIG. 2) contained the correct sequence according SEQ ID NO: 3 and was selected for transfection.

Example 3 Construction of the ST6 Expression Vector

[0084] The coding sequence of beta-galactosamide alpha-2,6-sialyltransferase 1 (ST6, NM_003032, SEQ ID NO: 4) was amplified by PCR using the primer combination 2,6STfw and 2,6STrev.

TABLE-US-00003 2,6STfw (SEQIDNO:15) 5-CCAGGATCCGCCACCATGATTCACACCAACCTGAAG-3 2,6STrev (SEQIDNO:16) 5-TTTTTTTCTTAAGTTAGCAGTGAATGGTCCGG-3

[0085] The resulting amplified ST6 DNA was digested with the restriction enzymes BamHI and AflII and inserted into the BamHI and AflII sites on the CMV driven mammalian expression vector carrying a hygromycin resistance marker. The vector was amplified as previously described and sequenced. Clone pST6#11 (FIG. 3) contained the correct sequence according SEQ ID NO: 4 and was selected for transfection.

Example 4 Stable Expression of pFSH + in PER.C6 cells. Transfection Isolation and Screening of Clones.

[0086] PER.C6clones producing FSH were generated by expressing both polypeptide chains of FSH from a single plasmid (see Example 1).

[0087] To obtain stable clones a liposome based transfection agent with the pFSH + construct. Stable clones were selected in VPRO supplemented with 10% FCS and containing G418. Three weeks after transfection G418 resistant clones grew out. Clones were selected for isolation. The isolated clones were cultured in selection medium until 70-80% confluent. Supernatants were assayed for FSH protein content using an FSH selective ELISA and pharmacological activity at the FSH receptor in cloned cell line, using a cAMP accumulation assay. Clones expressing functional protein were progressed for culture expansion to 24 well, 6 well and T80 flasks.

[0088] Studies to determine productivity and quality of the material from seven clones were initiated in T80 flasks to generate sufficient material. Cells were cultured in supplemented media as previously described for 7 days and the supernatant harvested. Productivity was determined using the FSH selective ELISA. The isoelectric profile of the material was determined by Isoelectric focusing (IEF), by methods known in the art. Clones with sufficient productivity and quality were selected for sialyltransferase engineering.

Example 5 Level of sialylation is increased in cells that over express 2,3-sialyltransferase. Stable expression of pST3 in FSH expressing PER.C6 cells; Transfection isolation and screening of clones.

[0089] PER.C6 clones producing highly sialylated FSH were generated by expressing 2,3 sialyltransferase from separate plasmids (Example 2) in PER.C6 cells already expressing both polypeptide chains of FSH (from Example 4). Clones produced from PER.C6 cells as set out in Example 4 were selected for their characteristics including productivity, good growth profile, production of functional protein, and produced FSH which included some sialylation. Stable clones were generated as previously described in Example 4. Clones were isolated, expanded and assayed. The 2,3-sialyltransferase clones were adapted to serum free media and suspension conditions.

[0090] As before, clones were assayed using a FSH selective ELISA, functional response in an FSH receptor cell line, IEF, metabolic clearance rate and Steelman Pohley analysis. Results were compared to a commercially available recombinant FSH (Gonal-f, Serono) and the parental FSH PER.C6cell lines. FSH produced by most of the clones has significantly improved sialylation (i.e. on average more FSH isoforms with high numbers of sialic acids) compared to FSH expressed without 2,3- sialyltransferase. In conclusion expression of FSH together with sialyltransferase in PER.C6cells resulted in increased levels of sialylated FSH compared to cells expressing FSH only.

Example 6 Production and Purification Overview

[0091] A procedure was developed to produce FSH in PER.C6cells that were cultured in suspension in serum free medium. The procedure is described below and was applied to several FSH-producing PER.C6cell lines.

[0092] FSH from 2,3-clone (Example 5) was prepared using a using a modification of the method described by Lowry et al. (1976).

[0093] For the production of PER.C6-FSH, the cell lines were adapted to a serum-free medium, i.e., Excell 525 (JRH Biosciences). The cells were first cultured to form a 70%-90% confluent monolayer in a T80 culture flask. On passage the cells were re-suspended in the serum free medium, Excell 525+4 mM L-Glutamine, to a cell density of 0.310.sup.6 cells/ml. A 25 ml cell suspension was put in a 250 ml shaker flask and shaken at 100 rpm at 37 C. at 5% CO.sub.2. After reaching a cell density of >110.sup.6 cells/ml, the cells were sub-cultured to a cell density of 0.2 or 0.310.sup.6 cells/ml and further cultured in shaker flasks at 37 C., 5% CO.sub.2 and 100 rpm.

[0094] For the production of FSH, the cells were transferred to a serum-free production medium, i.e., VPRO (JRH Biosciences), which supports the growth of PER.C6cells to very high cell densities (usually >10.sup.7 cells/ml in a batch culture). The cells were first cultured to >110.sup.6 cells/ml in Excell 525, then spun down for 5 min at 1000 rpm and subsequently suspended in VPRO medium+6 mM L-glutamine to a density of 110.sup.6 cells/ml. The cells were then cultured in a shaker flask for 7-10 days at 37 C., 5% CO.sub.2 and 100 rpm. During this period, the cells grew to a density of >10.sup.7 cells/ml. The culture medium was harvested after the cell viability started to decline. The cells were spun down for 5 min at 1000 rpm and the supernatant was used for the quantification and purification of FSH. The concentration of FSH was determined using ELISA (DRG EIA 1288).

[0095] Thereafter, purification of FSH was carried out using a modification of the method described by Lowry et al. (1976). Purification using charge selective chromatography was carried out to enrich the highly sialylated forms by methods well known in the art.

[0096] During all chromatographic procedures, enrichment of the sialylated forms of FSH as claimed herein was confirmed by RIA (DRG EIA 1288) and/or IEF.

Example 7 Quantification of Relative Amounts of 2,3 and 2,6 Sialic Acid

[0097] The relative percentage amounts of 2,3 and 2,6 sialic acid on purified rFSH (Example 6) were measured using known techniques.

[0098] N-Glycans were released from the samples using PNGase F under denaturative conditions and then labelled with 2-aminobenzamide. Released glycan forms were then separated and analysed by Weak Anion Exchange (WAX) column for determination of charge distribution. Labelled glycans treated with 2,3,6,8 sialidase for determination of total sialic acid and 2,3 sialidase for determination of 2,3 sialic acid, were further analyzed by wax column.

[0099] The relative percentages of the charged glycans were calculated from structures present in the undigested and digested glycan pools and are shown in FIG. 4 (for 8 samples). These were found to be in the ranges 50%-95% (e.g. about 80% to 90%) for 2,3 sialylation and 5% to 50%, generally about 10 to 20% (or about 31% or 35%), for 2,6 sialylation.

Example 8A multiple dose study investigating FE 999049 in comparison to GONAL-F.

[0100] The following describes a randomised, controlled, assessor-blind, parallel groups, multinational, multicentre trial assessing the dose-response relationship of FE 999049 in patients undergoing controlled ovarian stimulation for in vitro fertilisation (IVF)/intracytoplasmic sperm injection (ICSI). The patient population was 265 IVF patients aged between 18 to 37 years, with BMI 18.5 to 32.0 kg/m.sup.2.

[0101] The trial was designed as a dose-response trial with number of oocytes retrieved as the primary endpoint. Secondary endpoints will explore the qualitative and quantitative impact of different doses of FE 999049 with regard to endocrine profile, follicular development, oocyte fertilisation, embryo quality and treatment efficiency (i.e. total gonadotropin consumption and duration of stimulation). The trial is designed to evaluate the efficacy of FE 999049 to establish pregnancy when used in controlled ovarian stimulation for IVF/ICSI cycles.

[0102] Subjects were assessed within 3 months prior to randomisation for compliance with the inclusion and exclusion criteria, including an anti-Mllerian hormone (AMH) assessment to increase homogeneity of the trial population in relation to ovarian response and minimise the number of potential poor and hyper-responders to the FE 999049 doses and GONAL-F dose used in the trial. The AMH assessment was measured using the AMH Gen-II enzyme linked immunosorbent assay kit (Beckman Coulter, Inc., Webster, Tex.). This assay can detect AMH concentrations greater than 0.57 pmol/L with a minimum limit of quantitation of 1.1 pmol/L.

[0103] On day 2-3 of their menstrual cycle, subjects were randomised in a 1:1:1:1:1:1 fashion to treatment with either 90 IU, 120 IU, 150 IU, 180 IU or 210 IU FE 999049 or 150 IU GONAL-F, and ovarian stimulation initiated. Randomisation was stratified according to AMH level at screening [5.0-14.9 pmol/L (low AMH) and 15.0 to 44.9 pmol/L (high AMH)).

[0104] Gonal-F is filled by mass (FbM) at FDA request; referring to g dose is therefore appropriate. The Gonal-F label indicates 600 IU/44 g, which indicates that 150 IU is 11 g. However, there is some variation and the batch certificate for this trial indicated that 11.3 g Gonal-F was equivalent to 150 IU. The FE999049 doses are presented by protein content (g) rather than biological activity. Thus the doses of FE999049 were 5.2 g (90 IU), 6.9 g (120 IU), 8.6 g (150 IU), 10.3 g (180 IU) or 12.1 g (210 IU).

[0105] The subject and dose distribution is set out as follows (data are number of subjects):

TABLE-US-00004 TABLE 1 GONAL-F FE 999049 11.3 (11) 5.2 g 6.9 g 8.6 g 10.3 g 12.1 g g Total Screened 334 Randomised 42 45 44 45 46 43 265 and exposed High AMH 23 26 24 24 26 25 148 strata (56%) (15.0-44.9 pmol/L) Low AMH 19 19 20 20 21 18 117 strata (44%) (5.0-14.9 pmol/L) Per-protocol 40 42 42 44 44 43 255

[0106] The daily dose level of FE 999049 or GONAL-F is fixed throughout the entire stimulation period. During stimulation, subjects are monitored on stimulation day 1, 4 and 6 and hereafter at least every second day. When 3 follicles of 15 mm are observed, visits are performed daily. Subjects are treated with FE 999049 or GONAL-F for a maximum of 16 days.

[0107] To prevent a premature LH surge, a GnRH antagonist (ganirelix acetate, ORGALUTRAN, MSD/Schering-Plough) may be initiated on stimulation day 6 at a daily dose of 0.25 mg and continued throughout the stimulation period. Triggering of final follicular maturation is done on the day when 3 follicles with a diameter 17 mm are observed. If there are <25 follicles with a diameter 12 mm, 250 g recombinant hCG (choriogonadotropin alfa, OVITRELLE, Merck Serono/EMD Serono) is administered. If there are 25-35 follicles with a diameter 12 mm, 0.2 mg GnRH agonist (triptorelin acetate, DECAPEPTYL/GONAPEPTYL, Ferring Pharmaceuticals) is administered. In case of excessive ovarian response, defined as >35 follicles with a diameter 12 mm, the treatment is cancelled. In case of poor ovarian response, defined as <3 follicles with a diameter 10 mm observed on stimulation day 10, the cycle could be cancelled.

[0108] Oocyte retrieval takes place 36 h (2 h) after triggering of final follicular maturation and the oocytes inseminated by IVF and/or ICSI. Fertilisation and embryo development are assessed from oocyte retrieval to the day of transfer. For subjects who underwent triggering of final follicular maturation with hCG, one blastocyst of the best quality available is transferred on day 5 after oocyte retrieval while remaining blastocysts are frozen. For subjects who undergo triggering of final follicular maturation with GnRH agonist, no embryo transfer takes place in the fresh cycle and blastocysts are instead frozen on day 5. Vaginal progesterone tablets (LUTINUS, Ferring Pharmaceuticals) 100 mg 3 times daily are provided for luteal phase support from the day after oocyte retrieval until the day of the clinical pregnancy visit. A hCG test is performed 13-15 days after embryo transfer and clinical pregnancy will be confirmed by transvaginal ultrasound (TVU) 5-6 weeks after embryo transfer.

Results

[0109] The number of oocytes retrieved (primary endpoint) is shown in the following Table.

TABLE-US-00005 TABLE 2 GONAL- FE 999049 F 11.3 5.2 g 6.9 g 8.6 g 10.3 g 12.1 g (11)g Oocytes retrieved All 5.2 (3.3) 7.9 (5.9) 9.2 (4.6) 10.6 (7.0) 12.2 (5.9) 10.4 (5.2) High 5.9 (3.9) 9.1 (6.4) 10.6 (4.8) 13.6 (7.8) 14.4 (5.8) 12.4 (5.4) AMH Low 4.5 (2.2) 6.3 (4.9) 7.4 (3.8) 6.9 (3.6) 9.4 (4.9) 7.8 (3.4) AMH Data are mean (SD)

[0110] The primary objective was met: a significant dose-response relationship was established for FE 999049 with respect to number of oocytes retrieved. This finding was observed not only for the overall trial population, but also for each of the two AMH strata used at randomisation. A significant dose-response for FE 999049 was demonstrated for all key objective pharmacodynamic parameters, e.g. estradiol, inhibin B and inhibin A. At a similar microgram dose level, the pharmacodynamic responses with FE 999049 were larger than with GONAL-F (these results not shown).

[0111] The serum FSH concentrations after exposure to FE 999049 were significantly higher than for GONAL-F. The results confirm that the PK profile of FE 999049 differs from that of GONAL-F. Fertilisation rates, blastocyst development and pregnancy rates in IVF/ICSI patients treated with FE 999049 were within expectations.

[0112] There were no safety concerns with the use of FE 999049. A good local tolerability was documented.

Further Analysis

[0113] The applicants have further analysed the data to identify the FE 999049 dose(s) that fulfil the following criteria with respect to number of oocytes retrieved: [0114] Oocytes retrieved in the range 8-14 [0115] Minimise proportion of patients with <8 oocytes [0116] Minimise proportion of patients with <4 or 20 oocytes

Low AMH Strata

[0117] As seen in Table 2, the dose of FE999049 which fulfilled the first criterion (Oocytes retrieved in the range 8-14) was 12.1 g (mean 9.4 oocytes retrieved). The distribution of oocytes is shown in Table 3 below.

[0118] As shown by the box and arrow, a dose of 12.1 g FE999049 provides retrieval of the most desirable number of oocytes in 60% of subjects in the low AMH group. This is a marked improvement on Gonal-F (most desirable number of oocytes in only 33% of subjects). There were no indications of early OHSS of a moderate or severe nature and there were no incidences of preventative action being required; there are no concerns associated with the dose of 12.1 g FE999049 in a patient having low AMH.

[0119] Thus the applicants have found that a dose of, or dose equivalent to, 6 to 24 g, for example 9 to 14 g, for example 12 g, human derived recombinant FSH is suitable for use in the treatment of infertility in a patient having serum AMH <15 pmol/L, for example 0.05-14.9 pmol/L for example 5.0-14.9 pmol/L. The dose provides an effective response while minimising risk of OHSS.

Exploratory Evaluation

[0120] As an exploratory evaluation, the present inventors investigated the contribution of FSH receptor polymorphism on ovarian response and treatment efficiency following stimulation with FE999049.

[0121] Genomic DNA from all patients in the trial was analysed for single nucleotide polymorphism (SNP) at positions 29, 307 and 680 of the FSH-R at the University of Modena and Reggio Emilia, Italy. FIG. 4 is a schematic diagram of the FSH Receptor, indicating the position of polymorphisms at amino acid positions 307 and 680 of exon 10, and position 29 in the promoter. This distribution of SNP FSH-R combinations is as follows: AA 7%, AG 35% and GG 58% for position 29; Thr/Thr 29%, Ala/Thr 54% and Ala/Ala 17% for position 307; and Asn/Asn 30%, Asn/Ser 53% and Ser/Ser 17% for position 680. FIG. 5 shows the distribution of SNP Haplotypes at the FSH receptor gene for the 222 patients treated with FSH in the study of Example 8. The distribution for each position and the overall combinations was not significantly different between the low AMH and high AMH strata.

[0122] The results of the clinical trial were further analysed to assess whether SNP had any effect on the duration of treatment and total dose required. This was done for the low AMH group and the high AMH group.

[0123] FSHR polymorphism was examined by PCR (Polymerase Chain Reaction) and RFLP (Restriction fragment length polymorphism) by methods known in the art. Women were classified as Asn/Asn, Asn/Ser, and Ser/Ser genotypes. The genetic analysis was described in the following overview protocol and the patients signed a special informed consent. The samples were taken as part of the other blood samples on stimulation day 1. They were measured at the University of Modena and Reggio Emilia.

Overview of Procedures used for SNP-analysis at the FSH Receptor Gene

General Procedures:

[0124] 1. Genomic DNA extraction (from blood using Nucleon Genomic DNA extraction kit, GE HEALTHCARE) [0125] 2. Operating procedures using nanodrop.

HRM Procedures:

[0126] SNPs genotyping by high resolution melting (HRM) methodology (using SsoFast EvaGreen Supermix cod enzyme. 172-5201, Bio-Rad; HSP-96 plates, cat. HSP9645, Bio-Rad; and CFX96 real-time thermal cycler Bio-Rad.)

Sequencing Procedures:

[0127] In case of doubt about HRM results, (after two independent HRM on the same samples), the following sequencing procedures are utilised: [0128] 1. PCR reaction and amplification. [0129] 2. PCR product purification. [0130] 3. Quantification of purified PCR. [0131] 4. Sequence reaction protocol. [0132] 5. Sequence product purification. [0133] 6. Capillary electrophoresis run by ABI PRISM 3130 instrument. [0134] 7. Assessment and validation of the results obtained by capillary electrophoresis sequencing with ABI PRISM 3100.

Results

[0135] FIG. 7 is a table of results showing, for the full analysis set, the expected duration of gonadotropin (FSH) treatment (days) delivered to patients/subjects having AMH <15 pmol/L in each of the three distinct FSH receptor genotypes with regard to position 680: Asn/Asn, Asn/Ser and Ser/Ser, adjusted for dose.

[0136] FIG. 7 shows that the expected mean duration of treatment required for stimulation of a patient having AMH level <15 pmol/L and variant Ser/ser is 9.59 days, which is about 1.5 days longer than that required for stimulation of a patient having AMH level <15 pmol/L and variant Asn/Asn (8.13 days), and about 1.3 days longer than that required for stimulation of a patient having AMH level <15 pmol/L and variant Ser/Asn (8.26 days).

[0137] As indicated above, success (in terms of pregnancy and/or live birth) is more likely if the patient has an adequate response (expected ovarian multifollicular development, rise in circulating 17--estradiol) occurring within an ideal treatment window. Success is further enhanced if the response is within the centre of this treatment window; that is, not too early in the window and not too late. Reduction of the duration of treatment in patients having low AMH and variant Ser/Ser at position 680 of the FSH receptor (by increasing the dose above 12 g) may bring the response towards the centre of the treatment window, with enhanced likelihood of success.

[0138] Accordingly, tailoring the dose to patients identified as having AMH level <15 pmol/L and variant Ser/Ser prior to treatment may be possible. Identification of patients having Ser/Ser prior to treatment may allow the starting dose to be increased in these patients, compared with those having Ser/Asn and Asn/Asn.

[0139] As set out above, a dose of 12.1 g FE999049 provides retrieval of the most desirable number of oocytes in 60% of subjects in the low AMH group (Table 3). The low AMH group shown in Table 3 included patients having variant Ser/Ser, as well as those having Ser/Asn and Asn/Asn. Administration of a higher starting dose (for example 9 to 24 pg, for example >12 to 24 g, e.g. 12.33 g or 13 g human derived recombinant) of FSH to patients having low AMH [AMH level <15 pmol/L, (e.g. 0.05 pmol/L to 14.9 pmol/L, e.g. 5.0 pmol/L to 14.9 pmol/L)], as well as having variant Ser/Ser at position 680 of the FSH receptor, may be advantageous because it may provide increased probability of success (in terms of pregnancy and/or live birth) and better predictability of success.

[0140] FIG. 7 shows that the mean duration of treatment required for stimulation of a patient having AMH level <15 pmol/L and variant Asn/Asn is 8.13 days, and that required for stimulation of a patient having AMH level <15 pmol/L and variant Ser/Asn is 8.26 days, about 1.5 to 1.3 days shorter than the duration for equivalent treatment of a patient having AMH level <15 pmol/L and variant Ser/Ser (9.59 days). Thus, identification of patients having AMH level <15 pmol/L and variant Ser/Asn and Asn/Asn prior to treatment may allow the starting dose for these patients to be reduced to less than 12 g FE 999049 , e.g. 10 to 12 g, or the duration of treatment to be reduced, while still providing a good response in terms of follicular development. This may provide a benefit in terms of cost of the pharmaceutical, and also in terms of reduction in risk associated with administration of a higher dose than is required for effect in these patients.

[0141] FIG. 6 is a table of results showing, for the full analysis set, the observed duration of gonadotropin (FSH) treatment (days) and total gonadotropin (FSH) dose delivered (g) to patients/subjects having AMH <15 pmol/L in each of the three distinct FSH receptor genotypes with regard to position 680: Asn/Asn, Asn/Ser and Ser/Ser. This confirms the effects shown in FIG. 7.

[0142] The results did not show this effect related to SNP in the high AMH population.

[0143] This allows tailoring of the dose of FSH in specific patients identified as having specific AMH level, and specific polymorphism at the FSHR.

Example 9Individualised COS Protocol (Low AMH)

[0144] The selected patients are about to undergo COS for in vitro fertilisation (IVF)/intracytoplasmic sperm injection (ICSI) by methods known in the art. The pre-treatment protocol includes assessment/screening of the patient's serum AMH using the AMH Gen-II enzyme linked immunosorbent assay kit (Beckman Coulter, Inc., Webster, Tex.). This assay can detect AMH concentrations greater than 0.57 pmol/L with a minimum limit of quantitation of 1.1 pmol/L. AMH may be measured using other Assay kits (e.g. available from Roche). The pre-treatment protocol includes identification of the allelic variant at position 680 of the FSH receptor following extraction of genomic DNA by methods well known in the art (e.g. by means of a kit for extraction of genomic DNA from blood, and subsequent DNA sequencing, as described in e.g. Gromoll et al, Methods, 21, 83-97 (2000), Simoni et al, Journal of Clinical Endocrinology and Metabolism, Vol 84, No. 2, 751-755 (1999), Falconer et al, Acta Obstet Gynecol Scand 2005: 84: 806-811 (2005), and references therein, or by a PCR and RFLP method such as that set out in Loutradis et al, Journal of Assisted Reproduction and Genetics, Vol. 23, No. 4, April 2006).

[0145] The COS protocol proceeds in the usual manner apart from administration of the initial dose of FE 999049 according to AMH level at screening. A patient with an AMH level of <15 pmol/L and variant Ser/Asn or Asn/Asn would be administered an initial daily dose of approximately 12 g FE 999049, a human derived recombinant FSH product manufactured according to the method of Example 6, or <12 g FE 999049 , e.g. 10 to 12 g, e.g. 11.33 g or 11.67 g, of the human derived recombinant FSH . A patient with an AMH level of <15 pmol/L and variant Ser/Ser would receive a higher initial daily dose greater than 12 g (e.g. 12.33 to 24 g, or 13-24 g of the human derived recombinant FSH.

References

[0146] Andersen C Y, Westergaard L G, and van Wely M. (2004). FSH isoform composition of commercial gonadotrophin preparations: a neglected aspect? Reprod Biomed Online. 9(2), 231-236.

[0147] Arey B J, Stevis P E, Deecher D C, Shen E S, Frail D E, Negro-Vilar A, and Lopez F J. (1997) Induction of promiscuous G protein coupling of the follicle-stimulating hormone (FSH) receptor: a novel mechanism for transducing pleiotropic actions of FSH isoforms. Mol Endocrinol. 11(5) 517-526.

[0148] Baenziger J U and Green E D. (1988). Pituitary glycoprotein hormone oligosaccharides: structure, synthesis and function of the asparagine-linked oligosaccharides on lutropin, follitropin and thyrotropin. Biochim Biophys Acta. 947(2), 287-306.

[0149] Bassett R M, and Driebergen R. (2005). Continued improvements in the quality and consistency of follitropin alfa, recombinant human FSH. Reprod Biomed Online. 10(2), 169-177.

[0150] Damin-Matsumura P, Zaga V, Maldonado A, Snchez-Hernndez C, Timossi C, and Ulloa-Aguirre A. (1999). Oestrogens regulate pituitary alpha2,3-sialyltransferase messenger ribonucleic acid levels in the female rat. J Mol Endocrinol. 23(2), 153-165.

[0151] D'Antonio M., Borrelli F., Datola A., Bucci R., Mascia M., Polletta P., Piscitelli D., and Papoian R. (1999) Biological characterization of recombinant human follicle stimulating hormone isoforms. Human Reproduction 14, 1160-1167

[0152] Dalpathado D S, Irungu J, Go E P, Butnev V Y, Norton K, Bousfield G R, and Desaire H. (2006). Comparative glycomics of the glycoprotein follicle stimulating hormone: glycopeptide analysis of isolates from two mammalian species. Biochemistry. 45(28), 8665-8673.

[0153] Dias J A, Van Roey P. (2001). Structural biology of human follitropin and its receptor. Arch Med Res. 32(6), 510-519

[0154] Fiddes, J. C. and Goodman, H. M. (1979) Isolation, cloning and sequence analysis of the cDNA for the alpha-subunit of human chorionic gonadotropin. Nature, 281, 351-356.

[0155] Flack, M. R., Bennet, A. P., Froehlich, J. Anasti, J N and Nisula, B. (1994). Increased biological activity due to basic isoforms in recombinant human follicle-stimulating hormone produced in a human cell line. J. Clin. Endocrinol. Metab., 79, 756-760

[0156] Fox K M, Dias J A, and Van Roey P. (2001). Three-dimensional structure of human follicle-stimulating hormone. Mol Endocrinol. 15(3), 378-89

[0157] Grabenhorst E, Hoffmann A, Nimtz M, Zettlmeissl G, and Conradt H S. (1995). Construction of stable BHK-21 cells coexpressing human secretory glycoproteins and human Gal(beta 1-4)GIcNAc-R alpha 2,6-sialyltransferase alpha 2,6-linked NeuAc is preferentially attached to the Gal(beta 1-4)GIcNAc(beta 1-2)Man(alpha 1-3)-branch of diantennary oligosaccharides from secreted recombinant beta-trace protein. Eur J Biochem. 232(3), 718-25.

[0158] Green E D and Baenziger J U. (1988). Asparagine-linked oligosaccharides on lutropin, follitropin, and thyrotropin. II. Distributions of sulfated and sialylated oligosaccharides on bovine, ovine, and human pituitary glycoprotein hormones. J Biol Chem. 263(1) 36-44.

[0159] Grundmann, U., Nerlich, C., Rein, T. and Zettlmeissl, G. (1990). Complete cDNA sequence encoding human beta-galactoside alpha-2,6-sialyltransferase. G Nucleic Acids Res. 18 (3), 667

[0160] Howles, C. M. (1996). Genetic engineering of human FSH (Gonal-F). Hum Reprod. Update, 2,172-191.

[0161] Kagawa Y, Takasaki S, Utsumi J, Hosoi K, Shimizu H, Kochibe N, and Kobata A. (1988). Comparative study of the asparagine-linked sugar chains of natural human interferon-beta 1 and recombinant human interferon-beta 1 produced by three different mammalian cells. J Biol Chem. 263(33), 17508-17515.

[0162] Keene, J. L., Matzuk, M. M., Otani, T., Fauser, B, C, J, M., Galway, A. B., Hsueh, A. J. W. and Boime, I. (1989). Expression of Biologically active Human Follitropin in Chinese Hamster Ovary Cells. The Journal of Biological Chemistry, 264(9) 4769-4775.

[0163] Kitagawa, H. and Paulson, J. C (1994) Cloning of a novel alpha 2,3-sialyltransferase that sialylates glycoprotein and glycolipid carbohydrate groups. J. Biol. Chem. 269(2), 1394-1401.

[0164] Lee E U, Roth J, and Paulson J C (1989) Alteration of terminal glycosylation sequences on N-linked oligosaccharides of Chinese hamster ovary cells by expression of beta-galactoside alpha 2,6-sialyltransferase. J Biol Chem. 264(23) 13848-13855.

[0165] de Leeuw, R., Mulders, J., Voortman, G. Rombout, F. Damm, J. and Kloosterboer, L. (1996) Structure-function relationship of recombinant follicle stimulating hormone (Puregon). Mol. Hum. Reprod., 2, 361-369.

[0166] Lowry O H, Rosebrough N J, Farr A L, Randall R J. (1951) Protein measurement with the Folin phenol reagent. J Biol Chem. 193(1) 265-75.

[0167] Lowry, P J, McLean, C, Jones R L and Satgunasingam N. (1976) Purification of anterior pituitary and hypothalamic hormones Clin Pathol Suppl (Assoc Clin Pathol). 7, 16-21.

[0168] Olivennes F, Howles C M, Borini A, Germond M, Trew G, Wikland M, Zegers-Hochschild F, Saunders H (2009) Individualizing FSH dose for assisted reproduction using a novel algorithm: the CONSORT study. Reprod Biomed Online. 2009 Feb;18(2):195-204.

[0169] Pierce J G, and Parsons T F (1981) Glycoprotein hormones: structure and function Annu Rev Biochem. 50 465-495.

[0170] Pricer W E Jr, and Ashwell G. (1971). The binding of desialylated glycoproteins by plasma membranes of rat liver. J Biol Chem. 246(15), 4825-33.

[0171] Rathnam P, and Saxena B B. (1975). Primary amino acid sequence of follicle-stimulating hormone from human pituitary glands. I. alpha subunit. J Biol Chem.;250(17):6735-6746.

[0172] Regoeczi E, Debanne M T, Hatton M C, and Koj A. (1978) Elimination of asialofetuin and asialoorosomucoid by the intact rat. Quantitative aspects of the hepatic clearance mechanism. Biochim Biophys Acta. 541(3), 372-84.

[0173] Royle L, Radcliffe C M, Dwek R A and Rudd PM (2006) Methods in Molecular Biology, ed I Brockhausen-Schutzbach (Humana Press), 347: Glycobiology protocols, 125-144.

[0174] Ryan R J, Keutmann H T, Charlesworth M C, McCormick D J, Milius R P, Calvo F O and Vutyavanich T. (1987). Structure-function relationships of gonadotropins. Recent Prog Horm Res.;43,:383-429.

[0175] Saxena B B and Rathnam P. (1976) Amino acid sequence of the beta subunit of follicle-stimulating hormone from human pituitary glands. J Biol Chem. 251(4), 993-1005

[0176] Steelman S L, and Pohley F M. (1953) Assay of the follicle stimulating hormone based on the augmentation with human chorionic gonadotropin. Endocrinology. 53(6), 604-616.

[0177] Steer C J, and Ashwell G. (1980) Studies on a mammalian hepatic binding protein specific for asialoglycoproteins. Evidence for receptor recycling in isolated rat hepatocytes. J Biol Chem. 255(7), 3008-13.

[0178] Svensson E C, Soreghan B, and Paulson J C. (1990) Organization of the beta-galactoside alpha 2,6-sialyltransferase gene. Evidence for the transcriptional regulation of terminal glycosylation. J Biol Chem. 265(34):20863-20868.

[0179] Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, and Kobata A (1988). Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. J Biol Chem. 263(8), 3657-3663.

[0180] Timossi C M, Barrios de Tomasi J, Zambrano E, Gonzlez R, Ulloa-Aguirre A. (1998). A naturally occurring basically charged human follicle-stimulating hormone (FSH) variant inhibits FSH-induced androgen aromatization and tissue-type plasminogen activator enzyme activity in vitro. Neuroendocrinology. 67(3), 153-163.

[0181] Timossi C M, Barrios-de-Tomasi J, Gonzlez-Surez R, Arranz M C, Padmanabhan V, Conn P M, and Ulloa-Aguirre A. (2000). Differential effects of the charge variants of human follicle-stimulating hormone. J Endocrinol. 165(2), 193-205.

[0182] Ulloa-Aguirre, A., Espinoza, R., Damian-Matsumura, P. and Chappel, S. C. (1988) Immunological and biological potencies of the different molecular species of gonadotrophins. Hum. Reprod. 3, 491-501.

[0183] Ulloa-Aguirre, A., Cravioto, A., Damian-Matsumura, P. Jimenez, M, Zambrano, E and Diaz-Sanchez, V. (1992) Biological characterization of the naturally occurring analogues of intrapituitary human follicle stimulating hormone. Hum. Reprod. 7, 23-30.

[0184] Ulloa-Aguirre A, Midgley A R Jr, Beitins I Z, and Padmanabhan V. (1995). Follicle-stimulating isohormones: characterization and physiological relevance. Endocr Rev.16(6), 765-787.

[0185] Ulloa-Aguirre A, Maldonado A, Damian-Matsumura P, and Timossi C (2001). Endocrine regulation of gonadotropin glycosylation. Arch Med Res. 32(6), 520-532.

[0186] Ulloa-Aguirre A, Timossi C, Barrios-de-Tomasi J, Maldonado A, and Nayudu P. (2003). Impact of carbohydrate heterogeneity in function of follicle-stimulating hormone: studies derived from in vitro and in vivo models. Biol Reprod. 69(2), 379-389.

[0187] Van Lenten L, and Ashwell G. (1972) The binding of desialylated glycoproteins by plasma membranes of rat liver. Development of a quantitative inhibition assay. J Biol Chem. 247(14), 4633-40.

[0188] Wide, L. and Albertsson-Wikland, K. (1990) Change in electrophoretic mobility of human follicle-stimulating hormone in serum after administration of gonadotropin-releasing hormone. J. Clin. Endocrinol. Metab. 70 271-276.

[0189] Wide, L. and Bakos, O. (1993). More basic forms of both human follicle-stimulating hormone and luteinizing hormone in serum at midcycle compared with the follicular or luteal phase. J. Clin. Endocrinol. Metab., 76 885-889.

[0190] Wide L, Naessn T, Sundstrm-Poromaa I, Eriksson K. (2007) Sulfonation and sialylation of gonadotropins in women during the menstrual cycle, after menopause, and with polycystic ovarian syndrome and in men. J Clin Endocrinol Metab.;92(11), 4410-4417.

[0191] Zambrano E, Zarin T, Olivares A, Barrios-de-Tomasi J, and Ulloa-Aguirre A. (1999). Receptor binding activity and in vitro biological activity of the human FSH charge isoforms as disclosed by heterologous and homologous assay systems: implications for the structure-function relationship of the FSH variants. Endocrine. 10(2), 113-121.

[0192] Zhang X, Lok S H, and Kon O L (1998) Stable expression of human alpha-2,6-sialyltransferase in Chinese hamster ovary cells: functional consequences for human erythropoietin expression and bioactivity. Biochim Biophys Acta. 1425(3), 441-452.

[0193] FIGS. 1, 2 and 3: Plasmid maps of the pFSHalpha/beta, pST3 and pST6 expression vectors. CMV=Cytomegalovirus promoter, BGHp(A)=Bovine Growth Hormone poly-adenylation sequence, fl ori=fl origin of replication, SV40=Simian Virus 40 promoter, Neo=Neomycin resistance marker, Hyg=Hygromycin resistance marker, SV40 p(A)=Simian Virus 40 poly-adenylation sequence, FSH A=Follicle stimulating hormone alpha polypeptide, FSH B=Follicle stimulating hormone beta polypeptide, ST3GAL4=2,3-sialyltransferase, ST6GAL1=2,6-sialyltransferase, ColEI=ColEI origin of replication, Amp=ampicillin resistance marker.

TABLE-US-00006 Folliclestimulatinghormonealphapolypeptide AccessionnumberAH007338 NucleotidesequenceofFSHalpha SEQIDNO:1 1 ATGGATTACTACAGAAAATATGCAGCTATCTTTCTGGTCACATTGTCGGTGTTTCTGCAT 61 GTTCTCCATTCCGCTCCTGATGTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCA 121 TTCTTCTCCCAGCCGGGTGCCCCAATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCA 181 TATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAG 241 TCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTG 301 GAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCTTAA ProteinsequenceofFSHalpha (SEQIDNO:5) 1 MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA 61 YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Folliclestimulatinghormonebetapolypeptide AccessionnumberNM_000510 NucleotidesequenceofFSHbeta SEQIDNO:2 1 ATGAAGACACTCCAGTTTTTCTTCCTTTTCTGTTGCTGGAAAGCAATCTGCTGCAATAGC 61 TGTGAGCTGACCAACATCACCATTGCAATAGAGAAAGAAGAATGTCGTTTCTGCATAAGC 121 ATCAACACCACTTGGTGTGCTGGCTACTGCTACACCAGGGATCTGGTGTATAAGGACCCA 181 GCCAGGCCCAAAATCCAGAAAACATGTACCTTCAAGGAACTGGTATATGAAACAGTGAGA 241 GTGCCCGGCTGTGCTCACCATGCAGATTCCTTGTATACATACCCAGTGGCCACCCAGTGT 301 CACTGTGGCAAGTGTGACAGCGACAGCACTGATTGTACTGTGCGAGGCCTGGGGCCCAGC 361 TACTGCTCCTTTGGTGAAATGAAAGAATAA ProteinsequenceofFSHbeta (SEQIDNO:6) 1 MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP 61 ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS 121 YCSFGEMKE Beta-galactosidealpha-2,3-sialyltransferase4 AccessionNumberL23767 NucleotidesequenceofST3GAL4 SEQIDNO:3 1 ATGTGTCCTGCAGGCTGGAAGCTCCTGGCCATGTTGGCTCTGGTCCTGGTCGTCATGGTG 61 TGGTATTCCATCTCCCGGGAAGACAGGTACATCGAGCTTTTTTATTTTCCCATCCCAGAG 121 AAGAAGGAGCCGTGCCTCCAGGGTGAGGCAGAGAGCAAGGCCTCTAAGCTCTTTGGCAAC 181 TACTCCCGGGATCAGCCCATCTTCCTGCGGCTTGAGGATTATTTCTGGGTCAAGACGCCA 241 TCTGCTTACGAGCTGCCCTATGGGACCAAGGGGAGTGAGGATCTGCTCCTCCGGGTGCTA 301 GCCATCACCAGCTCCTCCATCCCCAAGAACATCCAGAGCCTCAGGTGCCGCCGCTGTGTG 361 GTCGTGGGGAACGGGCACCGGCTGCGGAACAGCTCACTGGGAGATGCCATCAACAAGTAC 421 GATGTGGTCATCAGATTGAACAATGCCCCAGTGGCTGGCTATGAGGGTGACGTGGGCTCC 481 AAGACCACCATGCGTCTCTTCTACCCTGAATCTGCCCACTTCGACCCCAAAGTAGAAAAC 541 AACCCAGACACACTCCTCGTCCTGGTAGCTTTCAAGGCAATGGACTTCCACTGGATTGAG 601 ACCATCCTGAGTGATAAGAAGCGGGTGCGAAAGGGTTTCTGGAAACAGCCTCCCCTCATC 661 TGGGATGTCAATCCTAAACAGATTCGGATTCTCAACCCCTTCTTCATGGAGATTGCAGCT 721 GACAAACTGCTGAGCCTGCCAATGCAACAGCCACGGAAGATTAAGCAGAAGCCCACCACG 781 GGCCTGTTGGCCATCACGCTGGCCCTCCACCTCTGTGACTTGGTGCACATTGCCGGCTTT 841 GGCTACCCAGACGCCTACAACAAGAAGCAGACCATTCACTACTATGAGCAGATCACGCTC 901 AAGTCCATGGCGGGGTCAGGCCATAATGTCTCCCAAGAGGCCCTGGCCATTAAGCGGATG 961 CTGGAGATGGGAGCTATCAAGAACCTCACGTCCTTCTGA ProteinSequenceofST3GAL4 (SEQIDNO:7) 1 MCPAGWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGN 61 YSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCV 121 VVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVEN 181 NPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAA 241 DKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITL 301 KSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF Beta-galactosamidealpha-2,6-sialyltransferase1 AccessionnumberNM_003032 NucleotidesequenceofST6GAL1 SEQIDNO:4 1 ATGATTCACACCAACCTGAAGAAAAAGTTCAGCTGCTGCGTCCTGGTCTTTCTTCTGTTT 61 GCAGTCATCTGTGTGTGGAAGGAAAAGAAGAAAGGGAGTTACTATGATTCCTTTAAATTG 121 CAAACCAAGGAATTCCAGGTGTTAAAGAGTCTGGGGAAATTGGCCATGGGGTCTGATTCC 181 CAGTCTGTATCCTCAAGCAGCACCCAGGACCCCCACAGGGGCCGCCAGACCCTCGGCAGT 241 CTCAGAGGCCTAGCCAAGGCCAAACCAGAGGCCTCCTTCCAGGTGTGGAACAAGGACAGC 301 TCTTCCAAAAACCTTATCCCTAGGCTGCAAAAGATCTGGAAGAATTACCTAAGCATGAAC 361 AAGTACAAAGTGTCCTACAAGGGGCCAGGACCAGGCATCAAGTTCAGTGCAGAGGCCCTG 421 CGCTGCCACCTCCGGGACCATGTGAATGTATCCATGGTAGAGGTCACAGATTTTCCCTTC 481 AATACCTCTGAATGGGAGGGTTATCTGCCCAAGGAGAGCATTAGGACCAAGGCTGGGCCT 541 TGGGGCAGGTGTGCTGTTGTGTCGTCAGCGGGATCTCTGAAGTCCTCCCAACTAGGCAGA 601 GAAATCGATGATCATGACGCAGTCCTGAGGTTTAATGGGGCACCCACAGCCAACTTCCAA 661 CAAGATGTGGGCACAAAAACTACCATTCGCCTGATGAACTCTCAGTTGGTTACCACAGAG 721 AAGCGCTTCCTCAAAGACAGTTTGTACAATGAAGGAATCCTAATTGTATGGGACCCATCT 781 GTATACCACTCAGATATCCCAAAGTGGTACCAGAATCCGGATTATAATTTCTTTAACAAC 841 TACAAGACTTATCGTAAGCTGCACCCCAATCAGCCCTTTTACATCCTCAAGCCCCAGATG 901 CCTTGGGAGCTATGGGACATTCTTCAAGAAATCTCCCCAGAAGAGATTCAGCCAAACCCC 961 CCATCCTCTGGGATGCTTGGTATCATCATCATGATGACGCTGTGTGACCAGGTGGATATT 1021 TATGAGTTCCTCCCATCCAAGCGCAAGACTGACGTGTGCTACTACTACCAGAAGTTCTTC 1081 GATAGTGCCTGCACGATGGGTGCCTACCACCCGCTGCTCTATGAGAAGAATTTGGTGAAG 1141 CATCTCAACCAGGGCACAGATGAGGACATCTACCTGCTTGGAAAAGCCACACTGCCTGGC 1201 TTCCGGACCATTCACTGCTAA 0p-ProteinSequenceofST6GAL1 (SEQIDNO:8) 1 MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS 61 QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN 121 KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP 181 WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE 241 KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM 301 PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF 361 DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC