GIARDIA RECOMBINANT ANTIGENS, PURIFICATION OF POLYCLONAL ANTI-GIARDIA IGG AND IGY ANTIBODIES AND GIARDIA DETECTION

20200354401 · 2020-11-12

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a stationary phase for the purification of polyclonal anti-Giardia IgG and IgY antibodies, as well as a method for purifying polyclonal anti-Giardia IgG and IgY antibodies by affinity chromatography. The invention also relates to the polyclonal anti-Giardia IgG and IgY antibodies purified by affinity chromatography, which specifically bind to the antigenic proteins CWP1, alpha-giardin 7.3 and kinesin 3.

In an additional aspect, the invention relates to a method for diagnosing giardiasis by detection of Giardia in a specific sample, and a kit for diagnosing giardiasis in biological and environmental samples.

Claims

1. (canceled)

2. (canceled)

3. (canceled)

4. A method for purifying polyclonal anti-Giardia IgG and/or anti-Giardia IgY antibodies, by affinity chromatography, comprising the following steps: preparing a stationary phase comprising: a resistant, permeable and reactive support of polysaccharide matrix, wherein said matrix is selected from agarose, cellulose, and dextran; or a resistant, permeable and reactive support of synthetic matrix, wherein said matrix is selected from glass and polyacrylamide; and a mixture of two or more recombinant antigen proteins, selected from CWP1, alpha giardina 7.3 and Kinesin 3, wherein the two or more recombinant antigenic proteins are bound to the support by N-hydroxy-succimide ester and re-suspended in a phosphate, citrate or acetate buffer with pH between 6.0 and 8.0; blocking the active groups; transferring the stationary phase to a column and washing with bicarbonate buffer; adding IgG anti-Giardia polyclonal antibodies to the stationary phase until the gel is saturated and in the same way, but independently, carrying out the process with IgY anti-Giardia; removing proteins or other nonspecific solutes; eluting polyclonal IgG anti-Giardia or anti-Giardia IgY antibodies that were independently added; and neutralizing.

5. Anti-Giardia IgG and/or anti-Giardia IgY polyclonal antibodies, purified according to the method of claim 4, which specifically bind to the recombinant antigens CWP1, alpha giardin 7.3 and Kinesin 3.

6. An in vitro diagnostic test for the detection of Giardia antigens in biological or environmental samples comprising the following steps: adding polyclonal anti-Giardia IgG or anti-Giardia IgY antibodies, according to claim 5 (capture antibodies), in a solid phase or matrix; incubating the matrix and washing it; blocking; incubating and washing; contacting the biological or environmental sample with the matrix containing the anti-Giardia polyclonal antibodies, and incubating; removing excess from sample; adding purified anti-Giardia IgG or anti-Giardia IgY polyclonal antibodies; shaking, incubating, removing excess antibodies; adding a conjugate of rabbit anti-IgG or hen anti-IgY antibody bound to a reporter; shaking, incubating, removing excess from conjugate; performing the detection; incubating, stopping the reaction when necessary.

7. The diagnostic test according to claim 6, where the environmental sample is water.

8. A diagnostic kit for detecting Giardia antigens comprising the following components: a solid matrix selected from a solid plastic matrix such as tubes, beads, plates or others; of porous material such as nitrocellulose paper, cellulose acetate, regenerated cellulose, nylon, vinylidene polyfluoride (PVDF) among others that may have different shapes, and fibrous materials such as fiberglass, among others; polyclonal anti-Giardia IgG or anti-Giardia IgY antibodies according to claim 5; a conjugate of anti-Giardia antibody bound to a reporter; a detection reagent when necessary.

9. (canceled)

10. The kit according to claim 5, wherein the detection reporter may be of an enzymatic, fluorescent, luminescent or chromophoric nature which binds to the antigen-antibody complex and which produces a detectable signal in the presence of this reporter.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0033] FIG. 1. PCR for the amplification of interest genes of Colombian Giardia strains: A. CWP1; B. Alpha giardina 7.3.

[0034] FIG. 2. Detection of carrier colonies of the recombinant plasmidColony PCR: A. CWP1; B. Alpha giardina 7.3.

[0035] FIG. 3. Lysed affinity purification of the native recombinant protein in Nickel resin (Ni+2): A. CWP1; B. Alpha giardina 7.3.

[0036] FIG. 4. Concentration of the recovered protein.

[0037] FIG. 5. Western Blot: specific recognition of a single band of 34.2 kDa for the Alpha giardina-7.3.

[0038] FIG. 6. PCR amplification of the Kinesin 3 gene.

[0039] FIG. 7. PCR colony of Kinesin 3.

[0040] FIG. 8. Screening of colonies by using restriction enzyme (PstI) to identify the plasmids carrying the fragment of expected size for Kinesin 3.

[0041] FIG. 9. Purification scheme for Kinesin 3.

[0042] FIG. 10. SDS-PAGE gel: purification of Kinesin 3 by affinity chromatography on nickel-loaded resin.

[0043] FIG. 11. Pattern of excretion of cysts and trophozoites from Colombian Giardia isolates during experimental infection in Gerbils (animal model for studies of giardiosis).

[0044] FIG. 12. Biological activity of polyclonal anti-Giardia IgG and anti-Giardia IgY antibodies purified by affinity chromatography and demonstrated by Western Blot.

[0045] FIG. 13. Diagram of the detection of Giardia antigen by ELISA using polyclonal anti-Giardia IgG and IgY antibodies.

[0046] FIG. 14. Optimal dilution of polyclonal anti-Giardia antibodies.

[0047] FIG. 15. Optimal dilution of rabbit anti-IgG conjugate bound to alkaline phosphatase.

[0048] FIG. 16. Optical densities that indicate positivity in gerbils infected with the parasite from day zero of the infection until day 30 when the animals solve the infection themselves.

[0049] FIG. 17. Diagnostic discrimination of the indirect sandwich ELISA for the detection of Giardia antigen in human fecal eluate.

[0050] FIG. 18. Immunodiagnostic kit for the detection of fecal Giardia.

DETAILED DESCRIPTION OF THE INVENTION

[0051] Antibodies (immunoglobulins) are protein molecules that are produced in the body in response to microorganisms or molecules (antigens) and have the ability to bind to them with a high degree of affinity and specificity. In the mammals there are five classes of immunoglobulins (IgG, IgM, IgA, IgD and IgE) and in the birds three classes (IgY, IgM and IgA). Immunoglobulins recognize relatively small components of an antigen and can cross-react with similar epitopes of other antigens, but these are generally of less specificity.

[0052] Monoclonal antibodies are generated by a single clone of B lymphocytes. Monoclonal antibodies work well when the antigens are homopolymeric, otherwise, it is necessary to develop a pool of monoclonal antibodies, each with different specificities, which requires much time and economic investment, since the multiple monoclonal antibodies must be identified that meet the desired specificity.

[0053] Additionally, small changes in the structure of an epitope as a consequence of a genetic polymorphism, glycosylation and denaturation may obviously affect the function of monoclonal antibodies. Although the main advantages of monoclonal antibodies are their homogeneity, consistency and monospecificity, they can limit their use in the Giardia detection, since it presents genetic variability as a biological factor inherent to the parasite.

[0054] Polyclonal antibodies are generated by a mixture of several B lymphocyte clones and, in general, have higher sensitivity than monoclonal antibodies. The specificity of an antibody is known as the antibody ability to recognize a specific epitope in the presence of other epitopes. Therefore, an antibody with high specificity will present a minimum of cross-reactions. In relation to protein antigens, the affinity bonds of most antibodies are influenced by their conformational structure. A change in the conformational structure is critical when using monoclonal antibodies, and of less impact when using polyclonal antibodies.

[0055] Antigens of Giardia isolates containing membrane and protein fractions of the parasite, may be used through immunization of rabbits and hens, to obtain anti-Giardia antibodies that allow detecting the parasite. Once the relevant protein antigens have been identified, it is possible to obtain them using molecular and cellular biology techniques that include the cloning of genes.

[0056] Anti-Giardia IgY antibodies recognize around 45 cyst and trophozoite antigens from Giardia isolates. Thirty-three of these are present in the cyst and the remaining 12 of 18, 20, 25, 40, 69, 74, 94, 105, 129, 200, 230 and 241 kDa belong to the Giardia trophozoite. The fact that Giardia cyst antigens are also found in the trophozoite of the parasite is an advantage given that the trophozoite stage can remain axenic in vitro, which facilitates obtaining large volumes of antigen.

[0057] In accordance with the scientific literature of the proteins recognized in cyst and trophozoite of Giardia isolates by IgY, anti-Giardia isolates may correspond to the proteins listed in Table 1:

TABLE-US-00001 TABLE 1 Proteins recognized by IgY anti-Giardia isolates Antigen (Protein) Location and/or Bibliographic kDa function reference 170 Flagellus Rosales and Borjas, 1968 86 Membrane Edson and col, 1986 82 Membrane Einfeld and Stibbs, 1984 78 Regulator Reiner and Gillin, 1992 74 Membrane Clark and Holberton, 1986 67 Flagellus Crossley and Hoberton, 1986 65 Excretion/Secretion Rosoff Stibbs, 1986 Vinayak et al, 1993 64 Membrane Einfeld and Stibbs, 1984 60 Cytoskeleton Crossley and Holberton, 1985 56 Membrane Vinayak and col, 1989 52 Membrane Einfeld and Stibbs, 1984 49 Membrane Das and col, 1991 35 Giardinas Taylor and Wenman, 1987 24 Membrane Einfeld and Stibbs, 1984

[0058] Some of the amino acid sequences of the Giardia antigens that can be obtained by molecular biology techniques are shown below:

TABLE-US-00002 CWP1 (SEQIDNO:1) MRGSHHHHHHGSMMLAFLALAGSALALTCPATQREVLVEIYDATDGANWK TNNWLSGDSICTWTGVTCEASNNYVIALDLSDMGLTGTIPENIGCLTYLK TLYLSNNSLAGAIPEGLCQLTNLQYLQVNSAGLTGDIPECMCDLIHLMFW YMSDNALTGSIPTCINELQFLKELHLDCNQLSGTVPVGLMTLPYLMELYL NCNPDLTCPDATGVQFVFKCGDVDCENCGTLPPTNCAQCFTDPDCGEYCL TQP.

[0059] The previous sequence has 99% identity with the protein encoded by the gene GL50803_5638.

TABLE-US-00003 Alpha-giardina7.3 (SEQIDNO:2) MRGSHHHHHHGSMAAAKATEIKALIDAKDMDGLARSVADFDDRQRAEIYA AFRAANGKTASEYLDALFKNGDYKDLMMIVLDDEIDVRCKLIKKAFKGGN DERCLTDALLTTTPEVYARVKDRYHQLFGDDFESTLRKEIGSKTVWARMV NSWLAFCRSARNNAQGDAEALKAALIGVKHPDTDTVIRLLGTTVPSEWKQ ISEAFESIAKKTIEQALIEAYKGDDELALCCCNATLHCPARGAAYLLSLA CQKKGDTDRCCRITGMLYDQAEQCKVLYAHYGNLAKDIRATMSKNLAEAC CVLWHVM.

[0060] The previous sequence has 99% identity with the protein encoded by the gene GL50803_114119.

[0061] On the other hand, the expressed Kinesin 3 protein is orthologous of the gen GL50803_112846, which codes for the following amino acid sequence (SEQ ID NO: 3):

TABLE-US-00004 MRGSHHHHHHGSMPVTGVKVAVRVRPFNAREKREAARLCVDMPGGGKVVL RDADAKKPDAAFVYDHAYWSHDASRPCATQDTVYADIGPSVLDNAFEGYN YTLFAYGQTGSGKSYSMMGAPASEADAGIIPRVGRELFRRAAASPAETQV SVSFLEIYNERLRDLLVPAAGAQELRIRQDPAAGVFVQNLSHHAVADYDA IQRLIELGDRNRTVAATNMNATSSRSHSVFAIEVVQTAVLRNDAGEEVGR HVKRARVSLVDLAGSERQGKTGATGDRLTEGISINKSLTTLGRVIEALAY NTTAEGRRKPQHVPYRDSQLTYLLQPALGGNSMTCMIAAISPASTNYDES LSTLRYADRAHQIENTVTKNESAQEKYIRELEDRVKELEALLAGGAPAGD AGAVEPGLSDAERLELEAKIAEYDRLLKEGNQSLEEKLARAEQNRQELQD KLKKMGLAAAFGSEITTPYISNLSSNASDNGQLIYTLCSENDLKDARPVT VVVGADDSGPTECQCRIALVSKLGVLGEHFIISLTGKVVDSTANPIFPKV TEATIRPLSAKGALYINGRQIAAGSTHQLRHGDRIKCGSAAQSSFYRYYD PPARAAAVKQSLEQDYDYVEPEITYDLALREYTYYQSSGKDTAQRPIGDD PVSKENVSVTMDDAFGITPGLDNVQTDINESFYADFGNDDERTTYEKKVH EVLRQLYPFICEANSIAEYFCYDIRFAAQARTSISPTSLRQAARCQTIRN MSKNHPMTKDLRADQIDDDLSGILVEILVTATAAPSKTRDRKLIRQVWAL EKFGLRLSGMRRMYGLAMTLGKEEAVRRAHESADRDLEDDDEFPFDLEAD IYNQTLTHLIGVGRIPLSGLLETCETDVFSVPIYDYSGKAATSIDVSLSL LGSGYSHHGAECLACDVANLVQNESPVTTIAAYFKKAYNVPTQCCKKVHA VIHMPWFVNPDAGRPKGKRLSVYQENEFRRRLLDMGYTFQTASSSDLSPN PALDSTIYMDLKTSYFKQDDVLEWLRTSGTGLEVSLYGYTSAYADSLVPE IKDSALPDPSKKKVAIVSTNIVRTQTKEDGFKEINGEQVLIIKKFIFVDQ TKTDTGH.

[0062] Anti-Giardia IgG polyclonal antibodies developed in rabbit can be used to capture specific Giardia antigens present in fecal matter by the ELISA immunoenzymatic assay, with sensitivities and specificities ranging between 95% and 100%. These ranges may be due to some inherent physicochemical characteristics of mammalian IgG.

[0063] Since IgY polyclonal anti-microorganism antibodies decrease the probability of false positives in immunological assays, IgY polyclonal antibodies have been developed directed against parasites such as: Echinococcus granuloses, Naegleria fowleri, Plasmodium falciparum, Sacorcystis gigantae, Toxoplasma gondii, Trypanosoma brucei, Schistosoma japonicum.

[0064] IgY has some physicochemical characteristics that differentiate it from mammalian IgG, in such a way that the probability of giving false positives and false negatives in immunodiagnostic assays, decreases due to the elimination of nonspecific junctions. The best antibodies to detect a microorganism in clinical samples or Environmental factors using immunoassays are generally antibodies developed against the membrane of the microorganism or against protein fractions associated with it.

[0065] Purification of Anti-Giardia IgG and IgY Antibodies

[0066] Anti-Giardia polyclonal antibodies can be purified by affinity chromatography, which offers high specificity and selectivity for the isolation and purification of biomolecules. This technique is based on bio-specific interactions, thanks to which the column only absorbs the components that have affinity with the ligands coupled to the chromatographic support. When the retained compound is eluted, high levels of purity are achieved, thanks to the high selectivity of these affinity interactions.

[0067] One embodiment of the present invention corresponds to a stationary phase for purifying anti-Giardia IgG and IgY antibodies. The stationary phase of the invention comprises a resistant, permeable and reactive support, of matrices of polysaccharides (for example, agarose, cellulose, dextran) or synthetic matrices (e.g. glass, polyacrylamide) stable, resistant to microbial attacks, stable to changes in pH and compatible with various organic solvents. Additionally, the stationary phase of the invention comprises a mixture of two or more recombinant antigenic proteins selected from CWP1, Alpha giardina 7.3 and Kinesin 3, incorporated or dissolved in a buffer solution. Optionally, the stationary phase of the invention may comprise sodium azide in solution (0.2% w/v) to prevent contamination and thus be reused several times.

[0068] The regulating solution or buffer, for purposes of the present invention, is defined as a solution, with a certain pH, that allows resistance to pH changes when there is addition of acids or alkali. Regulatory solutions may include one, two, or more salts of phosphate, citrate, acetate (e.g. potassium metaphosphate, potassium phosphate, sodium acetate, sodium citrate anhydrous) and other salts known in the technical field to obtain such solutions.

[0069] In one embodiment of the invention, the stationary phase consists of a support comprising agarose spheres with N-hydroxy-succimide ester, which are coupled to aqueous or non-aqueous ligands in solution. This support allows the coupling, without denaturation, of two 2 or more recombinant Giardia antigens and guarantee their stability at 20 C. for one year and 70 C. for periods of time greater than one year

[0070] The present invention also contemplates a method for purifying polyclonal anti-Giardia IgG and IgY antibodies, by affinity chromatography, comprising the following steps: [0071] a) preparing a stationary phase comprising a resistant, permeable and reactive support of polysaccharide matrices (e.g. agarose, cellulose, dextran) or synthetic matrices (e.g. glass, polyacrylamide) and a mixture of two or more recombinant antigenic proteins selected from CWP1, Alpha giardina 7.3 and Kinesin 3; [0072] b) blocking the free amino-reactive groups of the support with a Tris HCl buffer solution pH 8.0 after the binding of the proteins to the support, to avoid additional nonspecific binding; [0073] c) transferring the stationary phase obtained in step a) to a column and washing with bicarbonate buffer; [0074] d) adding anti-Giardia IgG polyclonal antibodies to the stationary phase until the gel is saturated, and in the same way, but independently, performing the process with anti-Giardia IgY; [0075] e) removing proteins or other nonspecific solutes; [0076] f) eluting, with an acid pH buffer solution, the specific anti-Giardia IgG and IgY polyclonal antibodies that had been independently added; and [0077] g) neutralizing.

[0078] A further embodiment of the present invention corresponds to polyclonal anti-Giardia IgG and IgY antibodies, purified by affinity chromatography, which specifically bind to the antigens CWP1, alpha giardina 7.3 and Kinesin 3.

[0079] Detection of Giardia antigens in samples by immuno-enzymatic assay A diagnostic test refers to any method to obtain additional information on a patient's health status. The type of information acquired through the use of a diagnostic test not only includes the presence or absence of a certain disease, but also the staging of a known disease or establishing the existence of a certain condition, not necessarily pathological (Bossuyt P M, et. al., 2003).

[0080] The enzyme-linked immunosorbent assay (ELISA) is a method based on antigen-antibody reactions, incorporating an enzyme to one of these, in order to visualize the antigen-antibody binding by developing color as a product of the enzyme-substrate reaction. The ELISA assay can be used under the foundation of any of the following three modalities: i) direct ELISA; ii) indirect ELISA and iii) sandwich ELISA, which in turn can be direct or indirect.

[0081] The direct ELISA is used for competition and inhibition systems; the indirect ELISA has the advantage of being able to analyze a large number of samples. The direct sandwich ELISA is not recommended when it is expected to detect complex antigens and the indirect sandwich ELISA has the advantage of using different immunoglobulins from different animal species.

[0082] A further embodiment of the present invention is an in vitro diagnostic method or test for the detection of Giardia antigens in biological samples (e.g. feces) or environmental samples (e.g. water), comprising the following steps: [0083] a) adding polyclonal anti-Giardia antibodies IgG or anti-Giardia IgY (capture antibodies) in a plastic solid matrix (e.g. tubes, beads, plates or others), in a porous material of different forms, such as nitrocellulose paper, cellulose acetate, regenerated cellulose, nylon, vinylidene polyfluoride (pvdf), among others, or in fibrous materials such as fiberglass or others; [0084] b) incubating the matrix and washing it; [0085] c) blocking; [0086] d) incubating and washing; [0087] e) adding a biological or environmental sample in the solid matrix containing the anti-Giardia polyclonal antibodies, shaking and incubating; [0088] f) removing excess sample; [0089] g) adding purified anti-Giardia IgG or anti-Giardia IgY polyclonal antibodies; [0090] h) shaking, incubating and removing excess antibodies; [0091] i) adding a conjugate of anti-rabbit IgG or hen anti-IgY antibody bound to a reporter (enzyme or fluorescent or luminescent or chromophore molecule); [0092] j) shaking, incubating and removing excess conjugate; [0093] k) adding a detection reagent; and [0094] l) incubating and stopping the reaction when necessary.

[0095] The first polyclonal (capture) antibody in step (a) is that which binds to the solid matrix (as in the case of the IgY anti-Giardia polyclonal antibody developed in hen) and which captures the antigen to be detected (in this case, the Giardia antigen). The second polyclonal antibody (in this case the IgG anti-Giardia polyclonal antibody developed in rabbit) binds to the captured antigen and allows, with a conjugate (an anti-rabbit IgG immunoglobulin linked to an enzyme or fluorescent or luminescent or chromophore molecule), it is possible to visualize (by the development of a color product of the reaction) the Giardia antigen that was captured. The absence of color indicates that the sample does not contain Giardia antigens.

[0096] For the detection of the antigen-antibody complex reaction molecules known as reporters (markers) are used, which can be enzymatic, fluorescent, luminescent and chromophores that bind to the antigen-antibody complex, and a detection reagent that produces a detectable signal in the presence of this reporter.

[0097] The essential components for performing the diagnostic test of the invention can be combined in a single package (kit) in order to facilitate storage, transport and marketing.

[0098] This indirect sandwich ELISA can be used for the detection of Giardia antigen for the advantages described above and additionally because: [0099] i) polyclonal anti-Giardia IgY and anti-Giardia IgG antibodies do not react with each other, avoiding the idiotype-anti-idiotype recognition that generates false positives when polyclonal antibodies developed in the same animal species are used; and [0100] ii) avian IgY antibodies unlike mammalian IgG, does not interact with rheumatoid factors, does not activate the human complement system, does not bind to staphylococcal protein A, does not bind to the G protein or to the Fe receptors. of mammalian cells, thus decreasing the probability of giving false positives in immunological assays.

[0101] In the ELISA, the solid matrix is one of the important elements since it acts as a support immobilizing the antibodies. This solid matrix is made with different materials such as: plastic in tubes, beads, plates or others; porous materials such as nitrocellulose, cellulose acetate, regenerated cellulose, nylon, vinylidene polyfluoride (pvdf) among others, which may have different shapes and fibrous materials such as fiberglass among others (Desphande, 1996).

[0102] For the detection of the antigen-antibody complex reaction molecules known as reporters (markers) are used that can be enzymatic, fluorescent, luminescent and chromophoric that bind to the antigen-antibody complex and a detection reagent that produces a detectable signal in the presence of this reporter.

[0103] In a further embodiment, the present invention contemplates a diagnostic kit comprising a solid matrix, polyclonal anti-Giardia IgG antibodies, polyclonal anti-Giardia IgY antibodies, conjugate and a detection reagent.

[0104] The following examples illustrate the invention, without the inventive concept being restricted thereto:

EXAMPLES

Example 1. Identification of Giardia Proteins Recognized by Polyclonal Anti-Giardia IgG Antibodies and Polyclonal Anti-Giardia IgY Antibodies from Colombian Isolates

[0105] 1.1 Isolation of Giardia from Human Fecal Matter.

[0106] Identification of fecal Giardia cysts and isolation of cysts by purification thereof: [0107] Parasitological diagnosis was made in human fecal matter to determine the presence or absence of cysts of Giardia and other intestinal parasites by the direct method in saline and lugol (Melvin and Brooke, 1980) and the method of formaldehyde-ether concentration (Ridley et al. Hawgood, 1956). The purification of Giardia cysts from fecal matter was performed using gradients of sucrose and Percoll (Sauch, 1984). [0108] Eluates of human fecal matter (coproantigen): Fecal eluates stored in the Samples Bank of the Parasitology Group of the National Institute of Health were defrosted. Detection of Giardia antigen in human fecal eluates was performed by ELISA using antibodies polyclonal anti-Giardia IgG and polyclonal antibodies anti-Giardia IgY, developed in rabbit and hen, respectively.

[0109] 1.2 GerbilAnimal Model for Studies of Giardiosis.

[0110] Gerbils Quarantine and Maintenance:

[0111] Gerbils were quarantined and maintained in the Bioterium of the National Health Institute (Bogot, Colombia), following the protocols and procedures established in the ABSL2 of the INS, the norms established in the Guide for the care and use of laboratory animals, 2010 and those of the Council of International Organizations of Medical Sciences (CIOMS), 1996.

[0112] Prophylaxis and Infection with Giardia Cysts to Gerbils:

[0113] Ten gerbils were given Secnidazole (Secnidal) in a dose of 0.2 g/Gerbil in a single dose. Eight gerbils were experimentally inoculated orally with 510 cysts of Colombian Giardia isolates (positive controls) by intubation with a naso-gastric tube, impregnated with lidocaine, guaranteeing that the specimens would only be infected with Giardia. The two remaining gerbils (negative controls) were not infected with the parasite.

[0114] Diagnosis of Giardia in Gerbil's Feces:

[0115] The presence or absence of Giardia cysts or trophozoites was established in the fecal matter of the gerbils infected with the parasite, as well as of the uninfected, by the direct method in saline and lugol (Melvin and Brooke, 1980) and the formalin-ether concentration method (Ridley and Hawgood, 1956).

[0116] Preparation of Fecal Matter Eluent (Coproantigen) from Germs not Infected (Negative Controls), Infected (Positive Controls) and Gerbils Naturally Infected with Trichomonas hominis (Cross-Reaction):

[0117] The feces of each of the infected gerbils were collected independently, not infected with cysts of Colombian isolates of Giardia, daily and for 30 consecutive days (Arvalo et al., 2005). Approximately 1 gram of fecal matter was homogenized in 10 milliliters of phosphate buffer saline (PBS) pH 7.2. The homogenate was filtered through of double gauze allowing the sedimentation of large particles present in the feces for 20 minutes at room temperature.

[0118] The coproantigen was stored at 20 C. (Green, 1985) and defrosted at the time of detecting Giardia antigen by ELISA using polyclonal anti-Giardia IgG antibodies and polyclonal anti-Giardia IgY antibodies, developed in rabbit and hen, respectively.

[0119] Isolation of Giardia Trophozoites from the Small Intestine of Gerbils Infected with the Parasite:

[0120] Euthanasia was performed on the gerbils using CO.sub.2. The small intestine of the specimens was resected under aseptic and biosecurity conditions (Arvalo, 1999).

[0121] In Vitro Maintenance of Giardia Trophozoites:

[0122] TYI-S-33 culture medium supplemented with bile and antibiotics (TYI-S-33-B) was used and Giardia trophozoites were incubated at 35 C. (Keister, 1983).

[0123] Preparation of Giardia Antigen:

[0124] Giardia trophozoites isolated from the small intestine of gerbils were frozen at 196 C., defrosted at 4 C. and sonicated at 20 kHz. The supernatant (antigen) was centrifuged and preserved and the protein concentration was determined by the Bradford method.

[0125] 1.3 Identification of Giardia Antigens with Diagnostic Potential Through in Silico Analysis and Review of Scientific Literature.

[0126] A review of scientific literature was carried out to identify publications that used the experimental Giardia model, in which antigens are identified or proposed as candidates for the immunodiagnosis of giardiasis. Moreover, a bio-informatic analysis was made considering criteria such as molecular mass or excretion/secretion proteins.

[0127] These criteria were used as the first filter to search for proteins of interest in the Giardia genome database that is available online at http://giardiadb.org/giardiadb, then criteria such as: selection of surface proteins, the prediction of immunogenic B epitopes; located on the surface of the molecule at accessible sites for the free antibody.

[0128] Finally, two proteins with potential usefulness for immunodiagnosis were selected; the protein CWP1 of the wall of the cyst (GL50803_5638) and the alpha giardina 7.3 (GL50803_114787). The sequence of the respective genes was downloaded for the strains of Giardia with sequenced genome and with these we proceeded to make multiple alignment of sequences in search of conserved regions to design primers that allowed the amplification of these genes in Colombian strains of Giardia.

[0129] 1.4 Amplification of the Genes of Interest.

[0130] To amplify the genes of interest, DNA was extracted from 3 strains of Giardia from different geographical regions of Colombia (MHOM/Co/99/GI-15 from Tarapac Amazonas, MHOM/Co/99/GI-18 from Garagoa Boyac, MHOM/Co/99/GI-23 Popayn Cauca). The PCR was done using the CloneAmp HiFi PCR Premix kit following the manufacturer's recommendations.

[0131] The amplification products were separated on 1% agarose gels, TAE IX, stained with GelRed 1/10,000 and visualized with ultraviolet light in a GelDoc XR+ (Image Lab Software) (FIG. 1). The fragments of the expected size were cut out of the gel, purified using the Zymoclean Gel DNA Recovery kit and quantified in a NanoDrop 2000.

[0132] The fragments were cloned directly into an expression plasmid using the In-Fusion HD Cloning kit following the manufacturer's recommendations. With these plasmids, E. coli XL1-Blue cells were transformed and plated into Luria Bertani (LB) agar boxes with tetracycline/ampicillin. To detect the carrier colonies of recombinant plasmid, a colony PCR was developed using primers that align on the expression plasmid (FIG. 2).

[0133] Plasmid DNA was extracted from the colonies carrying the recombinant plasmid and sequenced in the DNA Sequencing Laboratory of the Universidad de los Andes (Bogot, Colombia). The sequences were visualized and edited using the BioEdit program. To confirm the identity of the sequences, a BLAST (Basic Local Alignment Search Tool) was made at the NCBI (National Center for Biotechnology Information).

[0134] 1.5 Obtaining the Recombinant Proteins

[0135] Once the identity of the gene of interest within the expression plasmid was confirmed, E. coli MI 5 cells were transformed with each plasmid and induction tests were carried out under optimum conditions of optical density of the culture. non-induced, IPTG concentration and induction temperature (Table 2). Bacterial culture was staggered, under adequate conditions, in order to mass produce the proteins of interest.

TABLE-US-00005 TABLE 2 Induction conditions of each of the recombinant proteins Protein Conditions CWP1 Alpha Giardina 7.3 Kinesin Optical 0.3 0.3 0.8 Density IPTG 0.5 mM 0.5 mM 0.5 mM concentration Incubation 25 C. 18 C. 18 C. Temperature Time 18 hours 18 hours 18 hours

[0136] The extraction of the recombinant protein in its native form was performed using a lysis buffer containing 0.1PBS and 0.1% triton X-100, sonicating in Ultrasonic processor GEX 130 with amplitude of 65% and in 3 cycles of 20 seconds The used ones of the native recombinant protein were purified by affinity in Nickel resin (Ni+2)(Ni2+-NTA-Agarose resin columns (QIAGEN, Inc., Hilden, Germany), FIG. 3.

[0137] The recombinant protein purified by affinity was separated by SDS-PAGE. In order to obtain a protein free of salts or compounds that could interfere with subsequent methodologies, the next step was to dialyze the protein in PBS IX buffer with 1% glycerol at 4 C. for 4 hours. Once the dialysis process was concluded, the protein was quantified in SDS-PAGE gel using a standard curve of known concentrations of bovine serum albumin (BSA), the documented image of this gel was used to develop a densitometry analysis that allowed to know the concentration of the recovered protein (FIG. 4).

[0138] In order to confirm that the recovered protein is indeed recognized by the polyclonal IgG antibodies against Colombian isolates of Giardia, a Western Blot was made, which revealed the specific recognition of a single band of the expected size (27.5 kDa for the CWP1 protein and 34.2 kDa for the giardina alpha-7.3) (FIG. 5).

[0139] 1.6 In Vitro Detection of Giardia Antigens with Potential for Immunodiagnosis, Through Immunoprecipitation and Mass Spectrometry, Universal Methodologies.

[0140] The antibodies developed in rabbit against a pool of 25 Colombian isolates of Giardia, were united to magnetic microbeads coated with protein A/G and this complex was used to capture proteins present in the Used of Giardia trophozoites by the universal immunoprecipitation technique (IP).

[0141] Simultaneously, the same process was developed using pre-immune antibody, which was taken as the non-specificity control. After several washes, the retained protein was eluted and LC/MS/MS mass spectrometry analysis was performed (universal methodology). In this way it was possible to identify 30 proteins of Giardia, of which only 7 proteins remained, when eliminating those that appeared in the elution of the pre-immune serum. When making a functional analysis of the remaining proteins, a structural protein was selected, which was Kinesin 3 (GL50803_112846). The design of primers, PCR amplification, cloning and expression of this protein was done in the same way as for the two previous proteins (FIGS. 6-10).

Example 2. Purification of Polyclonal Anti-Giardia IgG Antibodies and Anti-Giardia IgY Polyclonal Antibodies

[0142] 2.1 Stationary Phase

[0143] Affigel 10 is a commercial stationary phase of BIO-RAD composed of agarose spheres with N-hydroxy-succimide ester that are coupled to aqueous or non-aqueous ligands in solution. The recombinant Giardia antigens developed in the National Institute of Health obtained according to Example 1 were coupled to the Affigel, without denaturation.

[0144] The affi-gel 10 was uniformly homogenized, one milliliter of it was removed and washed with five volumes of isopropanol refrigerated at 4 C. 0.5 ml of a solution that may contain the combination of two or three recombinant antigens or total parasite antigens dissolved in phosphate buffer in a final concentration of 30 mg, was stirred at 18 C. for one hour to obtain a suspension. uniform, the active groups were blocked by adding 0.1 ml of 1M ethanolamine HCl (pH 8.0) for one hour, and transferred to a Biorad Econo-Pack column of 10 ml capacity. Finally, it was washed with bicarbonate buffer until the obtained gel was free of reagents, which was detected by optical density at a wavelength of 280 nm.

[0145] 2.2 Polyclonal Anti-Giardia IgG Antibodies Developed in Rabbit and Polyclonal Anti-Giardia IgY Antibodies Developed in Hen

[0146] IgY anti-Giardia polyclonal antibodies present in egg yolks were developed in hens immunized with parasite trophozoites, in previous studies, and egg yolks stored at 20 C. The egg yolks were defrosted at 4 C. and mixed with sterile distilled water in a ratio of 1:9 v/v. It was filtered through sterile double gauze and the filtrate was adjusted to pH 7.0 with 0.1N NaOH (Garcia et al., 2005). IgG anti-Giardia polyclonal antibodies present in serum were developed in rabbit and previously purified by precipitation sequential with caprylic acid and ammonium sulfate, in previous studies, and subsequently stored at 20 C. (Duque et al., 2002). They were defrosted at 4 C. and purified by affinity chromatography.

[0147] 2.3 Purification of Polyclonal Anti-Giardia IgG Antibodies and Anti-Giardia IY Polyclonal Antibodies, by Affinity Chromatography.

[0148] IgG and IgY anti-Giardia polyclonal antibodies were added, independently, in the upper part of the column until the gel was saturated, proteins or other nonspecific solutes were removed with 1M sodium chloride (NaCl), polyclonal IgG and IgY antibodies were eluted. anti-Giardia, independently, with 1M propionic acid and neutralized with a base (Bio-Rad).

[0149] 2.4 Determination of the Biological Activity of Polyclonal Antibodies IgG and IgY Anti-Giardia.

[0150] The biological activity of polyclonal antibodies IgG and IgY anti-Giardia was determined, independently, by Western Blot. The recognition of Giardia trophozoite antigens was performed by the procedure described by Laemmli, 1970 and Towbin et al, 1979.

[0151] Giardia trophozoite proteins were separated by polyacrylamide gel electrophoresis under denaturant conditions using a 12.5% polyacrylamide gel separator. The proteins were transferred to a nitrocellulose membrane (MNC) at 4 C./200 mA/130 volts/26 watts for 2 hours and the transfer of the proteins was verified by coloring the MNC with Ponceau S. red.

[0152] The MNC was blocked with 4% skim milk dissolved in PBS-0.1% Tween 20 (PBS-T) at 18 C. for one hour, and washed three times with PBS-T, for five minutes each time. IgG and IgY anti-Giardia polyclonal antibody was added to the MNC, independently, at a 1:400 dilution, incubated at 18 C. for 18 hours and washed as described above.

[0153] The MNC was incubated at 18 C. for 1 hour with a 1:10,000 dilution, independently, of anti-IgG (Biorad) and anti-IgY (Promega) both bound to alkaline phosphatase. The MNC was washed twice with PBS-T and once with Tris-NaClMgCl buffer. The reaction was revealed with 5-bromo-4-chloro-3-indole phosphate (BCIP) and nitrotetrazolium blue (NBT). The reaction was stopped using a buffer solution of the enzymatic reaction (sodium chloride, potassium chloride, potassium monobasic phosphate, sodium dibasic phosphate, ethylene diamine tetraacetic acid (EDTA).

Example 3. Development of the Indirect Sandwich ELISA for Detection of Giardia Antigen in Eluate of Gerbil Feces, Animal Model for Studies of Giardiosis

[0154] 3.1 Enzyme Immunoassay Indirect Sandwich ELISA:

[0155] Polyclonal anti-Giardia IgG antibodies developed in rabbit were used, as the first capture of Giardia antigen and polyclonal anti-Giardia IgY antibodies, developed in hens, as the second capturer for the detection of the parasite in fecal matter of gerbil. Moreover, polyclonal anti-Giardia IgY antibodies, developed in hen, as the first capture of Giardia antigen and polyclonal anti-Giardia IgG antibodies, developed in rabbit, as the second capturer for the detection of the parasite in fecal matter of Gerbil.

[0156] The optimal concentrations of the biologics for the ELISA were determined as the optimal concentration of coproantigen, polyclonal anti-Giardia IgG antibody, polyclonal anti-Giardia IgY antibody and commercial conjugates (anti-rabbit IgG and hen anti-IgY both bound to a reporter) following the guidelines established by Voller et al., 1976 and McLaren et al., 1981).

[0157] 3.2 Standardization of Optimal Biological Concentrations

[0158] Polystyrene plates were used (Ref: 95029380 Combiplate 1225 flat bottom universal 250/crt, Labsystem). Dilutions of anti-polyclonal antibody were made Giardia IgG and anti-Giardia IgY polyclonal antibody, independently, in final concentration of 0.1, 0.5, 1, 2, 5, 10, 20, 40, 80, 160 and 320 g/ml in 0.05M buffer of carbonate/bicarbonate pH 9.6, 100 l of each of the dilutions was added in triplicate in the wells of the plates and shaken once for five minutes or as an alternative to three rpm for two minutes using a plate mixer (Titer plate Shaker, Lab Line Instruments, Inc.) in order to optimize the adsorption of polyclonal antibodies to the plates. These were incubated in a humid chamber at 4 C. for 18 hours.

[0159] The plates were washed three times consecutively with 0.15M phosphate buffer, pH 7.4 plus 0.05% Tween 20 (PBS-T) for five minutes each time and alternatively using the automatic plate washer (Wellwash 4 MK 2 Thermo Labsystems) four times for two minutes each time. The plates were blocked with 1% bovine serum albumin by adding 100 l in each well and shaken once for five minutes and as an alternative to three rpm for two minutes. The plates were incubated in a humid chamber at 18 C. for one hour. The excess bovine serum albumin was removed by washing three consecutive times with PBS-T for five minutes each time and as an alternative using the automatic plate washer four times for two minutes each time.

[0160] A 1:1 dilution of 1% bovine serum albumin and fecal eluates was performed, independently, without the presence of Giardia (negative samples), with the presence of Giardia, coproantigen, (positive samples) and with the presence of Trichomonas hominis, intestinal parasite different from Giardia, (cross-reactive samples) and 100 l of this was added to each of the wells containing polyclonal anti-Giardia IgG antibodies or polyclonal anti-Giardia IgY antibodies, independently, adsorbed on the plates and these were shaken once for five minutes and, as an alternative, at three rpm for two minutes.

[0161] Plates were incubated in a humid chamber at 37 C. for one hour. Excess eluate was removed from fecal material by washing three consecutive times with PBS-T for five minutes each time and as an alternative using the automatic plate washer four times for two minutes each time.

[0162] Dilutions of polyclonal anti-Giardia IgG and IgY antibodies, independently, in final concentrations of 0.1, 0.5, 1, 2, 5, 10, 20, 40, 80, 160 and 320 g/ml in PBS-T were made, and 100 l of each of the dilutions was added in triplicate in the wells of the plates. The plates were shaken once for five minutes or, alternatively, at three rpm for two minutes in order to homogenize the reaction. Plates were incubated in a humid chamber at 37 C. for one hour. Excess polyclonal antibodies were removed three consecutive times with PBS-T for five minutes each time and, alternatively, using the plate washer four times for two minutes each time.

[0163] PBS-T dilutions of goat anti-rabbit IgG conjugate (Biorad) and goat anti-hen IgG conjugate (Promega) were both prepared, both bound to the enzyme alkaline phosphatase in dilutions with final concentration of 1:500, 1:1000; 1:2000; 1:5000 and 1:10,000. 100 l were added to each well of the plates, these were shaken once for five minutes and, alternatively, at three rpm for two minutes in order to homogenize the reaction.

[0164] Plates were incubated in a humid chamber at 37 C. for one hour. The excess conjugate was removed by washing three consecutive times with PBS-T for five minutes each time and, alternatively, using the plate washer four times for two minutes each time. 100 l of substrate (p-nitrophenylphosphate) was added at a concentration of 1 mg/ml of 0.1M diethanolamine buffer solution, pH 9.8.

[0165] Plates were incubated at 18 C. for 30 minutes. The enzyme-substrate reaction was stopped with 25 l of 3N sodium hydroxide (NaOH). The optical density value was determined at a wavelength of 405 nm in a Multiscan EX.

[0166] 3.3 Validation (Determination of Diagnostic Discrimination) of the Indirect Sandwich ELISA for the Detection of Giardia Antigen in Eluted Feces of Gerbil, Animal Model for Studies of Giardiosis.

[0167] Fecal Samples (Eluates of Fecal Matter) from Gerbil:

[0168] The minimum sample size needed in Epidat 2 was calculated based on the following assumptions: A confidence level of 95%, a difference of the sample means it does not exceed the difference of true means in a percentage greater than 12%, a deviation standard of the optical density of the population of infected gerbils of 0.40 and one standard deviation of the optical density of the population of non-infected gerbils of 0.10.

[0169] In accordance with the above, the total fecal sample size for the evaluation of the immunoenzymatic test for fecal antigen detection was 92 samples (46 fecal without and 46 with the presence of Giardia, positive and negative samples, respectively). Additionally, 13 fecal samples from Gerbil naturally infected with Trichomonas hominis (cross-reaction) were evaluated.

[0170] 3.4 Diagnostic Discrimination

[0171] Once the concentrations of the biologics had been determined to perform the ELISA, we proceeded to detect Giardia antigen in the eluted feces of infected and uninfected gerbils by ELISA to establish the absorbance value that allowed to discriminate between presence and absence. of Giardia antigen (Kurstak, 1985). The ELISA was evaluated by determining the parameters of: sensitivity (S), specificity (E), positive predictive value (PPV) and negative predictive value (NPV) and concordance (Kappa index), with their 95% confidence intervals using a table of 22 contingency (Griner et al., 1981).

Example 4. Detection of Giardia Antigen in Human Fecal Eluates Using the ELISA Developed in Gerbil

[0172] 4.1 Sample of Human Feces (Eluates of Fecal Material):

[0173] Eluates of human fecal matter were used with presence of Giardia (positive samples), absence of the parasite (negative samples) and presence of other parasites. intestinal (cross-reaction), stored in the Samples Bank of the Parasitology Group of the National Institute of Health (Bogota, Colombia).

[0174] The minimum sample size needed was calculated in Epidat 2 based on the following assumptions: A confidence level of 95%, a difference of the sample means that did not exceed the difference of true means in a percentage greater than 12%, a deviation standard of optical density of the human population infected with Giardia of 0.40 and one standard deviation of the optical density of the human population not infected with the parasite of 0.20.

[0175] According to the above, the total fecal sample size for the evaluation of the immunoenzymatic test for antigen detection in human fecal matter was 92 samples: 46 fecal matter with presence of Giardia (positive samples) and 46 feces with absence of the parasite (negative samples). Additionally, 39 samples of human fecal matter infected with other intestinal parasites different from Giardia (Cross Reaction) were evaluated.

TABLE-US-00006 TABLE 3 Intestinal parasites identified in human fecal matter Identification of Number of intestinal parasites human feces Absence of Giardia duodenalis 46 and other intestinal parasites Giardia duodenalis 46 Intestinal parasites other than 39 Giardia duodenalis: Complex Entamoeba histolytica/ 1 Entamoeba dispar Entamoeba coli 7 Endolimax nana 1 Chilomastix mesnili 1 Trichomonas hominis 1 Blastocystis hominis 1 Strongyloides stercoralis 1 Uncinaria 1 Entamoeba coli, 6 Chilomastix mesnili Endolimax nana, 2 Chilomastix mesniii Entamoeba coli, 2 Endolimax nana Entamoeba coli, 1 Chilomastix mesnili Chilomastix mesnili, 1 Blastocystis hominis Chilomastix mesnili, 1 Trichuris trichiura Entamoeba coli, 1 Trichuris trichiura Entamoeba coli, 1 Uncinaria, Trichuris trichiura, 1 Hymenolepis diminuta Entamoeba coli, 6 Endolimax nana, Chilomastix mesnilii Entamoeba coli, 1 Iodamoeba bustchlii, Blastocystis hominis Entamoeba coli, 2 Endolimax nana, Chilomastix mesnili, Blastocystis hominis

[0176] 4.2 Diagnostic Discrimination for the Detection of Giardia in Human Fecal Fluid Eluates by Means of Indirect Sandwich ELISA:

[0177] The optimal concentrations of the determined biologicals were used for the detection of Giardia antigen in gerbil feces, animal model for studies of giardiosis. Polystyrene plates were used (Ref: 95029380 Combiplate 1225 flat bottom universal 250/crt, Labsystem).

[0178] Dilutions of anti-Giardia IgG and IgY polyclonal antibody were made, independently, in a final concentration of 10 g/ml in 0.05M carbonate/bicarbonate buffer 9.6, 6, 100 l of each of the dilutions were added in triplicate. in the wells of the plates and shaken once for five minutes and as an alternative to three rpm for two minutes using a plate mixer (Titer plate Shaker, Lab Line Instruments, Inc.) in order to optimize the adsorption of antibodies polyclonal to the plates.

[0179] These were incubated in a humid chamber at 4 C. for 18 hours. The plates were washed three times consecutively with 0.15M phosphate buffer, pH: 7.4 plus 0.05% Tween 20 (PBS-T) for five minutes each time and, alternatively, using the automatic plate washer. (Wellwash 4 MK 2 Thermo Labsystems) four times for two minutes each time.

[0180] Plates were blocked with 1% bovine serum albumin by adding 100 l in each well and shaken once for five minutes and, alternatively, at three rpm for two minutes. The plates were incubated in a humid chamber at 18 C. for one hour. The excess bovine serum albumin was removed by washing three consecutive times with PBS-T for five minutes each time and as an alternative using the automatic plate washer four times for two minutes each time.

[0181] A 1:1 dilution of 1% bovine serum albumin and fecal eluate was performed, independently, without the presence of Giardia (negative samples), with the presence of Giardia, coproantigen, (positive samples) and with the presence of other intestinal parasites. different from Giardia, (cross-reactive samples) and 100 l thereof was added in each of the wells containing polyclonal antibodies IgG or IgY anti-Giardia, independently, adsorbed on the plates and these were shaken once for five minutes and, alternatively, at 3 rpm for two minutes.

[0182] Plates were incubated in a humid chamber at 37 C. for one hour. Excess eluate was removed from fecal material by washing three consecutive times with PBS-T for five minutes each time and, alternatively, using the automatic plate washer four times for two minutes each time. Dilutions of anti-Giardia IgG and IgY polyclonal antibody in final concentration of 10 g/ml in PBS-T were made and 100 l of each of the dilutions was added in triplicate in the wells of the plates.

[0183] The plates were shaken once for five minutes and as an alternative to three rpm for two minutes in order to homogenize the reaction. Plates were incubated in a humid chamber at 37 C. for one hour. Excess antibody was removed in a polyclonal fashion three consecutive times with PBS-T for five minutes each time and, alternatively, using the plate washer four times for two minutes each time.

[0184] Dilutions, in PBS-T, of the goat anti-rabbit IgG conjugate (Biorad) bound to the alkaline phosphatase enzyme were prepared in dilution with a final concentration of 1:1000. 100 l was added to each well of the plates, they stir once for five minutes and, alternatively, at 3 rpm for two minutes in order to homogenize the reaction.

[0185] Plates were incubated in a humid chamber at 37 C. for one hour. The excess conjugate was removed by washing three consecutive times with PBS-T for five minutes each time or, alternatively, using the plate washer four times for two minutes each time. 100 l of substrate (p-nitrophenylphosphate) was added at a concentration of 1 mg/ml of 0.1 M diethanolamine buffer, pH 9.8. The plates were incubated at 18 C. for 30 minutes and the enzyme-substrate reaction was stopped with 25 l of 3N sodium hydroxide (NaOH). The optical density value was determined at a wavelength of 405 nm in a MultiscanEX.

Example 5. Results of the Infection of Gerbils with Cysts of Colombian Isolates of Giardia

[0186] Infection with Cysts of Colombian Isolates of Giardia

[0187] The infection of the specimens was achieved with the inoculation of 510.sup.3 cysts of Giardia/ml and the corroborated infection course, daily, during 30 consecutive days by means of the parasitological diagnosis allowed to identify the presence of Giardia cysts or trophozoites in the fecal of Gerbils. Thus, although no cysts of the parasite were observed in some feces of infected gerbils, it was known that parasite antigen existed in their feces due to the experimental infection with Giardia that had been performed on the gerbils.

[0188] The course of the infection showed an intermittent pattern of parasite cysts excretion with absence of these on days 1, 2, 3, 4, 7, 8, 10, 11, 12, 13, 15, 16, 18, 19 and from day 21 to 30 post-infection and with constant presence of Giardia cysts during days 5, 6, 9, 14, 17 and 20 post-infection (FIG. 11).) During this period, the average concentration of Parasite cysts varied within the range of 2 (log 10: 0.30) to 17 (log 10: 1.23) cysts released during two hours of collection.

[0189] Due to the large difference in the orders of magnitude between the number of cysts and the number of trophozoites obtained in the collection, and in order to graphically visualize the release behavior of these, the logarithmic transformation of the data was used. The number of Giardia trophozoites recovered from the small intestine was different in each of the observations conducted with a range between 15,000 (log 10: 4.2) and 6,577,778 (log 10: 6,8) trophozoites/ml.

[0190] Isolation of Giardia Trophozoites from the Small Intestine of Gerbils and In Vitro Maintenance of Parasite Trophozoites

[0191] Giardia trophozoites were obtained at 7, 14, 21, 28 and 30 post-infection days of each of the small resected intestines of each of the gerbils that had been previously infected with the parasite. The small intestine resection of gerbils infected with Giardia allowed to isolate trophozoites from the parasite, maintain them in vitro, obtain mass culture of these and prepare Giardia trophozoite antigen at a concentration of 30 mg/ml. Giardia trophozoites obtained from the dried intestines of gerbils infected with the parasite were maintained in vitro, increasing the population of the parasite to a number of 110.sup.6 trophozoites/ml.

[0192] Utility of IgY Anti-Giardia from Colombian Isolates to Detect Antigen of the Parasite in Human Fecal Matter and Gerbil (Animal Model for Studies of Giardiosis)

[0193] Preparation of Giardia Trophozoite Antigen:

[0194] The Giardia antigen was prepared according to the proposed methodology and the protein concentration determined by the Bradford method was 1.2 mg/ml.

Example 6. Polyclonal Anti-Giardia Antibodies IgG and IgY

[0195] Purification by Affinity Chromatography of Polyclonal IgG and Anti-Giardia IgY Antibodies.

[0196] Anti-Giardia IgG and IgY concentrations of 5 mg/ml and 25 mg/ml were obtained, respectively.

[0197] Determination of the Biological Activity of Polyclonal IgG Anti-Giardia Antibodies Developed in Rabbit and IgY Anti-Giardia Polyclonal Antibodies Developed in Hen

[0198] Western Blot:

[0199] The biological activity of polyclonal anti-Giardia IgG antibodies developed in rabbit and IgY polyclonal antibodies anti-Giardia developed in hens, both independently purified by affinity chromatography, was demonstrated by the presence of bands indicating antigen binding (Giardia trophozoite) and antibody (polyclonal IgG anti-Giardia antibodies) or antigen binding (trophozoite of Giardia) and antibody (anti-Giardia IgY polyclonal antibodies) (FIG. 12).

[0200] Giardia trophozoite-specific antigens recognized by polyclonal IgG and IgY anti-Giardia antibodies by Western Blot ranged between 24 and 125 kDa and purified by affinity chromatography correspond to molecular weights of 94, 78, 64, 31 and 30 kDa and 86, 72, 60, 30 and 27 kDa, respectively.

Example 7. Indirect Sandwich ELISA for the Detection of Antigen of Giardia Using IgY Anti-Giardia, (First Capturer) and IgG Anti-Giardia (Second Capturer) Both Purified by Affinity Chromatography

[0201] Anti-Giardia IgG and IgY polyclonal antibodies were purified by affinity chromatography using a Giardia total antigen column. The polyclonal IgY anti-Giardia is used directly in the ELISA as the first capture. The anti-Giardia IgG polyclonal antibody was re-purified using a matrix containing the three recombinant Giardia antigens and it acts as the second capturer and to which the rabbit anti-IgG-labeled alkaline phosphatase conjugate binds. The above allows greater sensitivity and specificity of ELISA in the detection of Giardia in fecal material eluates.

[0202] Standardization of Optimal Concentrations of Biologics for ELISA

[0203] The use of this scheme for the capture of parasite antigen in the feces eluates of the gerbil, allowed to establish optimal concentrations of polyclonal antibodies IgG anti-Giardia and IgY anti-Giardia of 10 g/ml (FIG. 14) and a dilution of 1:1000 of rabbit anti-rabbit IgG conjugate to alkaline phosphatase (FIG. 15).

[0204] Diagnostic Discrimination

[0205] The parameters of the indirect sandwich ELISA for the detection of Giardia antigen in eluate of gerbil feces, animal model for studies of giardiasis using anti-Giardia IgY, (first capturer) and anti-Giardia IgG (second capturer) both purified by Affinity chromatography were: sensitivity (S): 100%, specificity (E): 100%, positive predictive value (PPV): 100% and negative predictive value (NPV): 100%.

[0206] These parameters are reliable, although in the course of infection, cysts of the parasite have not been observed in days 1, 2, 3, 4, 7, 8, 10, 11, 12, 13, 15, 16, 18, 19 and from day 21 to 30 post-infection and only constant presence of Giardia cysts during days 5, 6, 9, 14, 17 and 20 post-infection.

[0207] This is the natural phenomenon of intermittent cysts excretion, inherent in the biology of the parasite and independent of the host. Therefore, the optical densities that indicate positivity, although there is absence of cysts in the parasite, are reliable because it was known that feces came from gerbils infected with the parasite from day zero of the infection until day 30 when the animals resolve. by themselves the infection (FIG. 16).

[0208] Detection of Giardia Antigen in Human Fecal Eluates Using the Indirect Sandwich ELISA Developed to Detect Giardia Antigen in Animal Model Gerbil for Studies of Giardiasis.

[0209] Diagnostic Discrimination

[0210] The ELISA parameters for the detection of Giardia in eluates of human fecal matter using anti-Giardia IgY as the first capture and anti-Giardia IgG as the second capturer and both purified by affinity chromatography, were: sensitivity (S): 100%, specificity (E): 100%, positive predictive value (PPV): 100% and negative predictive value (NPV): 100%.

Example 8. Diagnostic Kit to Detect Giardia Antigens by the Dot-ELISA Methodology

[0211] A dilution of 148 g/ml of polyclonal anti-cyst antibody and anti-trophozoite of Giardia in phosphate buffer (PBS) was performed. There was 1 l of polyclonal antibody added to a circle of nitrocellulose membrane (MNC) of one centimeter in diameter.

[0212] It was incubated at 37 C. for 36 seconds for each sample of polyclonal antibody to be dried. Each MNC circle was blocked, individually, with 4% skimmed milk dissolved in PBS plus 1% Tween 20 (PBS-T) at 18 C. for one hour. The excess blocking solution was removed by inversion. 500 l of each of the following samples were added, independently: [0213] Fecal eluate without the presence of parasitologically diagnosed Giardia (negative control). [0214] Eluate of fecal sample with the presence of parasitologically diagnosed Giardia (positive control). [0215] Eluate of fecal matter to detect the presence of Giardia antigen or not.

[0216] The samples were incubated at 18 C. for 30 minutes. The fecal eluate was removed by inversion. There were 500 l of PBS-T added to each MNC circle, individually. This was eliminated by inversion and the procedure was repeated five consecutive times.

[0217] There were 500 l of anti-cyclic polyclonal antibody and Giardia anti-trophozoite added at a concentration of 148 g/ml PBS. It was incubated at 18 C. for 30 minutes. The polyclonal antibody was removed by inversion. There were 500 l of PBS-T added to each MNC circle, individually. This was eliminated by inversion and the procedure was repeated five consecutive times. There were 500 l of anti-rabbit IgG bound to alkaline phosphatase (conjugate) was added. It was incubated for 30 minutes. The conjugate was removed by inversion.

[0218] There were 500 l of PBS-T was added to each MNC circle, individually. This was eliminated by inversion and the procedure was repeated four consecutive times. Each MNC circle was washed once with a phosphate buffer specific for the enzyme alkaline phosphatase (AP buffer). The AP solution was discarded by investment.

[0219] There were 50 l of bromo-chloro-indolyl-phosphate, 50 l of nitro-tetrazolium blue and 400 l of AP solution were added. The development of the enzyme-substrate reaction was allowed at 18 C. for 10 minutes. The reaction was stopped with 500 l of PBS plus 20 mM of EDTA.

[0220] The purple reaction indicated the positive antigen-antibody binding reaction, and the absence of negative reaction color (FIG. 18).