MONOCLONAL ANTIBODIES AND COCKTAILS FOR TREATMENT OF EBOLA INFECTIONS

20200354438 ยท 2020-11-12

    Inventors

    Cpc classification

    International classification

    Abstract

    Described herein are compositions and methods for the prevention and treatment of ebolavirus infection. In certain embodiments of the present invention, monoclonal antibodies substantially similar to those described herein, as well as affinity matured variants thereof, alone or in combination, provide therapeutic efficacy in a patient against multiple species of ebolavirus.

    Claims

    1. A composition for the treatment of Ebola, the composition comprising: a therapeutically effective combination of i. a first monoclonal antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 21, and affinity matured variants thereof; and a light chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 23, and affinity matured variants thereof, wherein said first monoclonal antibody or antigen binding fragment thereof has a heavy chain CDR1 comprising SEQ ID NO: 47, a heavy chain CDR2 comprising SEQ ID NO: 48, a heavy chain CDR3 comprising SEQ ID NO: 49, a light chain CDR1 comprising SEQ ID NO: 50, a light chain CDR2 comprising SEQ ID NO: 51, and a light chain CDR3 comprising SEQ ID NO: 52 and amino acid sequences 90% identical thereto, and wherein the antigen to which the antigen binding fragment binds comprises Ebola glycoprotein; and ii. a pharmaceutically acceptable excipient or carrier.

    2. The composition of claim 1, wherein said first monoclonal antibody or antigen binding fragment thereof binds at least two species of Filovirus glycoprotein.

    3. The composition of claim 1, wherein the first monoclonal antibody or antigen binding fragment that binds to the Ebola glycoprotein antigen thereof comprises predominantly a single glycoform.

    4. The composition of claim 3, wherein the predominantly single glycoform is one of GnGn, G1/G2, and NaNa.

    5. The composition of claim 3, wherein the predominantly single glycoform substantially lacks at least one of fucose and xylose.

    6. The composition of claim 2 further comprising a second monoclonal antibody or antigen binding fragment thereof, wherein said second monoclonal antibody or antigen binding fragment thereof binds Ebola glycoprotein.

    7. A composition for the treatment of Ebola, the composition comprising: a therapeutically effective combination of i. a first monoclonal antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 21, and affinity matured variants thereof; and a light chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 23, and affinity matured variants thereof, wherein said first monoclonal antibody or antigen binding fragment thereof binds at least two species of Filovirus, and wherein the antigen to which the antigen binding fragment binds comprises Ebola glycoprotein; and ii. a pharmaceutically acceptable excipient or carrier.

    8. The composition of claim 7, wherein said first monoclonal antibody or antigen binding fragment thereof has a heavy chain CDR1 comprising SEQ ID NO: 47, a heavy chain CDR2 comprising SEQ ID NO: 48, a heavy chain CDR3 comprising SEQ ID NO: 49, a light chain CDR1 comprising SEQ ID NO: 50, a light chain CDR2 comprising SEQ ID NO: 51, and a light chain CDR3 comprising SEQ ID NO: 52 and amino acid sequences 90% identical thereto.

    9. The composition of claim 7, wherein the first monoclonal antibody or antigen binding fragment that binds to the Ebola glycoprotein antigen thereof comprises predominantly a single glycoform.

    10. The composition of claim 9, wherein the predominantly single glycoform is one of GnGn, G1/G2, and NaNa.

    11. The composition of claim 9, wherein the predominantly single glycoform substantially lacks at least one of fucose and xylose.

    12. The composition of claim 7 further comprising a second monoclonal antibody or antigen binding fragment thereof, wherein said second monoclonal antibody or antigen binding fragment thereof binds the Ebola glycoprotein.

    13. A monoclonal antibody or antigen binding fragment thereof effective to treat Ebola comprising a heavy chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 21, and affinity matured variants thereof; and a light chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 23, and affinity matured variants thereof, wherein said first monoclonal antibody or antigen binding fragment thereof comprises predominantly a single glycoform that binds at least two species of Filovirus, and wherein the antigen to which the antigen binding fragment binds comprises Ebola glycoprotein.

    14. The monoclonal antibody or antigen binding fragment thereof of claim 13, wherein said first monoclonal antibody or antigen binding fragment thereof has a heavy chain CDR1 comprising SEQ ID NO: 47, a heavy chain CDR2 comprising SEQ ID NO: 48, a heavy chain CDR3 comprising SEQ ID NO: 49, a light chain CDR1 comprising SEQ ID NO: 50, a light chain CDR2 comprising SEQ ID NO: 51, and a light chain CDR3 comprising SEQ ID NO: 52 and amino acid sequences 90% identical thereto.

    15. The monoclonal antibody or antigen binding fragment thereof of claim 13, wherein the predominantly single glycoform is one of GnGn, G1/G2, and NaNa.

    16. The monoclonal antibody or antigen binding fragment thereof of claim 13, wherein the predominantly single glycoform substantially lacks at least one of fucose and xylose.

    Description

    DESCRIPTION OF THE FIGURES AND TABLES

    [0073] Table 1. Amino acid residues comprising CDRs of anti-Ebola mAbs.

    [0074] FIG. 1 shows a neutralization curve for affinity matured variants of one embodiment of the present invention.

    [0075] FIG. 2 shows the binding sites on the EBOV-GP of various embodiments of the monoclonal antibodies of the present invention.

    [0076] FIG. 3 shows the location of the mutations that result in escape mutant resistance to two monoclonal antibodies of the present invention.

    [0077] FIG. 4 shows neutralization assays preformed against the escape mutants.

    [0078] FIG. 5 shows survival data for ebolavirus infected guinea pigs treated with certain embodiments of the present invention.

    [0079] FIG. 6 shows immune system response data from ebolavirus infected guinea pigs treated with certain embodiments of the present invention.

    [0080] FIG. 7 shows survival data for ebolavirus infected guinea pigs treated with certain embodiments of the present invention.

    [0081] FIG. 8 shows survival data for ebolavirus infected guinea pigs treated with certain embodiments of the present invention.

    [0082] FIG. 9 survival data for ebolavirus infected guinea pigs treated with certain embodiments of the present invention.

    [0083] FIG. 10 survival data for ebolavirus infected non-human primates treated with certain embodiments of the present invention.

    [0084] FIG. 11 survival data for ebolavirus infected non-human primates treated with certain embodiments of the present invention.

    [0085] FIG. 12 survival data for ebolavirus infected non-human primates treated with certain embodiments of the present invention.

    [0086] FIG. 13 shows a neutralization curves for certain embodiments of the present invention created using differing production methods.

    [0087] Table 2 shows the efficiency of anti-GP antibody isolation from peripheral B cells.

    [0088] Table 3 shows the cross-reactivity of candidate pan-ebolavirus mAbs against different ebolavirus species. Reactivity was measured by ELISA.

    [0089] Table 4 shows the in vitro neutralization activity and affinities of candidate pan-ebolavirus mAbs.

    [0090] Table 5 shows that mice infected with EBOV and subsequently treated with the monoclonal antibodies described above showed increased survival compared to mice treated with PBS.

    [0091] Table 6 is a summary of rVSV-GP neutralization by cross-neutralizing human mAbs.

    [0092] Table 7 is a summary of authentic ebolavirus neutralization by cross-neutralizing human mAbs.

    [0093] Table 8 shows K.sub.D values for recognition of EBOV GPTM by mature PE-87 bearing the indicated mutations in the CDR-H3 loop were determined by BLI. 95% confidence intervals are reported for each binding constant. IC.sub.50 values for neutralization of rVSVs bearing ebolavirus GPs by mature PE-87 bearing the indicated mutations in the CDR-H3 loop.

    [0094] Table 9 shows the mAb protection of mice after challenge with EBOV or SUDV.

    DESCRIPTION OF THE PREFERRED EMBODIMENTS

    [0095] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned above and hereunder are incorporated herein by reference.

    Definitions

    [0096] As used herein, neutralizing antibody (NAb) refers to an antibody, for example, a monoclonal antibody, capable of disrupting a formed viral particle or inhibiting formation of a viral particle or prevention of binding to or infection of mammalian cells by a viral particle. As used herein, diagnostic antibody or detection antibody or detecting antibody refers to an antibody, for example, a monoclonal antibody, capable of detecting the presence of an antigenic target within a sample. As will be appreciated by one of skill in the art, such diagnostic antibodies preferably have high specificity for their antigenic target. As used herein, human antibodies refer to antibodies that were isolated from the B cells of a human or directly from the sequence of serum antibodies.

    [0097] A therapeutically effective treatment refers a treatment that is capable of producing a desired effect. Such effects include, but are not limited to, enhanced survival, reduction in presence or severity of symptoms, reduced time to recovery, and prevention of initial infection. Therapeutically effective permutations of a mAb may enhance any of the above characteristics in a manner that is detectable by routine analysis of patient data. In certain embodiments, such therapeutically effective mutations include mutations that improve the stability, solubility, or production of the mAb, including mutations to the framework regions of the mAb sequence.

    [0098] As used herein, immunoreactive fragment refers in this context to an antibody fragment reduced in length compared to the wild-type or parent antibody which retains an acceptable degree or percentage of binding activity to the target antigen. As will be appreciated by one of skill in the art, what is an acceptable degree will depend on the intended use.

    [0099] As used herein, a mAb has pan-Ebola binding characteristics if it is capable of binding to at least 2, but preferable more, ebolavirus species.

    [0100] The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one light (about 25 kDa) and one heavy chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.

    [0101] Light chains are classified as kappa and lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgG, IgM, IgA, IgD and IgE, respectively. Within each isotype, there may be subtypes, such as IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, etc. Within light and heavy chains, the variable and constant regions are joined by a J region of about 12 or more amino acids, with the heavy chain also including a D region of about 3 or more amino acids. The particular identity of constant region, the isotype, or subtype does not impact the present invention. The variable regions of each light/heavy chain pair form the antibody binding site.

    [0102] Thus, an intact antibody has two binding sites. The chains all exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. The CDRs from the two chains of each pair are aligned by the framework regions, enabling binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with well known conventions [Kabat Sequences of Proteins of Immunological Interest National Institutes of Health, Bethesda, Md..sub.s 1987 and 1991; Chothia, et al., J. Mol. Biol. 196:901-917 (1987); Chothia, et al., Nature 342:878-883 (1989)].

    [0103] In another embodiment of the invention, there are provided glycoengineered variants of the monoclonal antibodies that contain predominantly a single glycoform. These glycans can be GnGn (GlcNAc.sub.2-Man.sub.3-GlcNAc.sub.2), mono- or di-galactosylated (Gal.sub.(1/2)-GlcNAc.sub.2-Man.sub.3-GlcNAc.sub.2) (hereinafter mono-galactosylated=G1, di-galactosylated=G2, and a combination of the two, in any proportion=G/G2), mono- or di-sialylated (NaNa.sub.(1,2)-Gal.sub.(1/2)-GlcNAc-Man.sub.3-GlcNAc) containing little or no fucose or xylose. A predominantly single glycoform is any glycoform that represents more than half (e.g. greater than 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%) of all glycoforms present in the antibody solution.

    [0104] The RAMP system has been used for glycoengineering of antibodies, antibody fragments, idiotype vaccines, enzymes, and cytokines. Dozens of antibodies have been produced in the RAMP system by Mapp (5, 6) and others (7, 8). These have predominantly been IgGs but other isotypes, including IgM (9, 10), have been glycoengineered. Glycoengineering has also been extended to human enzymes in the RAMP system (11, 12). Since the RAMP system has a rapid turn-around time from Agrobacterium infection to harvest and purification (13) patient specific idiotype vaccines have been used in clinical trials for non-Hodgkins lymphoma (7).

    [0105] For glycoengineering, recombinant Agrobacterium containing a mAb cDNA is used for infection of N. benthamiana in combination with the appropriate glycosylation Agrobacteria to produce the desired glycan profile. For wild-type glycans (i.e. native, plant-produced glycosylation) wild-type N. benthamiana is inoculated with only the Agrobacterium containing the anti-M2e cDNA. For the GnGn glycan, the same Agrobacterium is used to inoculate plants that contain little or no fucosyl or xylosyl transfrases (XF plants). For galactosylated glycans, XF plants are inoculated with the Agrobacterium containing the mAb cDNA as well as an Agrobacterium containing the cDNA for 0-1,4-galactosyltransferase expression contained on a binary Agrobacterium vector to avoid recombination with the TMV and PVX vectors (14). For sialylated glycans, six additional genes are introduced in binary vectors to reconstitute the mammalian sialic acid biosynthetic pathway. The genes are UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase, N-acetylneuraminic acid phosphate synthase, CMP-N-acetylneuraminic acid synthetase, CMP-NeuAc transporter, -1,4-galactosylatransferase, and 2,6-sialyltransferase (14).

    [0106] Glycanalysis of glycoengineered mAbs involved release of N-linked glycans by digestion with N-glycosidase F (PNGase F), and subsequent derivatization of the free glycan is achieved with anthranilic acid (2-AA). The 2-AA-derivatized oligosaccharide is separated from any excess reagent via normal-phase HPLC. The column is calibrated with 2-AA-labeled glucose homopolymers and glycan standards. The test samples and 2-AA-labeled glycan standards are detected fluorometrically. Glycoforms are assigned either by comparing their glucose unit (GU) values with those of the 2-AA-labeled glycan standards or by comparing with the theoretical GU values (15). Confirmation of glycan structure was accomplished with LC/MS.

    [0107] While the RAMP system is an effective method of producing various glycoengineered and wild-type mABs, it will be recognized that other expression systems may be used to accomplish the same result. For example, mammalian cell lines (such as CHO or NSO cells [Davies, J., Jiang, L., Pan, L. Z., LaBarre, M. J., Anderson, D., and Reff, M. 2001. Expression of GnTIII in a recombinant anti-CD20 CHO production cell line: Expression of antibodies with altered glycoforms leads to an increase in ADCC through higher affinity for FCyRIII. Biotechnol Bioeng 74:288-294]), yeast cells (such as Pichia pastoris [Gerngross T. Production of complex human glycoproteins in yeast. Adv Exp Med Biol. 2005; 564]) and bacterial cells (such as E. Coli) have been used produce such mABs.

    [0108] Described herein are mAbs, designated PE-24, PE-87, PE-47, PE-16, PE-64 and PE-05, which have surprisingly exhibited pan-Ebola neutralizing characteristics. The preferred antibodies of the present invention comprise mAbs with amino acid sequences sufficiently identical to referenced amino acid sequences. By sufficiently identical is intended an amino acid sequence that has at least about 60% or 65% sequence identity, about 70% or 75% sequence identity, about 80% or 85% sequence identity, about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity compared to a reference sequence using one of the alignment programs known in the art.

    [0109] The sequences below show the amino acid modifications to mAb PE-64 VH and VL amino acids to yield mAb PE-47 (Modifications are shown in Bold, CDR sequences are Underlined).

    TABLE-US-00001 mAbPE-64VHaminoacids: SEQIDNo.11 EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR IKSKTDGGTIDYAAPVKGRFTISRDDSKNTVYLQMTSLKTEDTAVYYCTT YTEDMRYFDWLLRGGETFDYWGQGTLVTVSS mAbPE-47VHaminoacids: SEQIDNo.12 EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGEGLEWVGR IKSKTDGGTIDYAAPVKGRFTISRDDSKNTVYLQMTSLKTEDTAVYYCTT YTEDMQYFDWLLRGGETFDYWGQGTLVTVSS mAbPE-64VLaminoacids: SEQIDNo.13 DIRLTQSPSSLSASVGDRVTITCRASHYISTYLNWYQQKPGKAPKLLIYA ASNLQSGVPSRFSGSGFGTDFSLTISSLQPEDFATYHCQQSYSTPGRYTF GQGTKVEIK mAbPE-47VLaminoacids: SEQIDNo.14 DIQMTQSPSSLSASVGDRVTITCRASQYISTYLNWYQQKPGKAPKLLIYA AYNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPGRYTF GQGTKVEIK

    [0110] The antibodies displayed below were isolated from the peripheral B cells of a survivor of the 2014 Ebola virus outbreak in West Africa (CDR amino acids are disclosed in Table 1).

    [0111] PE-87 VH amino acids: SEQ ID No. 15

    [0112] PE-87 VH nucleotides: SEQ ID No. 16

    [0113] An alternative PE-87 VH amino acid sequence is: SEQ ID No. 17 (alterations shown in Bold and Underlined)

    TABLE-US-00002 EVQLVESGGGLVQPGGSLRVSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGLGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDH RVWAAGYHFDYWGQGTLVTVSS

    [0114] PE-87 VL amino acids: SEQ ID No.18

    [0115] PE-87 VL nucleotides: SEQ ID No. 19

    [0116] An alternative PE-87 VL amino acid sequence is: SEQ ID No. 20 (alterations shown in Bold and Underlined)

    TABLE-US-00003 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGEAPKLLISD ASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYYSSPTFGGG TKVEIK

    [0117] PE-24 VH amino acids: SEQ ID No. 21

    [0118] PE-24 VH nucleotides: SEQ ID No. 22

    [0119] PE-24 VL amino acids: SEQ ID No. 23

    [0120] PE-24 VL nucleotides: SEQ ID No. 24

    [0121] PE-47 VH amino acids: SEQ ID No. 25

    [0122] PE-47 VH nucleotides: SEQ ID No. 26

    [0123] PE-47 VL amino acids: SEQ ID No.27

    [0124] PE-47 VL nucleotides: SEQ ID No. 28

    [0125] PE-16 VH amino acids: SEQ ID No.29

    [0126] PE-16 VH nucleotides: SEQ ID No.30

    [0127] PE-16 VL amino acids: SEQ ID No. 31

    [0128] PE-16 VL nucleotides: SEQ ID No. 32

    [0129] PE-05 VH amino acids: SEQ ID No. 33

    [0130] PE-05 VH nucleotides: SEQ ID No.34

    [0131] PE-05 VL amino acids: SEQ ID No. 35

    [0132] PE-05 VL nucleotides: SEQ ID No. 36

    [0133] PE-64 VH amino acids: SEQ ID No. 37

    [0134] PE-64 VH nucleotides: SEQ ID No. 38

    [0135] PE-64 VL amino acids: SEQ ID No. 39

    [0136] PE-64 VL nucleotides: SEQ ID No. 40

    TABLE-US-00004 TABLE1 AminoacidresiduescomprisingCDRsofanti-EbolamAbs (SEQIDNos.indicatedinparenthesis) MabVregion CDR1 CDR2 CDR3 PE-87VH GFTFSSYAMS(41) AISGLGGSTYYADSV(42) DHRVWAAGYHFDY(43) PE-87VL RASQSISSWLA(44) DASSLES(45) QQYYSSPT(46) PE-24VH GFTFSSYAMS(47) EISGLGGSTYYADSAK(48) DHRVWAPGYYFDH(49) PE-24VL RASQSISSWLA(50) DASSLES(51) QQYNRSPT(52) PE-47VH GFTFSNAWMS(53) RIKSKTDGGTIDYAAPVK(54) YTEDMQYFDWLLRGGETFDY(55) PE-47VL RASQYISTYLN(56) AAYNLQS(57) QQSYSTPGRYT(58) PE-16VH GYTFTTYYMH(59) IINPSGGITRYAQKFQ(60) DRYPVLFATDYGMDV(61) PE-16VL RASQSVSGYLA(62) DASNRAT(63) QQRSIWPPGVT(64) PE-05VH GFTFGDYAMS(65) FLRSKAYGGTAEYAASVK(66) DGFRGSSWGYSYYGMDV(67) PE-05VL SGSSSNIGGNTVS(68) TNDQRPS(69) WDDSLNGPVFGGGT(70) PE-64VH GFTFSNAWMS(71) RIKSKTDGGTIDYAAPVK(72) YTEDMRYFDWLLRGGETFDY(73) PE-64VL RASHYISTYLN(74) AASNLQS(75) QQSYSTPGRYT(76)

    [0137] In certain embodiments of the present invention, the above mAb sequences are affinity matured to enhance binding or otherwise improve the therapeutic efficacy of the antibody. In one embodiment, optimization of antibodies was performed via a light chain diversification protocol, and then by introducing diversities into the heavy chain and light chain variable regions as described below:

    [0138] CDRL1 and CDRL2 selection: The CDRL3 of a single antibody was recombined into a premade library with CDRL1 and CDRL2 variants of a diversity of 110.sup.8 and selections were performed with one round of MACS and four rounds of FACS. For each FACS round the libraries were affinity pressured using titrating amounts of an ebolavirus GP (for example, SUDV GP) and sorting was performed in order to obtain a population with the desired characteristics.

    [0139] VH Mut selection: The heavy chain variable region (VH) was mutagenized via error prone PCR. The library was then created by transforming this mutagenized VH and the heavy chain expression vector into yeast already containing the light chain plasmid of the parent. Selections were performed similar to previous cycles using FACS sorting for two rounds. For each FACS round the libraries were affinity pressured using titrating amounts of Sudan GP and sorting was performed in order to obtain a population with the desired characteristics.

    [0140] ADI-23774 (PE-47) was generated by combining the most improved HC (from the VH mut selection) with the most improved LC (from the L1/L2 selection).

    [0141] FIG. 1 illustrates the enhanced neutralization potential of the parent (PE-64), best VH mutant, best VL mutant, and best VH/VL mutant (PE-47).

    [0142] It will be apparent to those having skill in the art that these or alternate methods of affinity maturation may be used to rapidly and efficiently improve upon the desired characteristics of the mAb sequences described herein, and that routine analytical tools may be used to identify if any potential variant developed using these techniques possess the desired characteristic.

    [0143] These antibodies have high affinity and avidity for Ebola glycoproteins, which means that in certain embodiments they can be used as therapeutic reagents administered to an individual with an ebolavirus infection or as prophylactic reagents to prevent an ebolavirus infection or as highly sensitive diagnostic tools. In particular, we have found that PE-87 and PE-47 act primarily at a step that follows GP.fwdarw.GP.sub.CL cleavage and receptor engagement. Endosomally generated GP.sub.CL species (either alone or in complex with NPC1) is the presumptive final target of these mAbs. Strikingly, GP cleavage to GP.sub.CL enhanced the antiviral potencies of PE-64, PE-87, and PE-47 by 50-200 fold. Together, these results suggest that the broadly neutralizing mAbs PE-87 and PE-47 differ from previously described monospecific mAbs (KZ52, c2G4, and 4G7), in their ability to target and neutralize a cleaved GP species that is generated deep in the endocytic pathway. Conversely, the latter mAbs appear to act principally at and/or prior to the GP.fwdarw.GP.sub.CL cleavage step. PE-64 displayed a dual behavior, and may act both upstream, to block GP cleavage, and downstream, to target one or more GP.sub.CL-like species at or near the membrane fusion step. We assessed the protective efficacy of these broadly neutralizing human mAbs in three small-animal models of lethal ebolavirus challenge. First, wild type (WT) BALB/c mice were exposed to mouse-adapted EBOV (EBOV-MA), and then administered a single dose of each mAb at 2 days post-infection (300 g/animal). Cross-neutralizing mAbs were highly (80%) protective against EBOV in this stringent post-exposure setting, with little or no weight loss apparent in mAb-treated animals.

    [0144] FIG. 2 illustrates negative stain EM reconstructions of broadly neutralizing ebolavirus mAbs. A structure of ebolavirus GP (based on PDB IDs:5JQ3) displaying the antigenic surfaces and corresponding structural regions of interest. The disordered mucin domain (dashed lines), GP1, GP2, fusion loop, glycan cap in, CHR2 region and the N563-linked glycan. Top and side views are shown for negative stain EM 3D reconstructions of Fab models of PE-87, PE-47, PE-24 and PE-16 (shown in dark gray) in complex with EBOV GP.

    [0145] We next evaluated the NAbs in the Type I interferon / receptor-deficient mouse model for SUDV challenge. Mice were exposed to WT SUDV, and then dosed with each NAb on days 1 and 3 post-infection (300 g/animal/dose). The pan-ebolavirus mAbs PE-87 and PE-47 afforded 295% survival and greatly reduced weight loss, relative to the PBS control group. By contrast, PE-16 and PE-64, both weak SUDV neutralizers, provided little or no protection against SUDV.

    [0146] Finally, we tested the anti-BDBV efficacy of the two pan-ebolavirus human mAbs, PE-87 and PE-47, in the domestic ferret, which is the only described non-NHP model for BDBV challenge. Animals received two doses of each NAb (15 mg and 10 mg per animal on days 3 and 6 post-challenge, respectively). As observed previously, BDBV infection was uniformly lethal, with PBS-treated animals succumbing between days 8-10 following challenge. By contrast, both mAbs afforded highly significant levels of survival (3 of 4 animals for PE-87; 2 of 4 for PE-24). Furthermore, peak viremia levels correlated with mAb treatment and survival outcome, with lower viral titers observed in the surviving animals relative to those that succumbed to infection (p<0.001), and in mAb-treated animals relative to PBS-treated controls (p<0.001). Viremia also trended lower in animals receiving PE-87 relative to those receiving PE-47, but this difference did not reach statistical significance. In sum, our findings demonstrate that the pan-ebolavirus mAbs PE-87 and PE-47 can afford post-exposure protection against challenge by the three divergent ebolaviruses currently associated with lethal disease outbreaks in humans.

    [0147] In another embodiment of the present invention, the mAbs of the present invention have been shown to provide complete protection to a non-human primate model of Ebola virus challenge. Four days after exposure to a lethal challenge of EBOV virus, a group of rhesus macaque monkeys were treated with either one dose of an NAb cocktail (comprising 25 mg/kg each of PE-87 and PE-47) or two doses of the same NAb cocktail (one at 4 days post infection, comprising 50 mg/kg of the NAbs, and another at 7 days post infection, comprising 25 mg/kg of the NAbs). As previously observed, EBOV infection was uniformly lethal, with the all PBS-treated animals succumbing by the 7.sup.th day post infection. By contrast, every animal from the NAb treatment groups survived, with no detectable viral RNA present in the blood of the treatment groups 10 days following the initial treatment, as assayed via qRT-PCR.

    [0148] The NAb cocktail of PE-87 and PE-47 (also referred to herein as MBP134) was further tested as follows. First, escape mutants that were resistant to the individual components of MBP134 were generated. Escape mutant selections were performed by serial passage of rVSV-GP particles in the presence of test antibody. Briefly, serial 3-fold dilutions of virus were preincubated for one hour with a concentration of antibody corresponding to the IC.sub.90 value derived from neutralization assays, and then added to confluent monolayers of Vero cells in 12-well plates, in duplicate. Infection was allowed to proceed to completion (>90% cell death by eye), and supernatants were harvested from the infected wells that received the highest dilution (i.e., the least amount) of viral inoculum. Following three subsequent passages under antibody selection with virus-containing supernatants as above, supernatants from passage 4 were tested for viral neutralization escape. If resistance was evident, individual viral clones were plaque-purified on Vero cells, and their GP gene sequences were determined as described previously (Wong et al., 2010).

    [0149] FIG. 3 illustrates the mutations to the rVSV-GP and their relative locations within the three-dimensional structure of the viral glycoprotein for the two escape mutants that were most resistant to PE-47 (MBP047) and PE-87 (MBP087) respectively. Namely, the PE-87 escape mutant contained a G528E substitution, while the PE-47 escape mutant contained a N514D substitution.

    [0150] FIG. 4 illustrates the dose response curves of the above-mentioned escape mutants and the wild-type SUDV virus to concentrations PE-47 and PE-87. Importantly with regard to the efficacy of a multi-mAb cocktail, the escape mutations which provided resistance to one mAb resulted in significantly enhanced neurtralization by the other. As such, in certain embodiments of the present invention, a combination of multiple antibodies is provided which significantly reduce the risk of viral resistance development.

    [0151] As noted above, antibodies comprising a substantially single glycan and lacking fucose show enhanced efficacy in patients. To determine if afucosylated MBP134 has increased efficacy in mammals, fucosylated and afucosylated versions of the cocktail were used to treat guinea pigs challenged with a lethal dose of EBOV. All guinea pigs were healthy and immune competent as per vendor's representation. All guinea pigs were drug and test naive. Animals were monitored daily for food and water consumption and given environmental enrichment according to the guidelines for the species. Cleaning of the animals was completed three times per week which included a complete cage and bedding material change. Animals were kept two or three per cage in the large shoe box cages from IVC Alternative Design. Each unit is ventilated with a HEPA blower system. 4-6 week old female Hartley guinea pigs (250-300 g) were randomly assigned to experimental groups and challenged via IP with a 1000LD50 of guinea pig adapted EBOV/Mayinga in 1 mL of DMEM. Either MBP134 or the afucosylated MBP134-N was given IP at indicated time points and doses, with 6 guinea pigs/group (n=6). Control guinea pigs with 4 animals/group (n=4), were given PBS treatment. Animals were observed for clinical signs of disease, survival and weight change for 15-16 days, while survival was monitored for an additional 12 days.

    [0152] FIG. 5 illustrates the survival curves of the afucosylated vs. fucosylated MBP134 at various doses. The afucosylated cocktail showed dramatically improved survival, even at the lowest dosage tested. Furthermore, blood drawn from the animals showed significantly increased immune reactions in response to treatment with afucosylated PE-47 and PE-87, as compared to their fucosylated counterparts and other anti-EBOV mAbs c13C6 (also afucosylated) and 2G12, as illustrated in FIG. 6. Thus, in certain embodiments of the present invention, there is provided a monoclonal antibody that substantially lacks fucose.

    [0153] To determine the ability of the afucoslyated MBP134 to neutralize multiple strains of the ebolavirus, a dose down study of guinea pigs infected with a lethal dose of SUDV was conducted. As illustrated in FIG. 7, animals treated at three and four days post infection had 100% survival, while even treatment at 5 dpi resulted in a dramatic increase in survival. To determine if a lower dose of MBP134 would be effective at 4 dpi, and if a higher dose would lead to increased survival if administered at 5 dpi, further tests were conducted. As illustrated in FIG. 8, reduced doses of MBP134 administered at 4 dpi resulted in excellent, though not perfect, survival rates among the treated animals. Furthermore, doubling the dose administered at 5 dpi resulted in all of the infected animals surviving. In certain embodiments of the present invention, the increase dosage of the monoclonal antibodies at later dates post infection allows the host animals to overcome the increased viral load associated with the infection. Thus, in certain embodiments of the present invention, a patient is treated with an effective dose of a monoclonal antibody or combination of monoclonal antibodies. An effective dose includes, but is not limited to, 0.01 mg/kg, 0.05 mg/kg, 0.1 mg/kg, 0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 2 mg/kg, 5 mg/kg, 10 mg/kg, 25 mg/kg, 50 mg/kg, and 100 mg/kg

    [0154] To further explore the ability of the monoclonal antibodies disclosed herein to protect against multiple strains of the ebolavirus in mammals, female ferrets were infected with various strains of ebolavirus and treated with different dosages of MBP134. Female ferrets weighing 0.75-1 kg were housed 2-3 per cage per study. Ferrets were anesthetized by intramuscular injection with a ketamine-acepromazine-xylazine cocktail prior to all procedures. Prior to challenge, transponder chips (Bio-Medic Data Systems) were subcutaneously implanted for identification and temperature monitoring. Subjects were challenged intranasally with a lethal dose of 1000 plaque-forming units (PFU) ofZEBOV strain Kikwit, SEBOV strain Gulu, or BDBV and treated with MBP134-N at the times and dosing shown in FIG. 9. As shown in FIG. 9, two doses of 15 mg at two or three dpi and five or six dpi were sufficient to offer full survival to the infected mammals. Furthermore, the results illustrated here, combined with those discussed above, indicate that the MBP134 cocktail provides protection against many different stains of ebolavirus in mammals.

    [0155] To determine if this protection extends to primates, rhesus macaques were infected with a lethal dose of EBOV/Kikwit and treated with the monoclonal antibodies of the present invention. Rhesus macaques at UTMB were challenged by intramuscular injection (IM) with 1,000 PFU of EBOV/Kikwit. Two treatment groups (n=4/group) were treated either with a single 25 mg/kg dose of MBP134-N on day 4 or two doses of MBP134-N day 4 (50 mg/kg) and day 7 (25 mg/kg) post infection. Control animals (n=2) were treated with PBS. All the macaques were given physical examinations and blood was collected at the time of viral challenge; and on days 4, 7, 10, 14, 21, and 28 after challenge. The macaques were monitored daily and scored for disease progression with an internal filovirus scoring protocol approved by the UTMB Institutional Animal Care and Use Committee (IACUC) in accordance with state and federal statutes and regulations relating to experiments involving animals and by the UTMB Institutional Biosafety Committee. The scoring changes measured from baseline included posture/activity level; attitude/behavior; food and water intake; weight; respiration; and disease manifestations, such as visible rash, hemorrhage, ecchymosis, or flushed skin, with increased scores resulting in euthanasia. As illustrated in FIG. 10, all of the treated primates survived the lethal challenge of ebolavirus.

    [0156] As illustrated in FIG. 11, the protection offered to primates by the antibodies of the present invention extends to multiple strains of ebolavirus. Even a single dose of MBP134 is sufficient to protect from a lethal challenge of both SUDV/Nza-Boniface and SUDV/Gulu in rhesus macaques.

    [0157] Furthermore, the monoclonal antibodies of the present invention provide protection from ebolavirus challenge in different species of primate. Cynomolgus monkeys at UTMB were challenged by intramuscular injection (IM) with 1,000 PFU of BDBV (200706291 Uganda isolate, Vero E6 passage 2). One treatment group (n=6) was treated with a single 25 mg/kg dose of MBP134 (from CHOK1-AF) on day 7 post infection via IV infusion. Control animals (n=3) were untreated. All the animals were given physical examinations and blood was collected at the time of viral challenge; and on days 4, 7, 10, 14, 21, and 28 after challenge (or at time of euthanasia). All animals were monitored daily and scored for disease progression with an internal filovirus scoring protocol approved by the UTMB Institutional Animal Care and Use Committee. The scoring changes measured from baseline included posture/activity level, attitude/behavior, food intake, respiration, and disease manifestations such as visible rash, hemorrhage, ecchymosis, or flushed skin. A score of 9 indicated that an animal met criteria for euthanasia. As illustrated in FIG. 12, a single dose of MBP134 as late as one-week post infection is sufficient to offer excellent protection.

    [0158] In order to optimize the production methodology of the monoclonal antibodies disclosed herein, the ability of PE-87 and PE-47 produced in plants or CHO cells to neutralize numerous strains of ebolavirus were tested. As illustrated in FIG. 13, monoclonal antibodies produced in both plant and CHO based systems possess similar neurtralization characteristics. As such, these, or other systems known in the art, may be used to produce the monoclonal antibodies of the present invention.

    [0159] It is of note that as discussed herein, any of the above described antibodies may be formulated into a pharmaceutical treatment for providing passive immunity for individuals suspected of or at risk of developing hemorrhagic fever comprising a therapeutically effective amount of said antibody. The pharmaceutical preparation may include a suitable excipient or carrier. See, for example, Remington: The Science and Practice of Pharmacy, 1995, Gennaro ed. As will be apparent to one knowledgeable in the art, the total dosage will vary according to the weight, health and circumstances of the individual as well as the efficacy of the antibody. While the preferred embodiments of the invention have been described above, it will be recognized and understood that various modifications may be made therein, and the appended claims are intended to cover all such modifications which may fall within the spirit and scope of the invention.

    Materials and Methods 1

    Human Subjects

    [0160] Human blood samples were collected after Institutional Review Board (IRB) approval of a protocol to isolate B cells from healthy adult volunteers to identify antibodies elicited from prior immunization or infections. Eligible subjects were determined based on immunization and infection history recorded on a self-reported questionnaire completed prior to sample collection. Peripheral blood mononuclear cells were obtained from a survivor of the 2014 EBOV outbreak three months after the patient had been diagnosed with EBOV infection.

    B cell and plasma isolation

    [0161] Approximately 85 ml of whole blood was collected in 8.5 ml ACD Solution A Vacutainer venous blood collection tubes (Becton Dickinson) per the manufacturer's protocol. Blood was transported at room temperature and distributed into 50 ml conical tubes before addition of 300 l of RosetteSep human B cell enrichment cocktail (StemCell Technologies) per 21 ml of blood, mixed by inversion and incubated for 20 minutes at room temperature. The total volume was brought to 50 ml with Hank's Balanced Salt Solution (HBSS), layered over Ficoll-Paque Plus (GE Healthcare) and centrifuged following the manufacturer's protocol. The B cell layer was removed from the density gradient by pipette, washed twice in HBSS by centrifugation at 400g, frozen at 6.5106 cells/ml in a 1:1 mixture of FBS (Life Technologies) and cryoprotective medium (Lonza) and stored under liquid nitrogen. Plasma was collected from the top layer of the density gradient and stored at 80 C. until use.

    TABLE-US-00005 TABLE 2 Efficiency of anti-GP mAb isolation from peripheral B cells. Total number of IgG + B cells sorted: 600 Number of antibodies cloned: 420 (70%) Number of clones expressing IgG: 378 (63%) Number of EBOV GP binders: 349 (58%)

    Anti-EBOV GP Plasma ELISA

    [0162] A high-binding ELISA plate was coated with 1 g/ml of EBOV rGPTM (IBT BioSciences) diluted in PBS overnight at 4 C. After washing, wells were blocked with 1% BSA in PBS and 0.05% Tween-20 for 2 hours at room temperature. Wells were washed and serial dilutions of human plasma (diluted in blocking buffer) were added and incubated for 1.5 hours at room temperature. As positive and negative controls, serial dilutions of mAb KZ52 (IBT BioSciences) or an irrelevant human mAb, respectively, were added to appropriate wells. After washing, HRP-conjugated donkey anti-human IgG (Jackson ImmunoResearch) or HRP-conjugated goat anti-human IgA (Southern Biotech) secondary antibody was incubated in appropriate wells for 1.25 hours at room temperature. Wells were washed twice and developed with SureBlue TMB substrate (KPL). The reaction was stopped with 1M HCl and wells were read on an EMax Microplate Reader (Molecular Devices) at 450 nm wavelength. Plasma endpoint titers were determined by calculating the highest serum dilution that gives a reading above the blank including three standard deviations.

    Single B Cell Sorting

    [0163] Purified B cells were stained using anti-human IgM (BV605), IgD (BV605), IgG (BV421), CD8 (APC-Cy7), CD14 (AF700), CD19 (PerCP-Cy5.5), CD20 (PerCP-Cy5.5) and biotinylated EBOV GPTM. Biotinylated GPTM was used at a concentration of 50 nM and detected using streptavidin-APC (Life Technologies) at a dilution of 1:500. Single cells were sorted on a MoFlo cytometer (Beckman-Coulter) into 96-well PCR plates (BioRad) containing 20 l/well of lysis buffer [5 l of 5 first strand cDNA buffer (Invitrogen), 0.5 l RNaseOUT (Invitrogen), 1.25 l dithiothreitol (Invitrogen), 0.625 l NP-40 (New England Biolabs), and 12.6 l dH2O]. Plates were immediately frozen on dry ice before storage at 80 C.

    Amplification and Cloning of Antibody Variable Genes

    [0164] Single B cell PCR was performed essentially as previously described [27]. Briefly, IgH, Ig and Ig variable gene transcripts were amplified by RT-PCR and nested PCR reactions using cocktails of primers specific for IgG [27]. The primers used in the second round of PCR contained 40 base pairs of 5 and 3 homology to the cut expression vectors to allow for cloning by homologous recombination into Saccharomyces cerevisiae [28]. PCR products were cloned into S. cerevisiae using the lithium acetate method for chemical transformation [29]. Each transformation reaction contained 20 l of unpurified heavy chain and light chain PCR product and 200 ng of cut heavy and light chain plasmids. Individual yeast colonies were picked for sequencing and down-stream characterization.

    Expression and Purification of Antibodies and Fab Fragments

    [0165] Antibodies used for binding experiments, competition assays, neutralization assays, and structural studies were expressed in Saccharomyces cerevisiae cultures grown in 24 well plates. After 6 days of growth, the yeast cell culture supernatant was harvested by centrifugation and subject to purification. IgGs used in protection experiments were expressed by transient co-transfection of heavy and light chain plasmids into HEK293 cells. One day prior to transfection, HEK293 cells were passaged at 2.0-2.5106 cells/ml. On the day of transfection, cells were pelleted by centrifuging at 400 g for 5 min, and cell pellets were resuspended in fresh FreeStyle F17 medium at a density of 4106 cells/ml and returned to the incubator. A transfection mixture was prepared by first diluting the plasmid DNA preparations in FreeStyle F17 medium (1.33 g total plasmid DNA per ml of culture). Transfection agent, PEIpro (Polyplus Transfection, Illkirch, France), was then added to the diluted DNA at a DNA-to-PEI ratio of 1:2, and the mixture was incubated at room temperature for 10 min. The transfection mixture was then added to the culture. Cultures were harvested six days post transfection by two rounds of centrifugation, each at 2000g for 5 min, and the clarified conditioned medium subject to antibody purification. Cell supernatents were purified by passing over Protein A agarose (MabSelect SuRem from GE Healthcare Life Sciences). The bound antibodies were washed with PBS, eluted with 200 mM acetic acid/50 mM NaCl pH 3.5 into .sup.th volume 2M Hepes pH 8.0, and buffer-exchanged into PBS pH 7.0. Fabs were generated by digesting the IgGs with papain for 2 h at 30 C. The digestion was terminated by the addition of iodoacetamide, and the Fab and Fc mixtures were passed over Protein A agarose to remove Fc fragments and undigested IgG. The flowthrough of the Protein A resin was then passed over CaptureSelect IgG-CH1 affinity resin (ThermoFischer Scientific), and eluted with 200 mM acetic acid/50 mM NaCl pH 3.5 into th volume 2M Hepes pH 8.0. Fab fragments then were buffer-exchanged into PBS pH 7.0.

    Expression and Purification of EBOV GPs

    [0166] Recombinant EBOV GP ectodomains containing the mucin-like domain (EBOV GPTM) or lacking residues 312-463 of the mucin-like domain (EBOV GPAmuc) were produced as described previously [10, 30].

    EBOV GPTM Biotinylation

    [0167] EBOV GPTM was biotinylated using EZ-Link Sulfo-NHS-LC-Biotin (Life Technologies) followed by a desalting step by a Zeba Spin Desalting Column (Life Technologies).

    Biolayer Interferometry Binding Analysis

    [0168] IgG binding to the different GP antigens was determined by BLI measurements using a FortBio Octet HTX instrument (Pall Life Sciences). For high-throughput KD screening, IgGs were immobilized on AHQ sensors (Pall Life Sciences) and exposed to 100 nM antigen in PBS containing 0.1% BSA (PBSF) for an association step, followed by a dissociation step in PBSF buffer. Data was analyzed using the ForteBio Data Analysis Software 7. The data was fit to a 1:1 binding model to calculate an association and dissociation rate, and KD was calculated using the ratio kd/ka.

    Anti-GP mAb ELISAs

    [0169] ELISA plates were coated with 50 l PBS containing 4 g/mL EBOV GP antigens for 1 h at room temperature. After washing, wells were blocked with 3% BSA for 1 h at room temperature. After removal of the blocking solution, mAbs were applied to the plates at a concentration of 0.2 g/ml and incubated at room temperature for 1 h. After washing, binding was detected with an anti-human HRP-conjugated secondary antibody and TMB substrate. Optical density was read at 450 nm.

    TABLE-US-00006 TABLE 3 Cross-reactivity of pan ebolavirus mAbs (elisa) mAb EBOV SUDV BDBV RESTV TAFV MARV sGP GPcl PE-24 YES YES YES YES YES NO NO YES PE-05 YES YES YES YES YES NO YES NO PE-87 YES YES YES YES YES NO NO YES PE-16 YES WEAK YES NO YES NO NO YES PE-47 YES YES YES NP YES NO NO YES

    Antibody Competition Assays

    [0170] Antibody competition assays were performed essentially as previously described [31]. Antibody competition was measured by the ability of a control anti-EBOV GP Fab to inhibit binding of yeast surface-expressed anti-GP IgGs to GPAmuc. 50 nM biotinylated GPAmuc was pre-incubated with 1 M competitor Fab for 30 min at RT and then added to a suspension of yeast-expressed anti-GP IgG. Unbound antigen was removed by washing with PBSF. After washing, bound antigen was detected using Streptavidin Alexa Fluor 633 at a 1:500 dilution (Life Technologies) and analyzed by flow cytometry using a BD FACS Canto II. Results are expressed as the fold reduction in antigen binding in the presence of competitor Fab relative to an antigen-only control.

    Neutralization Assays

    [0171] Virus-specific neutralizing antibody responses were titrated essentially as previously described [32]. Briefly, plasma or antibodies were diluted serially in Minimal Essential Medium (Corning Cellgro, Manassas, Va.) containing 5% heat-inactivated fetal bovine serum (Gibco-Invitrogen, Gaithersburg, Md.), 1 Anti-Anti (Gibco-Invitrogen, Gaithersburg, Md.) (MEM complete) and incubated 1 hour at 37 C. with virus. After incubation, the antibody-virus or plasma-virus mixture was added in duplicate to 6-well plates containing 90-95% confluent monolayers of Vero E6 cells. Plates were incubated for 1 hour at 37 C. with gentle rocking every 15 minutes. Following the incubation, wells were overlaid with 0.5% agarose in supplemented EBME media, 10% heat-inactivated fetal bovine serum (Gibco-Invitrogen, Gaithersburg, Md.), 2 Anti-Anti (Gibco-Invitrogen, Gaithersburg, Md.), and plates were incubated at 37 C., 5% C02 for 7 days. On day 7, cells were stained by the addition of a second overlay prepared as above containing 4-5% neutral red. Plates were incubated for 18-24 hours at 37 C., 5% C02. The endpoint titer was determined to be the highest dilution with a 50% or greater or 80% or greater reduction (PRNT50, PRNT80) in the number of plaques observed in control wells. The assay limit of detection was calculated to be 5 plaque forming units (p.f.u.)/ml by this method.

    TABLE-US-00007 TABLE 4 Candidate pan-Ebolavirus mAbs in vitro activity Neutralization Neut. (VSV-GP IC.sub.50, nM) WT EBOV Microneut. WT Affinity EBOV PRNT.sub.50 IC.sub.50 (nM) mAb Epitope (KD, nM) EBOV SUDV BDBV RESTV TAFV GP.sub.CL (nM) EBOV SUDV BDBV PE-05 GC 44 8.8 34 3.7 22 0.8 NR 4.0 7.7 NR NR PE-87 IFL <0.01 0.5 0.3 0.5 0.2 1.0 0.2 <0.05 0.3 0.3 0.4 PE-16 Stalk 0.16 0.2 NR 0.6 NR 4.8 5.7 <0.02 0.05 NR 0.2 PE-47 Other 3.5 6.6 5.1 0.4 NR 6.1 0.08 NT 0.7 <0.1 0.5 PE-24 IFL 1 1.8 0.5 0.8 0.2 1.5 0.6 0.4 1 0.4 0.3 Epitope analyses and affinity measurements were performed by both Mapp and Integrated BioTherapeutics. VSV-GP assays were performed in Dr. K. Chandran's laboratory (Albert Einstein); neutralization assays with wildtype virus were performed in Dr. J. Dye's lab (USAMRIID); IFL = internal fusion loop; GC = glycan cap; RBS = receptor binding site; GP.sub.CL = cleaved GP, the form of GP exposed in the endosome when virus is internalized by the cell in preparation for fusion with the host cell receptor; P = in progress; NR = non-reactive; NT = not tested; WT = wildtype.

    Single-Particle Electron Microscopy

    [0172] For all EM studies the EBOV GPTM construct described above was used. Fabs were generated as described above and incubated with the EBOV GPTM trimer at a ratio of 1:10 for overnight at 4 C. Complexes were then deposited onto a carbon coated copper mesh grid and stained with 1% uranyl formate. Samples were imaged on a Tecnai F12 microscope using the automated image acquisition software Leginon [33]. Images were collected at 52,000 magnification resulting in a final pixel size at the specimen level of 2.05A using a Tietz 4K CMOS detector. Images were automatically uploaded to and processed within our Appion database [34]. Individual complexes were extracted from raw images using DogPicker [35] binned by 2 and placed into a stack. The stack was then subjected to reference free 2 dimensional classification using MRA/MSA [PMID 14572474]. Class averages that did not respond to Fab-EBOVTM complexes were removed from all subsequent analyses. A subset of 2D class averages was used to create an initial model using common lines within EMAN2 [36]. The raw particle stack was then refined against the initial model using EMAN2 to yield the final 3D volumes. UCSF Chimera was used for modeling and figure generation [37].

    EBOV Challenge Studies in Mice

    [0173] The lethal mouse-adapted EBOV mouse model was developed at the U.S. Army Medical Research Institute of Infectious Diseases (USAMRIID) by serial passages of EBOV (Zaire) in progressively older suckling mice [38]. Female BALB/c mice, aged 6 to 8 weeks, were purchased from Charles River Laboratory. Upon arrival, mice were housed in microisolator cages in an animal biosafety level 4 containment area and provided chow and water ad libitum. On day 0, mice were infected intraperitoneally (i.p.) with 100 p.f.u. of mouse-adapted EBOV. Two days post-infection, groups of mice (10 mice per group) were treated i.p. with a single dose (100 g) of antibody. Negative control mice received PBS. Mice were monitored daily (twice daily if there were clinical signs of disease) for 28 days post-infection. Group weights were taken on days 0-14, and on days 21 and 28 post-infection. Survival was compared using the log-rank test in GraphPad PRISM 5. Differences in survival were considered significant when the P value was less than 0.05. Research was conducted under an IACUC approved protocol in compliance with the Animal Welfare Act, PHS Policy, and other Federal statutes and regulations relating to animals and experiments involving animals. The facility where this research was conducted is accredited by the Association for Assessment and Accreditation of Laboratory Animal Care, International and adheres to principles stated in the Guide for the Care and Use of Laboratory Animals, National Research Council, 2011.

    TABLE-US-00008 TABLE 5 Therapeutic efficacy of mAbs in a mouse model of EBOV infection. Treatment No. survivors/ Average weight mAb competition group.sup.# total loss (%)* P value group PBS 2/10 8.8 N/A N/A 2G4 4/10 7.2 0.095 KZ52 competitor ADI-15956 7/10 8.6 0.008 HR2 PE-16 7/10 9.1 0.008 HR2 ADI-15974 8/10 8.0 0.002 HR2 ADI-15758 8/10 9.8 0.009 HR2 ADI-15999 10/10 8.1 <0.0001 HR2 ADI-15820 6/10 9.9 0.026 HR2 ADI-15848 7/10 8.2 0.008 HR2 ADI-15960 5/10 15.4 0.073 Undefined ADI-15903 4/10 8.4 0.079 Undefined ADI-15959 5/10 8.4 0.040 Undefined ADI-15765 4/10 5.9 0.102 Undefined ADI-15818 3/10 13.8 0.164 KZ52 competitor PE-87 8/10 10.4 0.005 KZ52 competitor ADI-15734 6/10 7.3 0.026 KZ52 competitor ADI-15784 8/10 9.1 0.002 KZ52 competitor ADI-15772 7/10 11.8 0.011 KZ52 competitor PE-24 10/10 10.5 0.0003 KZ52 competitor ADI-15731 4/10 9.2 0.059 13C6 competitor ADI-15932 4/10 12.1 0.139 13C6 competitor ADI-15940 4/10 11.0 0.059 13C6 competitor ADI-15744 4/10 12.3 0.095 13C6 competitor ADI-16037 8/10 7.0 0.005 13C6 competitor ADI-16044 2/10 9.9 0.263 13C6 competitor ADI-15817 4/10 9.9 0.095 13C6 competitor PE-47 9/10 10.1 0.006 Undefined PE-05 9/10 8.2 0.008 Undefined .sup.#Mice were given 100 ug of the indicated antibody, or PBS, two days post infection. *Average weight change from the pre-injection baseline to the peak of clinical disease. Mice were weighed as groups.

    SUDV Challenge Studies in Mice

    [0174] 4-5 week old, IFNa/bR KO mice will be inoculated I.P. with SUDV (1000 pfu). Experimental group will be treated with mAbs (0.3 ml volume) at indicated dose on days 1 and 4 post-infection. Control mice will vehicle control I.P. (0.3 ml volume) on the same schedule as experimental mice. Mice will be observed daily for 21 days for moribund condition. Moribund mice will be promptly euthanized (IAW SOP AC-11-07) when they meet euthanasia criteria (score sheet).

    Reagents and Animals Required:

    [0175]

    TABLE-US-00009 Number # of Treat- Dose of Animals to Challenge Challenge Group ment (ug) Animals Challenge Dose Virus Grp 1 PE-87 300 10 10 1000 pfu SUDV Grp 2 PE-24 300 10 10 1000 pfu SUDV Grp 3 PE-16 300 10 10 1000 pfu SUDV Grp 4 PBS n/a 10 10 1000 pfu SUDV Total 40 40
    Species: IFNa/bR KO; Number of pans: 4; Days Required: 21; mAb: 300 ug/dose (20 mg/kg): 300 ul of stock mAb per mouse

    TABLE-US-00010 Time Line Day Date Task 0 4 Feb. 2016 Challenge I.P. 1 5 Feb. 2016 Treat I.P. with 300 ul per mouse 4 8 Feb. 2016 Treat I.P. with 300 ul per mouse 21 25 Feb. 2016 Terminate Study

    Materials and Methods 2

    Cells

    [0176] Vero African grivet monkey cells and 293T human embryonic kidney fibroblast cells were maintained in high-glucose Dulbecco's modified Eagle medium (DMEM; Thermo Fisher) supplemented with 10% fetal bovine serum (Atlanta Biologicals), 1% GlutaMAX (Thermo Fisher), and 1% penicillin-streptomycin (Thermo Fisher). Cells were maintained in a humidified 37 C., 5% CO2 incubator.

    Vesicular Stomatitis Virus (VSV) Recombinants and Pseudotypes

    [0177] Recombinant vesicular stomatitis Indiana viruses (rVSV) expressing eGFP in the first position, and encoding representative GP proteins from EBOV/Mayinga (EBOV/H.sap-tc/COD/76/Yambuku-Mayinga), EBOV/Makona (EBOV/H.sap-rec/LBR/14/Makona-L2014), BDBV (BDBV/H.sap/UGA/07/But-811250), SUDV/Boneface (SUDV/C.por-lab/SSD/76/Boneface), RESTV (RESTV/M.fas-tc/USA/89/Phi89-AZ-1435), and LLOV (LLOV/M.sch-wt/ESP/03/Asturias-Bat86), in place of VSV G have been described previously [1-3]. VSV pseudotypes bearing eGFP and GP proteins from TAFV (TAFV/H.sap-tc/CIV/94/CDC807212) and MARV (MARV/H.sap-tc/KEN/80/Mt. Elgon-Musoke) were generated as described [4].

    Generation of Cleaved VSV-GP Particles and GPTM Ectodomain Proteins

    [0178] In some experiments, cleaved viral particles bearing GP.sub.CL were first generated by incubation with thermolysin (200 g/mL, pH 7.5, 37 C. for 1 h; Sigma-Aldrich) or recombinant human cathepsin L (CatL, 2 ng/L, pH 5.5, 37 C. for 1 h; R&D Systems), as described previously [1]. Reactions were stopped by removal onto ice and addition of phosphoramidon (1 mM) or E-64 (10 M), respectively, and viral particles were used immediately for infectivity assays. A recombinant, soluble GPTM protein [5] was also essentially as described above.

    VSV Infectivity Measurements and Neutralization Assays

    [0179] Viral infectivities were measured by automated counting of eGFP+ cells (infectious units; IU) using a CellInsight CX5 imager (Thermo Fisher) at 12-14 h post-infection. For mAb neutralization experiments, pre-titrated amounts of VSV-GP particles (MOI1 IU per cell) were incubated with increasing concentrations of test mAb at room temp for 1 h, and then added to confluent cell monolayers in 96-well plates. Viral neutralization data were subjected to nonlinear regression analysis to derive EC.sub.50 values (4-parameter, variable slope sigmoidal dose-response equation; GraphPad Prism).

    TABLE-US-00011 TABLE 6 rVSV-GP neutralization IC50 (nM).sup.1 mAb EBOV BDBV TAF SUDV RESTV PE-16 0.2 0.6 4.8 .sup.2 PE-05 9.0 4.0 0.8 34 22 PE-24 2.0 1.0 1.5 0.5 0.2 PE-87 0.5 0.5 1.0 0.3 0.2 PE-64 2.5 0.4 8 40 .sup.1IC.sub.50 (nM), mAb concentration that affords half-maximal neutralization of viral infectivity. .sup.2No detectable neutralizing activity.

    Authentic Filoviruses and Microneutralization Assays

    [0180] The authentic filoviruses EBOV/Zaire 1995 (EBOV/H.sap-tc/COD/95/Kik-9510621) [6], mouse-adapted EBOV/Mayinga (EBOV-MA) [7], SUDVBoneface-USAMRID111808, and BDBV/200706291 [8] were used in this study. Antibodies were diluted to indicated concentrations in culture media and incubated with virus for 1 h. Vero E6 cells were exposed to antibody/virus inoculum at an MOI of 0.2 (EBOV, BDBV) or 0.5 (SUDV)plaque-forming unit (PFU)/cell for 1 h. Antibody/virus inoculum was then removed and fresh culture media was added. At 48 h post-infection, cells were fixed, and infected cells were immunostained and quantitated by automated fluorescence microscopy, as described [3].

    TABLE-US-00012 TABLE 7 Authentic virus neutralization IC50 (nM).sup.1 mAb EBOV BDBV SUDV PE-16 0.1 0.3 300 PE-05 5.2 .sup.2 PE-24 0.7 0.6 0.2 PE-87 0.2 0.6 0.2 PE-64 0.6 1.5 120 .sup.1IC.sub.50 (nM), mAb concentration that affords half-maximal neutralization of viral infectivity. .sup.2No detectable neutralizing activity.
    Generation of mAbs

    [0181] Recombinant mAbs from the human EBOV disease survivor, as well as germline-reverted (IGL) mAb constructs and WT:IGL chimeras of PE-87 were expressed in Saccharomyces cerevisiae and purified from cell supernatants by protein A affinity chromatography, as described previously [5]. Other recombinant mAbs were produced in 293F cells by transient transfection, and purified by protein A affinity chromatography, as described previously [3].

    ELISAs for GP:mAb Binding

    [0182] To identify GP cross-reactive mAbs, normalized amounts of rVSVs bearing EBOV, BDBV, and SUDV GP were coated onto plates at 4 C. Plates were then blocked with PBS containing 3% bovine serum albumin (PBSA), and incubated with dilutions of test antibody (5, 50 nM). Bound Abs were detected with anti-human IgG conjugated to horseradish peroxidase (Santa Cruz Biotechnology) and Ultra-TMB colorimetric substrate (Thermo Fisher). All incubations were performed for 1 h at 37 C.

    Competition ELISAs for GP/mAb Binding to NPC1

    [0183] The viral lipid envelopes of rVSV-EBOV GP particles were labeled with biotin using a function-spacer-lipid construct (FSL-biotin) (Sigma-Aldrich) for 1 h at pH 7.5 and 37 C., as described [2]. Biotinylated viral particles bearing GP.sub.CL were generated by incubation with thermolysin, and then captured onto high-binding 96-well ELISA plates precoated with recombinant streptavidin (0.65 g/mL; Sigma-Aldrich). Plates were then blocked with PBSA, and incubated with serial dilutions of test mAbs. Washed plates were then incubated with a pre-titrated concentration of soluble, FLAG epitope-tagged, NPC1 domain C (NPC1-C) protein [9], and bound NPC1-C was detected with an anti-FLAG antibody conjugated to horseradish peroxidase (Sigma-Aldrich). All incubations were performed for 1 h at 37 C.

    ELISAs and Immunoblots to Detect mAb Inhibition of GP Cleavage

    [0184] We used exposure of the NPC1-binding site in EBOV GP.sub.CL as a proxy for successful GP.fwdarw.GP.sub.CL cleavage by CatL. rVSV-EBOV GP particles, biotinylated as above, were preincubated with mixtures of test mAb and irrelevant human IgG (test mAb at 50, 250, or 1000 nM; 1000 nM total IgG per reaction) for 1 h at pH 5.5 and 37 C. Reactions were then incubated with CatL (4 ng/L and 37 C. for 30 min). Reactions were then stopped with E-64, readjusted to neutral pH with PBS, and captured onto streptavidin-coated ELISA plates. NPC1-C binding was measured as above.

    [0185] Samples treated with the highest concentration of test mAb were also subjected to western blotting. Cleaved GP1 species were detected by immunoblotting with h21D10 mAb (a gift from Dr. Javad Aman) directly conjugated to horseradish peroxidase.

    Selection of Viral Neutralization Escape Mutants

    [0186] Escape mutant selections were performed by serial passage of rVSV-GP particles in the presence of test mAb. Briefly, serial 3-fold dilutions of virus were preincubated with a concentration of mAb corresponding to the IC.sub.90 value derived from neutralization assays, and then added to confluent monolayers of Vero cells in 12-well plates, in duplicate. Infection was allowed to proceed to completion (>90% cell death by eye), and supernatants were harvested from the infected wells that received the highest dilution (i.e., the least amount) of viral inoculum. Following three subsequent passages under mAb selection with virus-containing supernatants as above, supernatants from passage 4 were tested for viral neutralization escape. If resistance was evident, individual viral clones were plaque-purified on Vero cells, and their GP gene sequences were determined as described previously [1]. The following escape mutant selections were performed: PE-16 with rVSV-EBOV GP/Makona, PE-24 with rVSV-SUDV GP/Boneface, PE-05 with rVSV-EBOV/Mayinga, and PE-64 with rVSV-BDBVAMuc.

    Single-Particle Electron Microscopy

    [0187] Antibody Fabs and a EBOV GPTM ectodomain protein were prepared as described previously [5], and incubated at a ratio of 10:1 (Fab:GP) overnight at 4 C. Complexes were then deposited onto a carbon-coated copper mesh grid, and stained with 1% uranyl formate. Samples were imaged on a Tecnai F12 microscope using the automated image acquisition software Leginon [10]. Images were collected with a Tietz 4K CMOS detector at 52,000 magnification, resulting in a final pixel size of 2.05 at the specimen level. Images were automatically uploaded to and processed within our Appion database [11]. Individual complexes were extracted from raw images using DoG Picker [12], binned by 2, and placed into a stack. The stack was then subjected to reference-free 2D classification using MRA/MSA [13]. Class averages that did not respond to Fab:EBOV GPTM complexes were removed from all subsequent analyses. A subset of 2D class averages was used to create an initial model using common lines within EMAN2 [14]. The raw particle stack was then refined against the initial model using EMAN2 to yield the final 3D volumes. UCSF Chimera was used for modeling and figure generation [15].

    GP:mAb Kinetic Binding Binding Analysis by Biolayer Interferometry (BLI)

    [0188] The OctetRed system (ForteBio, Pall LLC) was used to determine the binding properties of different IgGs to various forms of EBOV GP. Anti-human Fc (AHC) capture sensors (ForteBio) were used for initial mAb loading at 25 mg/mL in 1 kinetics buffer (PBS supplemented with 0.002% Tween-20 and 1 mg/mL of BSA). Binding to GP was performed across two-fold serial dilutions of EBOV GPTM or GP.sub.CL. The baseline and dissociation steps were carried out in the 1 kinetics buffer as per the instrument manufacturer's recommendations. For analysis of binding at pH 5.5, a 1 pH 5.5 kinetics buffer (50 mM sodium citrate dihydrate[pH 5.5], 150 mM sodium chloride, 0.002% Tween-20 and 1 mg/mL BSA) was used in place of the PBS-based 1 kinetic buffer for all steps. For all of the kinetics experiments, a global data fitting to a 1:1 binding model was used to estimate values for the k.sub.on (association rate constant), k.sub.off (dissociation rate constant), and K.sub.D (equilibrium dissociation constant).

    TABLE-US-00013 TABLE 8 K.sub.D and IC.sub.50 values for PE-87 and PE-87 CDR-H3 mutations K.sub.D Ligand Analyte (nM) EBOV.sup.1 BDBV.sup.1 TAFV.sup.1 SUDV.sup.1 RESTV.sup.1 PE-87 GP/GP.sub.CL <0.001 1.0 0.4 0.9 0.8 0.1 D99A.sup.2 GP 74 1 >500 nn >350 nn nn H100A.sup.2 GP 4.5 0.2 1.0 0.4 0.8 1.0 0.2 R101A.sup.2 GP 9.4 0.3 3.2 0.4 1.9 1.5 0.2 V102A.sup.2 GP 4.0 0.1 0.6 0.2 1.0 1.1 0.2 W103A.sup.2 GP 1.3 0.1 nn >200 >150 nn nn G106A.sup.2 GP .03 .01 0.8 0.4 0.8 0.9 0.2 Y107A.sup.2 GP 30 1 3.0 0.8 0.8 >350 1.3 H108A.sup.2 GP 18 0.4 3.2 0.6 2.2 2.1 0.5 F109A.sup.2 GP 37 1 4.2 0.3 2.8 2.1 0.4 D110A.sup.2 GP 1.3 0.3 2.0 0.9 2.1 1.5 0.4 Y111A.sup.2 GP 5.9 0.3 0.8 0.4 1.1 0.8 0.1 .sup.1IC.sub.50 (nM), mAb concentration that affords half-maximal neutralization of vira infectivity. .sup.2Mutation in CDR3 of PE87.

    EBOV and SUDV Challenge Studies in Mice

    [0189] 10-12 week old female BALB/c mice (Jackson Labs) were challenged via the intraperitoneal (i.p.) route with EBOV-MA (100 PFU; 3,000 LD.sub.50). Mice were treated i.p. 2 days post-challenge with PBS vehicle or 300 g of each mAb (0.3 mL volume, 15 mg mAb/kg). Animals were observed daily for clinical signs of disease and lethality. Daily observations were increased to a minimum of twice daily while mice were exhibiting signs of disease. Moribund mice were humanely euthanized on the basis of IACUC-approved criteria.

    [0190] 6-8 week old male and female Type 1IFN / receptor knockout mice (Type 1 IFN/ R/) (Jackson Labs) were challenged with WT SUDV (1000 PFU i.p.). Animals were treated i.p. 1 and 4 days post-challenge with PBS vehicle or 300 g (15 mg mAb/kg) per dose, and monitored and euthanized as above.

    TABLE-US-00014 TABLE 9 Activity in mouse models Mouse efficacy (% survival) mAb EBOV SUDV PE-05 90 PE-87 80 100 PE-16 70 20 PE-47 90 100 PE-24 100 90-100 EBOV mouse studies (n = 10-30) were performed by Dr. J. Dye or P. Glass (USAMRIID) with mAb dosing (5-20 mg/kg) two days post-infection; SUDV mouse studies (n = 10) were performed by Dr. Dye with 10-20 mg/kg of mAb dosed one and four days post-infection.

    BDBV Challenge Studies in Ferrets

    [0191] Six-month-old female ferrets (Mustela putorius furo) were challenged via the intramuscular (i.m.) route with WT BDBV (BDBV/H.sap-tc/UGA/07/Butalya-811250; 1000 TCID.sub.50 in 0.5 mL volume), as described previously [16]. Animals were treated i.p. 3 and 6 days post-challenge with either PBS vehicle or 15 mg (day 3) and 10 mg (day 6) of each mAb (2 mL volume/dose). Additionally, 1 mL blood was taken from each animal on days 0, 3, 6, 10, 14, 21, 28 days post-infection to determine viral load, measure complete blood counts, and evaluate biochemical markers. Animals were were monitored twice daily for signs of disease during the course of the experiment.

    Animal Welfare Statement

    [0192] Murine challenge studies were conducted under IACUC-approved protocols in compliance with the Animal Welfare Act, PHS Policy, and other applicable federal statutes and regulations relating to animals and experiments involving animals. The facility where these studies was conducted (USAMRIID) is accredited by the Association for Assessment and Accreditation of Laboratory Animal Care, International (AAALAC) and adhere to principles stated in the Guide for the Care and Use of Laboratory Animals, National Research Council, 2011.

    [0193] Ferret challenge studies were approved by the Animal Care Committee (ACC) of the Canadian Science Centre for Human and Animal Health (CSCHAH) in Winnipeg, Canada, in accordance with guidelines from the Canadian Council on Animal Care (CCAC).

    Statistical Analysis

    [0194] Dose-response neutralization curves were fit to a logistic equation by nonlinear regression analysis. 95% confidence intervals (95% CI) for the extracted IC.sub.50 parameter were estimated under the assumption of normality. Analysis of survival curves was performed with the Mantel-Cox (log-rank) test. Statistical comparisons of viral titers were carried out with an unpaired t-test. Testing level (alpha) was 0.05 for all statistical tests. All analyses were carried out in GraphPad Prism.

    REFERENCES FOR MATERIALS AND METHODS 2

    [0195] 1. Wong, A. C., et al., A forward genetic strategy reveals destabilizing mutations in the Ebolavirus glycoprotein that alter its protease dependence during cell entry. J Virol, 2010. 84(1): p. 163-75. [0196] 2. Ng, M., et al., Cell entry by a novel European filovirus requires host endosomal cysteine proteases and Niemann-Pick C1. Virology, 2014. 468-470: p. 637-46. [0197] 3. Wec, A. Z., et al., A Trojan horse bispecific antibody strategy for broad protection against ebolaviruses. Science, 2016. [0198] 4. Takada, A., et al., A system for functional analysis of Ebola virus glycoprotein. Proc Nat Acad Sci USA, 1997. 94(26): p. 14764-9. [0199] 5. Bornholdt, Z. A., et al., Isolation of potent neutralizing antibodies from a survivor of the 2014 Ebola virus outbreak. Science, 2016. 351(6277): p. 1078-83. [0200] 6. Jahrling, P. B., et al., Evaluation of immune globulin and recombinant interferon-alpha2b for treatment of experimental Ebola virus infections. J Infect Dis, 1999. 179 Suppl 1: p. 5224-34. [0201] 7. Bray, M., et al., A mouse model for evaluation of prophylaxis and therapy of Ebola hemorrhagic fever. J Infect Dis, 1998. 178(3): p. 651-61. [0202] 8. Towner, J. S., et al., Newly discovered ebola virus associated with hemorrhagic fever outbreak in Uganda. PLoS Pathog, 2008. 4(11): p. e1000212. [0203] 9. Bornholdt, Z. A., et al., Host-Primed Ebola Virus GP Exposes a Hydrophobic NPC1 Receptor-Binding Pocket, Revealing a Target for Broadly Neutralizing Antibodies. M Bio, 2015. 7(1). [0204] 10. Suloway, C., et al., Automated molecular microscopy: the new Leginon system. J Struct Biol, 2005. 151(1): p. 41-60. [0205] 11. Lander, G. C., et al., Appion: an integrated, database-driven pipeline to facilitate EM image processing. J Struct Biol, 2009. 166(1): p. 95-102. [0206] 12. Voss, N. R., et al., DoG Picker and TiltPicker: software tools to facilitate particle selection in single particle electron microscopy. J Struct Biol, 2009. 166(2): p. 205-13. [0207] 13. Ogura, T., K. Iwasaki, and C. Sato, Topology representing network enables highly accurate classification of protein images taken by cryo electron-microscope without masking. J Struct Biol, 2003. 143(3): p. 185-200. [0208] 14. Tang, G., et al., EMAN2: an extensible image processing suite for electron microscopy. J Struct Biol, 2007. 157(1): p. 38-46. [0209] 15. Goddard, T. D., C. C. Huang, and T. E. Ferrin, Visualizing density maps with UCSF Chimera. J Struct Biol, 2007. 157(1): p. 281-7. [0210] 16. Kozak, R., et al., Ferrets Infected with Bundibugyo Virus or Ebola Virus Recapitulate Important Aspects of Human Filovirus Disease. J Virol, 2016. 90(20): p. 9209-23.

    REFERENCES FOR BACKGROUND, SUMMARY, MATERIALS AND METHODS 1

    [0211] 1. Kuhn, J. H., et al., Nomenclature-and database-compatible names for the two Ebola virus variants that emerged in Guinea and the Democratic Republic of the Congo in 2014. Viruses, 2014. 6(11): p. 4760-99. [0212] 2. Feldmann, H. and M. P. Kiley, Classification, structure, and replication of filoviruses. Curr Top Microbial Immunol, 1999. 235: p. 1-21. [0213] 3. Dye, J. M., et al., Postexposure antibody prophylaxis protects nonhuman primates from filovirus disease. Proc Natl Acad Sci USA, 2012. 109(13): p. 5034-9. [0214] 4. Garbutt, M., et al., Properties of replication-competent vesicular stomatitis virus vectors expressing glycoproteins of filoviruses and arenaviruses. J Virol, 2004. 78(10): p. 5458-65. [0215] 5. Marzi, A., et al., Protective efficacy of neutralizing monoclonal antibodies in a nonhuman primate model of Ebola hemorrhagic fever. PLoS One, 2012. 7(4): p. e36192. [0216] 6. Olinger, G. G., Jr., et al., Delayed treatment of Ebola virus infection with plant-derived monoclonal antibodies provides protection in rhesus macaques. Proc Natl Acad Sci USA, 2012. 109(44): p. 18030-5. [0217] 7. Qiu, X., et al., Successful treatment of ebola virus-infected cynomolgus macaques with monoclonal antibodies. Sci Trans Med, 2012. 4(138): p. 138ra81. [0218] 8. Pettitt, J., et al., Therapeutic intervention of Ebola virus infection in rhesus macaques with the MB-003 monoclonal antibody cocktail. Sci Transl Med, 2013. 5(199): p. 199ra113. [0219] 9. Qiu, X., et al., Reversion of advanced Ebola virus disease in nonhuman primates with ZMapp. Nature, 2014. 514(7520): p. 47-53. [0220] 10. Lee, I. E., et al., Structure of the Ebola virus glycoprotein bound to an antibody from a human survivor. Nature, 2008. 454(7201): p. 177-82. [0221] 11. Nanbo, A., et al., Ebolavirus is internalized into host cells via macropinocytosis in a viral glycoprotein-dependent manner. PLoS Pathog, 2010. 6(9): p. e1001121. [0222] 12. Saeed, M. F., et al., Cellular entry of ebola virus involves uptake by a macropinocytosis-like mechanism and subsequent trafficking through early and late endosomes. PLoS Pathog, 2010. 6(9): p. e1001110. [0223] 13. Chandran, K., et al., Endosomal proteolysis of the Ebola virus glycoprotein is necessary for infection. Science, 2005. 308(5728): p. 1643-5. [0224] 14. Dube, D., et al., The primed ebolavirus glycoprotein (19-kilodalton GP1,2): sequence and residues critical for host cell binding. J Virol, 2009. 83(7): p. 2883-91. [0225] 15. Carette, I. E., et al., Ebola virus entry requires the cholesterol transporter Niemann-Pick C1. Nature, 2011. 477(7364): p. 340-3. [0226] 16. Cote, M., et al., Small molecule inhibitors reveal Niemann-Pick C1 is essential for Ebola virus infection. Nature, 2011. 477(7364): p. 344-8. [0227] 17. Cook, J. D. and J. E. Lee, The secret life of viral entry glycoproteins: moonlighting in immune evasion. PLoS Pathog, 2013. 9(5): p. e1003258. [0228] 18. Saphire, E. O., An update on the use of antibodies against the filoviruses. Immunotherapy, 2013. 5(11): p. 1221-33. [0229] 19. Maruyama, T., et al., Ebola virus can be effectively neutralized by antibody produced in natural human infection. J Virol, 1999. 73(7): p. 6024-30. [0230] 20. Dias, J. M., et al., A shared structural solution for neutralizing ebolaviruses. Nat Struct Mol Biol, 2011. 18(12): p. 1424-7. [0231] 21. Murin, C. D., et al., Structures of protective antibodies reveal sites of vulnerability on Ebola virus. Proc Nat Acad Sci USA, 2014. 111(48): p. 17182-7. [0232] 22. Volchkov, V. E., et al., Processing of the Ebola virus glycoprotein by the proprotein convertase furin. Proc Natl Acad Sci USA, 1998. 95(10): p. 5762-7. [0233] 23. Kuhn, J. H., et al., Conserved receptor-binding domains of Lake Victoria marburgvirus and Zaire ebolovirus bind a common receptor. J Biol Chem, 2006. 281(23): p. 15951-8. [0234] 24. Qiu, X., et al., Characterization of Zaire ebolavirus glycoprotein-specific monoclonal antibodies. Clin Immunol, 2011. 141(2): p. 218-27. [0235] 25. Qiu, X., et al., Ebola GP-specific monoclonal antibodies protect mice and guinea pigs from lethal Ebola virus infection. PLoS Negl Trop Dis, 2012. 6(3): p. e1575. [0236] 26. Chen, G., et al., Synthetic antibodies with a human framework that protect mice from lethal Sudan ebolovirus challenge. ACS Chem Biol, 2014. 9(10): p. 2263-73. [0237] 27. Tiller, T., et al., Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods, 2008. 329(1-2): p. 112-24. [0238] 28. Swers, J. S., B. A. Kellogg, and K. D. Wittrup, Shuffled antibody libraries created by in vivo homologous recombination and yeast surface display. Nucleic Acids Res, 2004. 32(3): p. e36. [0239] 29. Gietz, R. D. and R. H. Schiesti, High-efficiency yeast transformation using the LiAc/SS carrier DNA/PEG method. Nat Protoc, 2007. 2(1): p. 31-4. [0240] 30. Hashiguchi, T., et al., Structural basis for Marburg virus neutralization by a cross-reactive human antibody. Cell, 2015. 160(5): p. 904-12. [0241] 31. Bowley, D. R., et al., Antigen selection from an HIV-1 immune antibody library displayed on yeast yields many novel antibodies compared to selection from the same library displayed on phage. Protein Eng Des Sel, 2007. 20(2): p. 81-90. [0242] 32. Honnold, S. P., et al., Second generation inactivated eastern equine encephalitis virus vaccine candidates protect mice against a lethal aerosol challenge. PLoS One, 2014. 9(8): p. e104708. [0243] 33. Suloway, C., et al., Automated molecular microscopy: the new Leginon system. J Struct Biol, 2005. 151(1): p. 41-60. [0244] 34. Lander, G. C., et al., Appion: an integrated, database-driven pipeline to facilitate EM image processing. J Struct Biol, 2009. 166(1): p. 95-102. [0245] 35. Voss, N. R., et al., DoG Picker and TiltPicker: software tools to facilitate particle selection in single particle electron microscopy. J Struct Biol, 2009. 166(2): p. 205-13. [0246] 36. Tang, G., et al., EMAN2: an extensible image processing suite for electron microscopy. J Struct Biol, 2007. 157(1): p. 38-46. [0247] 37. Goddard, T. D., C. C. Huang, and T. E. Ferrin, Visualizing density maps with UCSF Chimera. J Struct Biol, 2007. 157(1): p. 281-7. [0248] 38. Bray, M., et al., A mouse model for evaluation of prophylaxis and therapy of Ebola hemorrhagic fever. J Infect Dis, 1999. 179 Suppl 1: p. S248-58.