Compositions and methods for expressing polypeptides on the surface of cells
10829771 ยท 2020-11-10
Assignee
Inventors
Cpc classification
G01N33/6872
PHYSICS
G01N33/6863
PHYSICS
C07K2319/70
CHEMISTRY; METALLURGY
C12N15/1037
CHEMISTRY; METALLURGY
C07K2319/035
CHEMISTRY; METALLURGY
C07K2319/74
CHEMISTRY; METALLURGY
International classification
C12N15/10
CHEMISTRY; METALLURGY
C07K14/00
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C07K14/715
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Methods and compositions are provided for displaying a protein of interest (POI) on the surface of a eukaryotic cell by fusing the POI to a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide to generate a surface accessible fusion protein. Nucleic acids are provided that include nucleotide sequences encoding a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject nucleic acid includes and insertion site for the insertion of a POI. In some cases, a subject nucleic acid includes a nucleotide sequence that encodes a POI. In some cases a stalk polypeptide is a synthetic stalk polypeptide and various example synthetic stalk polypeptides are disclosed. In some cases, a surface anchor polypeptide is a glycosylphosphatidylinisotol (GPI) anchor domain, which can be synthetic. Kits are also provided for practicing the subject methods.
Claims
1. A DNA nucleic acid for expressing a polypeptide of interest on the surface of a cell, the nucleic acid comprising: (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a synthetic stalk polypeptide that comprises an amino acid sequence having 60% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 31-35; and (iii) a third nucleotide sequence that encodes a surface anchor polypeptide, wherein (i), (ii), and (iii) are positioned relative to one another in a 5 to 3 orientation and are operably linked to the same promoter, wherein the promoter is functional in a eukaryotic cell.
2. The DNA nucleic acid of claim 1, comprising an insertion site for inserting a nucleotide sequence that encodes a protein of interest (POI), wherein the insertion site is positioned 3 of (i) and 5 of (ii).
3. The DNA nucleic acid of claim 1, comprising (iv) a fourth nucleotide sequence that encodes a protein of interest (POI), wherein said first through fourth nucleotide sequences are: (a) positioned, from 5 to 3, in the following order: (i), (iv), (ii), (iii); and (b) are in frame with one another such that they collectively encode a surface accessible fusion protein comprising the signal polypeptide, the POI, the stalk polypeptide, and the surface anchor polypeptide.
4. The DNA nucleic acid of claim 1, wherein the stalk polypeptide comprises a polypeptide sequence having a length of 20 or more amino acids.
5. The DNA nucleic acid of claim 1, wherein the stalk polypeptide comprises a polypeptide sequence having a length in a range of from 20 to 2000 amino acids.
6. The DNA nucleic acid of claim 1, wherein the signal polypeptide: is a signal polypeptide from a yeast protein; is from a protein that exhibits post-translational transport to the endoplasmic reticulum (ER); or comprises an amino acid sequence having 60% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 11-17.
7. The DNA nucleic acid of claim 1, wherein the surface anchor polypeptide is a glycosylphosphatidylinositol (GPI) anchor domain.
8. The DNA nucleic acid of claim 7, wherein the GPI anchor domain comprises an amino acid sequence having 60% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 51-64 and 71.
9. The DNA nucleic acid of claim 1, wherein the surface anchor polypeptide is a synthetic polypeptide sequence.
10. The DNA nucleic acid of claim 1, wherein the DNA nucleic acid is a recombinant expression vector.
11. The DNA nucleic acid of claim 1, wherein said promoter is functional in a fungal cell.
12. The DNA nucleic acid of claim 11, wherein the fungal cell is a yeast cell.
13. A kit, comprising two or more DNA nucleic acids, wherein each DNA nucleic acid comprises: (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a synthetic stalk polypeptide; and (iii) a third nucleotide sequence that encodes a surface anchor polypeptide, wherein (i), (ii), and (iii) of each DNA nucleic acid are positioned relative to one another in a 5 to 3 orientation and are operably linked to the same promoter; wherein at least one of the stalk polypeptides encoded by the two or more DNA nucleic acids comprises an amino acid sequence having 60% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 31-35.
14. The kit of claim 13, wherein the stalk polypeptides encoded by at least two of the two or more DNA nucleic acids are of different lengths.
15. A protein, or a nucleic acid encoding the same, comprising a synthetic GPI anchor domain, wherein the synthetic GPI anchor domain comprises an amino acid sequence having 60% or more or 80% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 51-64 and 71.
16. A method of displaying a protein of interest (POI) on the surface of a eukaryotic cell, the method comprising: introducing into a eukaryotic cell a DNA nucleic acid comprising a nucleotide sequence that: (i) is operably linked to a promoter that is functional in the eukaryotic cell, and (ii) encodes a surface accessible fusion protein, wherein the surface accessible fusion protein comprises, in order, a signal polypeptide, a POI, a synthetic stalk polypeptide, and a surface anchor polypeptide, wherein the synthetic stalk polypeptide comprises an amino acid sequence having 60% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 31-35.
17. The method according to claim 16, wherein the eukaryotic cell is a fungal cell.
18. The method according to claim 17, wherein the fungal cell is a yeast cell.
19. A method of measuring the binding of an agent to a protein of interest (POI), the method comprising: displaying the POI on the surface of the eukaryotic cell according to the method of claim 16, contacting the eukaryotic cell with an agent, measuring an amount of the agent bound to the cell.
20. The method according to claim 19, wherein the agent is labeled with a directly detectable label.
21. The method of claim 19, wherein the method comprises: displaying two or more different proteins of interest (POIs), each displayed on the surface of a different cell, contacting the cells displaying said POIs with the agent, and measuring an amount of the agent bound to said cells.
22. The method according to claim 21, wherein at least two of the two or more different POls differ in amino acid sequence by 1 to 20 amino acids.
23. The method according to claim 21, wherein the method comprises a step of generating at least two of the two or more different POIs using a method that includes mutagenesis.
24. The method of claim 19, wherein the method comprises: contacting the eukaryotic cell with two or more agents, and identifying at least one agent of said two more agents bound to said cell.
25. The kit of claim 13, wherein at least one of the two or more DNA nucleic acids further comprises an insertion site for inserting a nucleotide sequence that encodes a protein of interest (POI), wherein the insertion site is positioned 3 of (i) and 5 of (ii).
26. The kit of claim 13, wherein at least one of the two or more DNA nucleic acids comprises: (iv) a fourth nucleotide sequence that encodes a protein of interest (POI), wherein said first through fourth nucleotide sequences are: (a) positioned, from 5 to 3, in the following order: (i), (iv), (ii), (iii); and (b) are in frame with one another such that they collectively encode a surface accessible fusion protein comprising the signal polypeptide, the POI, the stalk polypeptide, and the surface anchor polypeptide.
27. The kit of claim 13, wherein at least one of the stalk polypeptides encoded by the two or more DNA nucleic acids comprises a polypeptide sequence having a length of 20 or more amino acids.
28. The kit of claim 13, wherein: (A) at least one of the signal polypeptides encoded by the two or more DNA nucleic acids: is a signal polypeptide from a yeast protein; is from a protein that exhibits post-translational transport to the endoplasmic reticulum (ER); or comprises an amino acid sequence having 60% or more amino acid sequence identity with the amino acid sequence set forth in any of SEQ ID NOs: 11-17; (B) at least one of the surface anchor polypeptides encoded by the two or more DNA nucleic acids is a glycosylphosphatidylinositol (GPI) anchor domain; (C) at least one of the two or more DNA nucleic acids is a recombinant expression vector; (D) said promoter of at least one of the two or more DNA nucleic acids is functional in a yeast cell; or (E) any combination thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The invention is best understood from the following detailed description when read in conjunction with the accompanying drawings. The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee. It is emphasized that, according to common practice, the various features of the drawings are not to-scale. On the contrary, the dimensions of the various features are arbitrarily expanded or reduced for clarity. Included in the drawings are the following figures.
(2)
(3)
DETAILED DESCRIPTION
(4) Methods and compositions are provided for displaying a protein of interest (POI) on the surface of a eukaryotic cell (e.g., a mammalian cell, a fungal cell, a yeast cell, etc.) by fusing the POI to a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide to generate a surface accessible fusion protein. In some cases, a surface accessible fusion protein is introduced into a eukaryotic cell as part of a nucleic acid (e.g., a recombinant expression vector). Nucleic acids are provided that include nucleotide sequences encoding a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject nucleic acid includes and insertion site for the insertion of a POI. In some cases, a subject nucleic acid includes a nucleotide sequence that encodes a POI. In some cases a stalk polypeptide is a synthetic stalk polypeptide and various example synthetic stalk polypeptides are disclosed herein. In some cases, a surface anchor polypeptide is a glycosylphosphatidylinisotol (GPI) anchor domain. In some cases, a GPI anchor domain is a synthetic GPI anchor domain.
(5) Methods are provided for measuring the binding of an agent to a POI (e.g., determining whether an agent can bind to a POI). Methods are also provided for identifying an agent that binds to a POI (e.g., screening test compounds for an agent that binds to a given POI); for identifying a polypeptide that binds to a given agent (e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a pre-determined value); and for generating a variant polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived.
(6) Kits are also provided that include various components of the subject compositions, and such kits can be used to practice the subject methods.
(7) Before the present methods and compositions are described, it is to be understood that this invention is not limited to particular method or composition described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
(8) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
(9) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.
(10) As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
(11) It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a cell includes a plurality of such cells and reference to the peptide includes reference to one or more peptides and equivalents thereof, e.g. polypeptides, known to those skilled in the art, and so forth.
(12) The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
Definitions
(13) In the description that follows, a number of terms conventionally used in the field are utilized. In order to provide a clear and consistent understanding of the specification and claims, and the scope to be given to such terms, the following definitions are provided.
(14) The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms also apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
(15) The term amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an .alpha. carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
(16) The term synthetic, as used when referring to components of the subject compositions (e.g., a synthetic stalk polypeptide, a synthetic surface anchor polypeptide, a synthetic signal polypeptide, and the like), means that component is non-naturally occurring. For example, a synthetic stalk polypeptide by definition comprises a non-naturally occurring amino acid sequence, a synthetic surface anchor polypeptide by definition comprises a non-naturally occurring amino acid sequence, and a synthetic signal polypeptide by definition comprises a non-naturally occurring amino acid sequence.
(17) The term antibody is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments (e.g., Fab fragments) so long as they exhibit the desired biological activity. Antibodies (Abs) and immunoglobulins (Igs) are glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibody-like molecules which lack antigen specificity. Polypeptides of the latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
(18) Native antibodies and immunoglobulins are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V.sub.H) followed by a number of constant domains. Each light chain has a variable domain at one end (V.sub.L) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains (Clothia et al., J. Mol. Biol. 186:651 (1985); Novotny and Haber, Proc. Natl. Acad. Sci. U.S.A. 82:4592 (1985)).
(19) The term variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a b-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the b-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
(20) Digestion of antibodies (e.g., with enzymes such as papain, Ficin, and the like) produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab).sub.2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
(21) Fv is the minimum antibody fragment which contains a complete antigen-recognition and binding site. In a two-chain Fv species, this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In a single-chain Fv species (scFv), one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a dimeric structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. For a review of scFv see Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
(22) The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab).sub.2 antibody fragments originally were produced as pairs of Fab fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
(23) Antibody fragment, and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody, wherein the portion is free of the constant heavy chain domains (i.e. CH2, CH3, and CH4, depending on antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include Fab, Fab, Fab-SH, F(ab).sub.2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a single-chain antibody fragment or single chain polypeptide), including without limitation (1) single-chain Fv (scFv) molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety and (4) nanobodies comprising single Ig domains from non-human species or other specific single-domain binding modules; and multispecific or multivalent structures formed from antibody fragments. In an antibody fragment comprising one or more heavy chains, the heavy chain(s) can contain any constant domain sequence (e.g. CH1 in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody, and/or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain(s).
(24) As used in this disclosure, the term epitope means any antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
(25) The term label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to a molecule. For example, an agent can be said to be detectably labeled, or can be said to include a detectable label. The label may itself may be detectable (directly detectable label) (e.g., radioisotope labels, fluorescent labels such as fluorescent chemical adducts, etc.), or the label can be indirectly detectable, e.g., in the case of an enzymatic label, the enzyme may catalyze a chemical alteration of a substrate compound or composition and the product of the reaction is detectable. One example of an indirect label is biotin, which can be detected using streptavidin. Any convenient direct or indirect label can be used in the compositions and methods described herein.
(26) The term recombinant as used herein means that a particular nucleic acid (DNA or RNA) is the product of various combinations of cloning, restriction, polymerase chain reaction (PCR) and/or ligation steps resulting in a construct having a structural coding or non-coding sequence distinguishable from endogenous nucleic acids found in natural systems. DNA sequences encoding polypeptides can be assembled from cDNA fragments or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system. Genomic DNA comprising the relevant sequences can also be used in the formation of a recombinant gene or transcriptional unit. Sequences of non-translated DNA may be present 5 or 3 from the open reading frame, where such sequences do not interfere with manipulation or expression of the coding regions, and may indeed act to modulate production of a desired product by various mechanisms. DNA sequences encoding RNA that is not translated may also be considered recombinant. Thus, e.g., the term recombinant nucleic acid refers to one which is not naturally occurring, e.g., is made by the artificial combination of two otherwise separated segments of sequence through human intervention. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a codon encoding the same amino acid, a conservative amino acid, or a non-conservative amino acid. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. When a recombinant nucleic acid encodes a polypeptide, the sequence of the encoded polypeptide can be naturally occurring (wild type) or can be a variant (e.g., a mutant) of the naturally occurring sequence.
(27) A vector is a replicon, such as a plasmid, phage, virus, or cosmid, to which another DNA segment, (e.g., an insert), may be attached so as to bring about the replication and/or expression of the attached segment in a cell. An expression vector is a vector having an expression cassette (e.g., having an insert that is an expression cassette). An expression cassette includes a DNA sequence (coding or non-coding) operably linked to a promoter. Operably linked refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. For instance, a promoter is operably linked to a nucleotide sequence if the promoter affects transcription of the nucleotide sequence (e.g., expression of the nucleotide sequence). Thus the term recombinant expression vector, or DNA construct are used interchangeably herein to refer to an expression vector having an insert, where the expression vector is recombinant (i.e., includes sequences that are not naturally occuring). Recombinant expression vectors are usually generated for the purpose of expressing and/or propagating the insert(s), or for the construction of other recombinant nucleotide sequences.
(28) Compositions
(29) The present disclosure provides compositions and methods for expressing a protein of interest (POI) on the surface of cell (i.e., surface display), by expressing the POI as a surface accessible fusion protein. The term surface accessible fusion protein is used herein to describe a polypeptide having a signal polypeptide, a protein of interest (POI), a stalk polypeptide, and a surface anchor polypeptide.
(30) Signal Polypeptide
(31) The terms signal polypeptide and signal sequence are used interchangeably herein to refer to the amino acid sequence that is present at or near the N-terminus of proteins of the secretory pathway (e.g., secreted proteins, GPI anchored proteins, etc.) that targets proteins for delivery into the lumen of the endoplasmic reticulum (ER)). As is known in the art, signal sequences are extremely variable, both in their length and in their amino acid composition. However, signal sequences tend to be approximately 15-30 amino acids long and usually include a block of 5-10 hydrophobic amino acids.
(32) Many proteins of the secretory pathway (e.g., secreted proteins) translocate to the ER (e.g., enter the ER lumen) during translation (co-translational). However, some small secretory proteins, such as the yeast mating factor alpha (about 70 amino acids), exhibit post-translational transport into the ER lumen. Signal sequences from different proteins can function interchangeably. In some cases, a signal sequence is cleaved during processing of the protein (e.g., is no longer present on the mature protein). As such, in some cases, a subject signal polypeptide is cleaved during processing of the surface accessible fusion protein (e.g., is no longer present on the mature protein that is displayed on the surface of the cell). In some cases, a signal polypeptide is one that is not cleaved during processing of the protein (i.e., is present in the mature protein).
(33) A subject signal polypeptide can be native to the host cell in which it is expressed, or can be heterologous to the host cell, as long as it is operable to effect transport of the surface accessible fusion protein into the secretory pathway. A subject signal polypeptide can be a well characterized signal sequence, or can be any signal polypeptide derived from any protein of the secretory pathway. In some cases, a subject signal polypeptide is a synthetic signal polypeptide, i.e., the sequence is not present in (is modified relative to) a naturally existing protein.
(34) In some embodiments, a subject surface accessible fusion protein includes a signal polypeptide from a protein (or is derived from a protein) that enters the ER via a post-translational route (referred to herein as a post-translational signal polypeptide). In some embodiments, a subject surface accessible fusion protein includes a signal polypeptide from a protein (or is derived from a protein) that enters the ER via a pre-translational route (referred to herein as a pre-translational signal polypeptide).
(35) Numerous signal sequences suitable for the subject compositions, kits, and methods are known to those of ordinary skill in the art, and any convenient signal polypeptide can be used. For example, one of ordinary skill in the art will be able to readily identify signal polypeptides for use in the subject compositions, kits, and methods. Any convenient signal polypeptide can be used that is functional in a host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, etc.). Selection of a signal sequence can take into account, for example, the desired level of protein to be displayed at the surface of the cell (e.g., the yeast cell). For example the signal sequence from alpha mating factor can be useful when a high level of displayed protein is desired, but in some cases less protein is desired at the cell surface and in such cases, other signal polypeptides can be used (e.g., the signal peptides from Pho5p, Suc2p, etc.).
(36) In some cases, the signal polypeptide is a heterologous polypeptide relative to the cell type in which the surface accessible fusion protein will be expressed. For example, if a surface accessible fusion protein will be expressed in a yeast cell, the signal polypeptide can be from (e.g., can be derived from) a cell type other than a yeast cell (e.g., a mammalian cell, a vertebrate cell, an invertebrate cell, etc.), or from a yeast cell of a different species from the species in which the surface accessible fusion protein will be expressed.
(37) In some cases, the signal polypeptide is from (e.g., derived from) the same cell type that the surface accessible fusion protein will be expressed (e.g., in some cases from the same species). For example, if a surface accessible fusion protein will be expressed in a yeast cell, the signal polypeptide can be from a yeast protein (e.g., in some cases from the same species of yeast). Example signal polypeptides include, but are not limited to those from (or derived from) the following yeast proteins: mating factor alpha, Aga2p, Pho5p, and Suc2p.
(38) Examples of suitable signal polypeptides include, but are not limited to, the following:
(39) TABLE-US-00001 SignalpolypeptidefromMatingfactoralpha: (SEQIDNO:11) MRFPSIFTAVLFAASSALAAPANTTTEDETAQIPAEAVIDYSDLEGDFDA AALPLSNSTNNGLSSTNTTIASIAAKEEGVQLDKREA SignalpolypeptidefromMatingfactoralpha (shorter): (SEQIDNO:12) MRFPSIFTAVLFAASSALAA SignalpolypeptidefromAga2p (SEQIDNO:13) MQLLRCFSIFSVIASVLAQ SignalpolypeptidefromPho5p (SEQIDNO:14) MFKSVVYSILAASLANAG SignalpolypeptidefromSuc2p (SEQIDNO:15) MLLQAFLFLLAGFAAKISAS SignalpolypeptidefromCecropin-A(from Hyalophoracecropia(Cecropiamoth)): (SEQIDNO:16) MNFSRIFFFVFACLTALAMVNA SignalpolypeptidefromGenBankAIO03624.1 (SEQIDNO:17) MRAFLALIFLTFVMNVESS
(40) In some cases, the signal polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity (70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 11-17.
(41) As described in more detail below, in some cases, a surface anchor polypeptide includes a TM domain (e.g., a type II TM domain) that is positioned such that the surface accessible fusion protein is a type II membrane protein (i.e., the surface anchor polypeptide would be positioned near the N-terminus instead of the C-terminus of the surface accessible fusion protein). As would be readily understood by one of ordinary skill in the art, in such cases, a surface accessible fusion protein can include a signal polypeptide that is appropriate for type II membrane protein.
(42) Protein of Interest
(43) The term protein of interest, POI, or polypeptide of interest as used herein refers to any amino acid sequence of interest. In some cases, a POI is an entire protein (e.g., an entire protein that is naturally existing, a modified version of an entire protein, etc.). In some cases, a POI is a fragment of a protein, and can be any fragment of interest. For example, if one desires to investigate the binding or function of a particular portion of a protein (e.g., a domain, an extracellular domain, a protein binding domain, an enzymatic domain, an epitope, a portion of a protein with no known function or suspected function, etc.), the particular portion of interest can be referred to as a POI. The protein from which a POI is derived can be any protein (e.g., an antibody, a ligand, and receptor, a membrane protein, a secreted protein, an intracellular protein, an protein the localized to a particular organelle, a cytosolic protein, an enzyme, and the like). A POI can be naturally existing sequence or a non-naturally existing sequence (e.g., a synthetic amino acid sequence, a mutated/modified version of a naturally existing sequence, etc.).
(44) In some cases, multiple POIs (e.g., two or more different POIs) are used in a subject method. In some cases, at least two of the two or more different POIs are similar to each other. For example, in some cases, the subject methods are screening methods that can be used to identify variants that bind with greater or weaker affinity to a particular compound. Thus multiple POIs can be used that are variants of one another (e.g., produced by mutagenesis). In some cases, at least two of the two or more POIs differ in amino acid sequence by 1 to 20 amino acids (e.g., 1 to 19 amino acids, 1 to 18 amino acids, 1 to 17 amino acids, 1 to 16 amino acids, 1 to 15 amino acids, 1 to 14 amino acids, 1 to 13 amino acids, 1 to 12 amino acids, 1 to 11 amino acids, 1 to 10 amino acids, 1 to 9 amino acids, 1 to 8 amino acids, 1 to 7 amino acids, 1 to 6 amino acids, 1 to 5 amino acids, 1 to 4 amino acids, 1 to 3 amino acids, 1 to 2 amino acids, or 1 amino acid).
(45) Stalk Polypeptide
(46) A stalk polypeptide, also referred to herein as a synthetic stalk polypeptide is a synthetic sequence (a non-naturally occurring sequence) designed to provide clearance for the POI from the cell surface, and to be inert such that the POI and the stalk polypeptide do not interact. The stalk polypeptide is meant to provide an attachment for a POI to the cell surface while allowing the POI to fold (and in some cases function) free of influence from the surface. In addition, the use of a synthetic stalk polypeptide (e.g., in some cases in addition to a synthetic surface anchor polypeptide such as a synthetic GPI polypeptide) can ensure that undesired recombination does not occur within the yeast genome between yeast genomic sequences and nucleotides sequences encoding the synthetic stalk (and/or the synthetic surface anchor polypeptide).
(47) Design features that can be used in designing a stalk polypeptide include low complexity in amino acid sequence, overall acidic character of the polypeptide, high hydrophilicity of the polypeptide, an absence of defined secondary or tertiary structure features within the polypeptide, a high density of O-linked glycosylation sites, and low self-similarity in the nucleotide sequence encoding the stalk polypeptide. In some cases, all of these features are taken into account such that the stalk polypeptide is characterized by low amino acid sequence complexity, overall acidic character, high hydrophilicity, an absence of defined secondary or tertiary structural features, a high density of O-linked glycosylation sites, and the nucleotide sequence encoding the stalk polypeptide is characterized by low self-similarity. In some cases, a stalk polypeptide comprises an amino acid sequence that is heavily O-glycosylated upon expression in a eukaryotic cell (e.g., a yeast cell). In some cases, a subject stalk polypeptide (and nucleotide sequences encoding the stalk polypeptide) can take into account (i.e., include) any or all of the above features (e.g., in any combination).
(48) As noted above, in some cases, a stalk polypeptide comprises an amino acid sequence that is heavily O-glycosylated upon expression in a eukaryotic cell (e.g., a yeast cell). In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 5 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 10 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 20 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 50 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 100 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 200 amino acids.
(49) In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having one or more O-linked glycosylation sites (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, or 10 or more O-linked glycosylation sites). In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 to 10 O-linked glycosylation sites (e.g., 1 to 9, 1 to 8, 1 to 7, 2 to 10, 2 to 9, 2 to 8, or 2 to 7 O-linked glycosylation sites).
(50) In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 20 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 40 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 50 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 0.5 or more O-linked glycosylation sites (e.g., 0.6 or more, 0.7 or more, 0.8 or more, 0.9 or more, 1 or more, 1.1 or more, 1.2 or more, 1.3 or more, 1.5 or more, or 2 or more O-linked glycosylation sites) per 100 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.7 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 100 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 0.5 or more O-linked glycosylation sites (e.g., 0.6 or more, 0.7 or more, 0.8 or more, 0.9 or more, 1 or more, 1.1 or more, 1.2 or more, 1.3 or more, 1.5 or more, or 2 or more O-linked glycosylation sites) per 200 amino acids. In some cases, a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.7 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 200 amino acids.
(51) A stalk polypeptide can be of any desired length. For example, in some cases, a stalk polypeptide comprises a polypeptide sequence having a length in a range of from 10 to 2000 amino acids (e.g., from 20 to 2000 amino acids, from 50 to 2000 amino acids, from 20 to 1500 amino acids, from 50 to 1500 amino acids, from 20 to 1000 amino acids, from 50 to 1000 amino acids, from 20 to 800 amino acids, from 50 to 800 amino acids, from 100 to 2000 amino acids, from 100 to 1500 amino acids, from 100 to 1000 amino acids, from 100 to 800 amino acids, from 10 to 100 amino acids, from 20 to 100 amino acids, from 40 amino acids to 100 amino acids, from 101 to 200 amino acids, from 201 to 300 amino acids, from 301 to 400 amino acids, from 401 to 500 amino acids, from 501 to 600 amino acids, from 601 to 700 amino acids, from 701 to 800 amino acids, from 801 to 900 amino acids, from 901 to 1000 amino acids, from 1001 to 1500 amino acids, or from 1501 to 2000 amino acids). In some cases, a stalk polypeptide comprises a polypeptide sequence having a length of 10 or more amino acids (e.g., 20 or more, 30 or more, 40 or more, 50 or more, 60 or more, 70 or more, 80 or more, 90 or more, 100 or more, 125 or more, 150 or more, 200 or more, 250 or more, 300 or more, 350 or more, 400 or more, 450 or more, or 500 or more amino acids).
(52) In some cases, the length of the stalk polypeptide can be used to make the surface accessible fusion protein accessible to agents of a defined molecular weight. For example, if the stalk polypeptide is short (e.g, 100 amino acids or less), then a larger agent may not have access to the POI of the surface accessible fusion protein due to steric hindrance. Thus, the length of the stalk polypeptide can be tuned to match a desired agent. For example, if one was going to screen a compound library for binding to a given POI, but they were only interested in compounds below a certain molecular weight (a threshold molecular weight), then a stalk polypeptide of a certain length can be chosen to provide steric hindrance to compounds above that threshold molecular weight. In other words, steric accessibility to a given POI can be tuned to a desired molecular weight cutoff by selecting a stalk polypeptide of an appropriate length. The greater the length of the stalk polypeptide, the less steric hindrance, and the greater accessibility (i.e., as the length of the stalk polypeptide increases, so too does the size of agent that can be used to bind to the POI of the surface accessible fusion protein). For an illustrative example, see the working examples below (
(53) Suitable stalk polypeptides include, but are not limited to, the examples provided here:
(54) TABLE-US-00002 S19(19aminoacids) (SEQIDNO:31) GGGGSGGGGSGSTGGGGGS S41(41aminoacids) (SEQIDNO:32) QTSSPSREASVSTSSTSSSASQSSDPTTTSSSTVSTPATGA S232(232aminoacids) (SEQIDNO:33) QTSSPSTEASVSTSSTSSSASQSSDPTTTSSSSSSSSPSSQSEEISSSPT VSTTPSTSSSSSSMTSTTTTKSISTSTTSSAPVTDVTVSSSPSKSTSTST STETSKTPTSMTEYTSSTSIISTPVSHSQTGLSASSSSSSTTSGSSSTKS ESSTTSGSSQSVESTSSHATVLANSAEMVTTSSSSSSTSEMSLTSTATSV PVSSSSSTTYSTSASTQAVTTTSSSTVSTTSS S465(465aminoacids) (SEQIDNO:34 QTSSPSTEASVSTSSTSSSASQSSDPTTTSSSSSSSSPSSQSEEISSSPT VSTTPSTSSSSSSMTSTTTTKSISTSTTSSAPVTDVTVSSSPSKSTSTST STETSKTPTSMTEYTSSTSIISTPVSHSQTGLSASSSSSSTTSGSSSTKS ESSTTSGSSQSVESTSSHATVLANSAEMVTTSSSSSSTSEMSLTSTATSV PVSSSSSTTYSTSASTQAVTTTSSSTVSTTSSSTTLTSAFTHSSTTSSDQ PPSDTTSPSTTHEPHVTTQTSSETSSSKSSSTSSSSTSQTSESATPSDSV SPGSSTSTSSSSTSTSTSISSGETTTSSSSSSATTTSNSATLSVSTTQTS IEASSSTTSTSSSTITTSSSSAHISSKSQSSITYPSSSTSSSTSSSISSE SESFESTSAEDAPSTAPSSSVSSKSSTSTTSSTSTSSSTPSPSPSSVSSS STSSLTTSAVSTPAT S649(649aminoacids) (SEQIDNO:35) QTSSPSTEASVSTSSTSSSASQSSDPTTTSSSSSSSSPSSQSEEISSSPT VSTTPSTSSSSSSMTSTTTTKSISTSTTSSAPVTDVTVSSSPSKSTSTST STETSKTPTSMTEYTSSTSIISTPVSHSQTGLSASSSSSSTTSGSSSTKS ESSTTSGSSQSVESTSSHATVLANSAEMVTTSSSSSSTSEMSLTSTATSV PVSSSSSTTYSTSASTQAVTTTSSSTVSTTSSSTTLTSAFTHSSTTSSDQ PPSDTTSPSTTHEPHVTTQTSSETSSSKSSSTSSSSTSQTSESATPSDSV SPGSSTSTSSSSTSTSTSISSGETTTSSSSSSATTTSNSATLSVSTTQTS IEASSSTTSTSSSTITTSSSSAHISSKSQSSITYPSSSTSSSTSSSISSE SESFESTSAEDAPSTAPSSSVSSKSSTSTTSSTSTSSSTPSPSPSSVSSS STSSLTTSAVSTPATSHSQSTVVTTTTITTSTGPVMSTTTAYSSSSTSSS ESSEVQSVMSSTPSSTSTTTSSESTSSSSTASTSPSTSQTFETSPTIGGV PSTTSFVSTPTTKLSHTTSTMTAQSDSKSTHSSSTSTEDKSSTASAVDES TTTSTSTESTTSVTSGTSHSAKESSSNSKVYSSQTAHSSISVASSPSTK
(55) In some cases, a subject synthetic stalk polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity (70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 31-35 (e.g., 32-35, 33-35, 34-35). In some cases, a subject synthetic stalk polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity (70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 32-35. In some cases, a subject synthetic stalk polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity (70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 33-35.
(56) Surface Anchor Polypeptide
(57) A subject surface anchor polypeptide of a surface accessible fusion protein anchors the fusion protein to the cell surface. In some cases, the surface anchor polypeptide is (or is derived from) a Glycosylphosphatidylinisotol (GPI) anchor domain. A wide range of cell-surface proteins, including enzymes, coat proteins, surface antigens, and adhesion molecules, are attached to plasma membranes via GPI anchors (Burikofer et al. 2002 FASEB J 15:545). GPI is a post-translationally added lipid anchor; therefore, unlike conventional polypeptide anchors which have different transmembrane domains and connect to specific cytoplasmic extensions, GPI anchors use a common lipid structure to attach to the membrane, which is irrespective of the proteins linked with it (Englund et al., Annul Rev. Biochem. 62:121 (1993)). GPI-anchored proteins are synthesized as precursors with a cleavable, hydrophobic signal sequence at or near the N-terminus that targets the protein to the lumen of the endoplasmic reticulum (ER), and a cleavable signal sequence (GPI anchor domain) at or near the C-terminus that directs GPI anchoring. When a GPI anchor is added to a protein having a GPI anchor domain, all or a portion of the GPI anchor domain is cleaved off from the protein, and a GPI anchor is attached to the protein. A GPI anchor domain includes a hydrophobic region separated from the GPI-attachment site (omega-site) by a hydrophilic spacer region.
(58) GPI anchored proteins have been identified throughout a broad range of eukaryotic species ranging from humans to insects, yeasts, bacteria, and fungi. GPI anchor domains have been identified for many proteins (for example, see Cares et al., Science 243:1196 (1989)). The GPI anchor signals have been successfully engineered onto the C-terminus of other proteins, and these GPI anchored proteins are coated on the cell surface and are functional. (Anderson et al., P.N.A.S. 93:5894 (1996); Brunschwig et al., J. Immunother. 22:390 (1999)).
(59) Examples of suitable GPI anchor domains include, but are not limited to, those disclosed in the following references: Doering, T. L. et al. (1990) J. Biol. Chem. 265:611-614; McConville, M. J. et al. (1993) Biochem. J. 294:305-324; and PCT Publication WO 2003017944; all of which are hereby incorporated by reference in their entirety.
(60) Any convenient GPI anchor domain can be used as a surface anchor polypeptide. Examples of GPI surface anchor polypeptides useful for the subject methods and compositions (e.g., GPI sequences found in S. cerevisiae proteins) include, but are not limited to:
(61) TABLE-US-00003 (SEQIDNO:51) IQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF (SEQIDNO:52) EKSTNSSSSATSKNAGAAMDMGFFSAGVGAAIAGAAAMLL (SEQIDNO:53) SLLKSAASATSSSQSSSKSKGAAGIIEIPLIFRALAELYNLVL (SEQIDNO:54) SSGASSSSSKSSKGNAAIMAPIGQTTPLVGLLTAIIMSIM (SEQIDNO:55) AQANVSASASSSSSSSKKSKGAAPELVPATSFMGVVAAVGVALL (SEQIDNO:56) GPGEKARKNNAAPGPSNFNSIKLFGVTAGSAAVAGALLLL (SEQIDNO:57) SSTGMLSPTSSSSTRKENGGHNLNPPFFARFITAIFHHI (SEQIDNO:58) SSFSSSGGSSESTTKKQNAGYKYRSSFSFSLLSFISYFLL (SEQIDNO:59) YKSTVNGKVASVMSNSTNGATAGTHIAYGAGAFAVGALLL (SEQIDNO:60) SGNLTTSTASATSTSSKRNVGDHIVPSLPLTLISLLFAFI (SEQIDNO:61) GKNGAKSQGSSKKMENSAPKNIFIDAFKMSVYAVFTVLFSIIF (SEQIDNO:62) TGSSSASSSSKSKGVGNIVNVSFSQSGYLALFAGLISALL (SEQIDNO:63) ASGSSTHKKNAGNALVNYSNLNTNTFIGVLSVISAVFGLI (SEQIDNO:64) EDADEDKDDLKRKHRNSASISGPLLPLGLCLLFFTFSLFF
Proteins from which a GPI surface anchor polypeptides can be from (e.g., derived from) include, but are not limited to: mating type protein agglutinin-a-1 (Aga1), flocculin proteins (e.g., Flo1), Sed1, Cwp1, Cwp2, Tip1, Tir1/Srp1, CCW14, CIS3, CWP1, PIR1, and PIR3. In some cases, a subject surface anchor polypeptide comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 80% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 51-64. In some cases, a subject surface anchor polypeptide comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 80% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in SEQ ID NO: 51.
(62) In some cases, the surface anchor polypeptide is heterologous (e.g., a GPI anchor domain from a different species or from a different organism relative to the host cell in which the surface accessible fusion protein will be expressed). The use of a heterologous surface anchor polypeptide (e.g., in some cases in addition to a synthetic stalk polypeptide) can decrease the likelihood that undesired recombination will occur within the yeast genome between yeast genomic sequences and nucleotide sequences encoding the heterologous surface anchor polypeptide (and/or the synthetic stalk polypeptide).
(63) In some cases, the surface anchor polypeptide is a synthetic polypeptide (i.e., the surface anchor polypeptide comprises an amino acid sequence that is not naturally occurring). The use of a synthetic surface anchor polypeptide (e.g., a synthetic GPI anchor domain)(in some cases in addition to a synthetic stalk polypeptide) can decrease the likelihood that undesired recombination will occur within the yeast genome between yeast genomic sequences and nucleotide sequences encoding the synthetic surface anchor polypeptide (and/or the synthetic stalk polypeptide).
(64) An example of a suitable synthetic (e.g., a hybrid) GPI surface anchor polypeptide is:
(65) TABLE-US-00004 (SEQIDNO:71) QIQSSMVEISTYAGSANSVNAGAGAGALFLLLSLAII.
(66) In some cases, a subject surface anchor polypeptide (e.g., a GPI anchor domain) comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with an amino acid sequence (GPI anchor domain amino acid sequence) set forth in any of SEQ ID NOs: 51-64 and 71. In some cases, a subject synthetic surface anchor polypeptide comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in SEQ ID NO: 71. In some cases, a subject synthetic surface anchor polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 71.
(67) Thus, in some cases, a surface accessible fusion protein includes a GPI anchor domain as a surface anchor polypeptide. As such, a GPI anchor domain can be positioned C-terminal to both the signal polypeptide and the stalk polypeptide. In such cases, the POI would be positioned N-terminal to the stalk polypeptide and C-terminal to the signal polypeptide (e.g., between the signal polypeptide and the stalk polypeptide). Thus, in some cases (e.g., when the surface accessible fusion protein includes a GPI anchor domain as the surface anchor polypeptide), the components of the surface accessible fusion protein include, from N-terminal to C-terminal, a signal polypeptide, a POI, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (e.g., a GPI anchor domain). Thus, in some cases, a display moiety (as discussed below) and/or a surface accessible fusion protein includes a GPI anchor domain as a surface anchor polypeptide. In some cases, the surface accessible fusion protein can also include one or more tags, as discussed in more detail below.
(68) In some embodiments, the surface anchor polypeptide comprises a transmembrane (TM) domain (e.g., a transmembrane helix) that inserts into the plasma membrane of a cell.
(69) In some cases, a surface accessible fusion protein is a type I membrane protein (e.g., has a type I TM domain as a surface anchor polypeptide). As such, a TM domain can be positioned C-terminal to both the signal polypeptide and the stalk polypeptide. In such cases, the POI would be positioned N-terminal to the stalk polypeptide and C-terminal to the signal polypeptide (e.g., between the signal polypeptide and the stalk polypeptide). In other words, in such cases, the TM domain would be positioned near the C-terminus of the surface accessible fusion protein, and the POI and stalk polypeptide would both be positioned N-terminal to the TM domain. Thus, in some cases (e.g., when the surface accessible fusion protein is a type I membrane protein and includes a TM domain as the surface anchor polypeptide), the components of the surface accessible fusion protein include, from N-terminal to C-terminal, a signal polypeptide, a POI, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (e.g., a TM domain, a type I TM domain). Thus, in some cases, a display moiety (as discussed below) and/or a surface accessible fusion protein includes a type I TM domain as a surface anchor polypeptide. In some cases, the surface accessible fusion protein can also include one or more tags, as discussed in more detail below.
(70) In some cases, a surface accessible fusion protein is a type II membrane protein (e.g., has a type II TM domain as a surface anchor polypeptide). As such, a TM domain can be positioned C-terminal to the signal polypeptide, and N-terminal to the stalk polypeptide. In such cases, the POI would be positioned C-terminal to the stalk polypeptide. In other words, in such cases, the TM domain would be positioned near the N-terminus of the surface accessible fusion protein, and the stalk polypeptide and the POI would both be positioned C-terminal to the TM domain. Thus, in some cases (e.g., when the surface accessible fusion protein is a type II membrane protein and includes a TM domain as the surface anchor polypeptide), the components of the surface accessible fusion protein include, from N-terminal to C-terminal, a signal polypeptide, a surface anchor polypeptide (e.g., a TM domain, a type II TM domain), a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a POI. Thus, in some cases, a display moiety (as discussed below) and/or a surface accessible fusion protein includes a type II TM domain as a surface anchor polypeptide. In some cases, the surface accessible fusion protein can also include one or more tags, as discussed in more detail below.
(71) Tags
(72) In some cases, a subject surface accessible fusion protein includes a tag. The term tag as used herein is a polypeptide comprising an amino acid sequence that is detectable (directly and/or indirectly) and provides for ease of tracking and/or purification. Examples of suitable tags will be known to one of ordinary skill in the art and any convenient tag can be used. Examples of suitable tags include, but are not limited to directly detectable tags (e.g., a fluorescent polypeptide, e.g., green fluorescent protein (GFP), YFP, RFP, CFP, mCherry, tdTomato, and the like); and affinity tags (e.g. a histidine tag, e.g., a 6His tag; a hemagglutinin (HA) tag; a FLAG tag; a Myc tag; and the like). In some cases, a surface accessible fusion protein includes more than one tag. Thus, in some cases a subject surface accessible fusion protein includes a one or more tags (2 or more, 3 or more, or 4 or more tags, or 1, 2, 3, or 4 tags).
(73) A tag can be positioned anywhere within a surface accessible fusion protein. For example, a tag can be positioned: (i) C-terminal to the signal polypeptide and N-terminal to the POI; and/or (ii) C-terminal to the POI and N-terminal to the synthetic stalk polypeptide. In cases where a surface accessible fusion protein has more than one tag, the tags can be positioned on either end of the POI (e.g., one or more positioned C-terminal to the signal polypeptide and N-terminal to the POI, and one or more positioned C-terminal to the POI and N-terminal to the synthetic stalk polypeptide). In some cases, the tags are positioned in succession (i.e., next to one another).
(74) Surface Accessible Fusion Proteins
(75) A subject surface accessible fusion protein is a single protein that includes multiple components (e.g., a protein composed of polypeptide components that are modular and are linked together by peptide linkages, such that they constitute a single protein). The various components (e.g., signal polypeptide, POI, tag, stalk polypeptide, surface anchor polypeptide) of a subject surface accessible fusion protein can be linked one directly after the other (with no intervening amino acids), or can be separated by linker amino acids (e.g., any number of linker amino acids). For example, in some cases, there are no amino acids separating two given components of a subject surface accessible fusion protein. In some cases, there are one or more amino acids (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 15 or more, 20 or more, 25 or more, 30 or more, or 40 or more amino acids) separating two given components of a subject surface accessible fusion protein. In some cases, there are 20 or less amino acids (e.g., 15 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less amino acids) separating two given components of a subject surface accessible fusion protein.
(76) In some cases, a subject surface accessible fusion protein consists of a signal polypeptide, a POI, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject surface accessible fusion consists of a signal polypeptide, a POI, a stalk polypeptide, a surface anchor polypeptide, and one or more tags. In some cases, a subject surface accessible fusion protein consists essentially of a signal polypeptide, a POI, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject surface accessible fusion consists essentially of a signal polypeptide, a POI, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
(77) Two illustrative examples of suitable surface accessible fusion proteins are depicted below. In the two examples, CV1 is the POI to be displayed. It is a previously described engineered protein that binds CD47 with high affinity. In the following two examples, CV1 is displayed on yeast cells as a surface accessible fusion protein, tethered to a 649 amino acid stalk and one of two different GPI anchors:
(78) TABLE-US-00005 CV1pYDS649HM Signalsequence:Mating-factoralphaleader (aminoacids1-87) (SEQIDNO:11) Proteinofinterest:CV1(aminoacids90-208) (SEQIDNO:7) HAepitopetag(aminoacids211-219) (SEQIDNO:8) Stalk:649aminoacidstalk(aminoacids220-868) (SEQIDNO:35) Surfaceanchor:HybridGPIanchordomain(amino acids871-907) (SEQIDNO:71) (SEQIDNO:9) MRFPSIFTAVLFAASSALAAPANTTTEDETAQPAEAVDYSDLEGDFDAAA LPLSNSTNNGLSSTNTTIASIAAKEEGVQLDKREASAEEELQIIQPDKSV LVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTV SDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELS VRAKPSGSYPYDVPDYAQTSSPSTEASVSTSSTSSSASQSSDPTTTSSSS SSSSPSSQSEEISSSPTVSTTPSTSSSSSSMTSTTTTKSISTSTTSSAPV TDVTVSSSPSKSTSTSTSTETSKTPTSMTEYTSSTSIISTPVSHSQTGLS ASSSSSSTTSGSSSTKSESSTTSGSSQSVESTSSHATVLANSAEMVTTSS SSSSTSEMSLTSTATSVPVSSSSSTTYSTSASTQAVTTTSSSTVSTTSSS TTLTSAFTHSSTTSSDQPPSDTTSPSTTHEPHVTTQTSSETSSSKSSSTS SSSTSQTSESATPSDSVSPGSSTSTSSSSTSTSTSISSGETTTSSSSSSA TTTSNSATLSVSTTQTSIEASSSTTSTSSSTITTSSSSAHISSKSQSSIT YPSSSTSSSTSSSISSESESFESTSAEDAPSTAPSSSVSSKSSTSTTSST STSSSTPSPSPSSVSSSSTSSLTTSAVSTPATSHSQSTVVTTTTITTSTG PVMSTTTAYSSSSTSSSESSEVQSVMSSTPSSTSTTTSSESTSSSSTAST SPSTSQTFETSPTIGGVPSTTSFVSTPTTKLSHTTSTMTAQSDSKSTHSS STSTEDKSSTASAVDESTTTSTSTESTTSVTSGTSHSAKESSSNSKVYSS QTAHSSISVASSPSTKGAQIQSSMVEISTYAGSANSVNAGAGAGALFLLL SLAII CV1pYDS649alphaM Signalsequence:Mating-factoralphaleader (aminoacids1-87) (SEQIDNO:11) Proteinofinterest:CV1(aminoacids90-208) (SEQIDNO:7) HAepitopetag(aminoacids211-219) (SEQIDNO:8) Stalk:649aminoacidstalk(aminoacids220-868) (SEQIDNO:35) Surfaceanchor:Agg1pGPIanchordomain:(amino acids871-910) (SEQIDNO:51) (SEQIDNO:10) MRFPSIFTAVLFAASSALAAPANTTTEDETAQIPAEAVIDYSDLEGDFDA AALPLSNSTNNGLSSTNTTIASIAAKEEGVQLDKREASAEEELQIIQPDK SVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVT TVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTE LSVRAKPSGSYPYDVPDYAQTSSPSTEASVSTSSTSSSASQSSDPTTTSS SSSSSSPSSQSEEISSSPTVSTTPSTSSSSSSMTSTTTTKSISTSTTSSA PVTDVTVSSSPSKSTSTSTSTETSKTPTSMTEYTSSTSIISTPVSHSQTG LSASSSSSSTTSGSSSTKSESSTTSGSSQSVESTSSHATVLANSAEMVTT SSSSSSTSEMSLTSTATSVPVSSSSSTTYSTSASTQAVTTTSSSTVSTTS SSTTLTSAFTHSSTTSSDQPPSDTTSPSTTHEPHVTTQTSSETSSSKSSS TSSSSTSQTSESATPSDSVSPGSSTSTSSSSTSTSTSISSGETTTSSSSS SATTTSNSATLSVSTTQTSIEASSSTTSTSSSTITTSSSSAHISSKSQSS ITYPSSSTSSSTSSSISSESESFESTSAEDAPSTAPSSSVSSKSSTSTTS STSTSSSTPSPSPSSVSSSSTSSLTTSAVSTPATSHSQSTVVTTTTITTS TGPVMSTTTAYSSSSTSSSESSEVQSVMSSTPSSTSTTTSSESTSSSSTA STSPSTSQTFETSPTIGGVPSTTSFVSTPTTKLSHTTSTMTAQSDSKSTH SSSTSTEDKSSTASAVDESTTTSTSTESTTSVTSGTSHSAKESSSNSKVY SSQTAHSSISVASSPSTKGAIQQNFTSTSLMISTYEGKASIFFSAELGSI IFLLLSYLLF
(79) Nucleic Acids
(80) Aspects of the disclosure include nucleic acids for expressing a surface accessible fusion protein, nucleic acids encoding a surface accessible fusion protein, and methods of using the nucleic acids (e.g., to express a surface accessible fusion protein on the surface of a cell, for screening for compounds that bind to a surface accessible fusion protein, for screening for polypeptides that bind to a compound of interest, and the like). In some cases, a subject nucleic acid is a recombinant expression vector (e.g., for expressing a subject surface accessible fusion protein).
(81) In some cases, a subject nucleic acid for expressing a surface accessible fusion protein does not include a nucleotide sequence encoding a protein of interest (POI). For example, the nucleic acid can be a pre-cursor for inclusion of a POI (e.g., between the nucleotide sequences encoding the signal polypeptide and the stalk polypeptide). For example, the nucleic acid can include a nucleotide sequence that encodes a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide (and in some cases a tag), all of which are operably linked to the same promoter where the promoter is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.), but the nucleic acid might not include nucleotides encoding a POI. In some cases, such a nucleic acid is a recombinant expression vector.
(82) In some cases, the nucleic acid (e.g, a recombinant expression vector) includes an insert site for the insertion of a POI. For example, an insertion site for inserting nucleotides encoding a POI can exist between nucleotides encoding a signal polypeptide and a stalk polypeptide (signal:stalk junction), a signal polypeptide and a tag (signal:tag junction) a tag and a stalk polypeptide (tag:stalk junction), and/or a first tag and a second tag (tag:tag junction). In some cases, an insertion site for inserting nucleotides encoding a POI is positioned adjacent to nucleotide encoding a stalk polypeptide.
(83) Insertion sites for use with various technologies are known to those of ordinary skill in the art and any convenient insertion site can be used. In other words, an insertion site can be for any method for manipulating nucleic acid sequences. For example, in some cases the insertion site can be a multiple cloning site (e.g., a site including one or more restriction enzyme sites), a site for ligation independent cloning, a site for recombination based cloning (e.g., recombination based on att sites), a nucleotide sequence recognized by a CRISPR (e.g. Cas9) based technologies, and the like. In some cases, an insertion site can be defined by the junction of the nucleotides encoding one component of a subject surface accessible fusion protein with the nucleotides encoding another component of the subject surface accessible fusion protein (e.g., signal:stalk junction, tag:stalk junction, and/or tag:tag junction) such that there exist no intervening nucleotides. An insertion site can be of any desired length and does not have to be in frame with the 3 components (e.g., nucleotides encoding the stalk polypeptide and the surface anchor polypeptide) because the intent of an insertion site is that it will get modified (e.g., in some cases replaced) to include a nucleotide sequence encoding a protein of interest. One of ordinary skill in the art will appreciate that once nucleotides encoding a POI are inserted at an insertion site, they need to be in frame with both the upstream sequences (e.g., sequences encoding the signal polypeptide) and the downstream sequences (e.g., sequences encoding the stalk polypeptide and the surface anchor polypeptide).
(84) Thus, in some cases, a subject nucleic acid (for expressing a polypeptide of interest on the surface of a cell) includes a nucleotide sequence that encodes a display moiety. A display moiety as used herein, refers to a combination of components of a subject surface accessible fusion protein, other than the POI. For example, a display moiety can include a signal polypeptide, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (not necessarily in that order). In some cases, in order from N-terminal to C-terminal, a display moiety includes a signal polypeptide, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (e.g., a GPI anchor domain, a type I TM domain, etc.). In some cases, in order from N-terminal to C-terminal, a display moiety includes a signal polypeptide, a surface anchor polypeptide (e.g., a type II TM domain, a TM domain from a type II membrane protein, etc.), and a stalk polypeptide (e.g., a synthetic stalk polypeptide). When a subject nucleic acid does not include a POI (e.g., when the nucleic acid includes an insertion site for a POI, when the nucleic acid is intended to be used for the insertion of a nucleotide sequence encoding a POI, etc.), the nucleotides encoding the components of the display moiety need not be in frame with one another prior to the insertion of the nucleotide sequence encoding the PO. For example, they can be in frame with one another after the insertion of the nucleotide sequence encoding a POI such that the encoded surface accessible fusion protein includes the components of the display moiety (i.e., a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide; the order of which can vary depending on the nature of the surface anchor polypeptide as described above). In such cases, the nucleic acid can still be referred to as a nucleic acid that includes nucleotide sequences encoding a display moiety.
(85) In some cases, a subject display moiety includes a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject display moiety includes a signal polypeptide, a stalk polypeptide, a surface anchor polypeptide, and one or more tags. In some cases, a subject display moiety consists of a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject display moiety consists of a signal polypeptide, a stalk polypeptide, a surface anchor polypeptide, and one or more tags. In some cases, a subject display moiety consists essentially of a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide. In some cases, a subject display moiety consists essentially of a signal polypeptide, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
(86) For example, in some cases, a subject nucleic acid (for expressing a polypeptide of interest on the surface of a cell) includes a nucleotide sequence that encodes (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a synthetic stalk polypeptide; and (iii) a third nucleotide sequence that encodes a surface anchor polypeptide. In some cases, (i), (ii), and (iii) are positioned relative to one another in a 5 to 3 orientation and are operably linked to the same promoter, where the promoter is functional in a host cell (e.g., a eukaryotic cell, a vertebrate cell, an invertebrate cell, a mammalian cell, a fungal cell, a yeast cell, etc.). In some such cases, the nucleic acid includes an insertion site (described above) for inserting a nucleotide sequence that encodes a protein of interest (POI), where the insertion site is positioned 3 of (i) and 5 of (ii). In some cases, the nucleic acid also includes a nucleotide sequence that encodes a tag (e.g., positioned such that it is in frame with at least one of the nucleotide sequences that encode the other components [(i), (ii), and (iii)].
(87) In some cases (e.g., when a subject nucleic acid includes a nucleotide sequence that encodes a display moiety), (i), (ii), and (iii) above are positioned relative to one another in a 5 to 3 orientation, in the order: (i), (iii), and (ii) (e.g., when the surface anchor polypeptide is a TM domain and the surface accessible fusion protein will be a type II membrane protein) and are operably linked to the same promoter, where the promoter is functional in a host cell (e.g., a eukaryotic cell, a vertebrate cell, an invertebrate cell, a mammalian cell, a fungal cell, a yeast cell, etc.). In some such cases, the nucleic acid includes an insertion site (described above) for inserting a nucleotide sequence that encodes a protein of interest (POI), where the insertion site is positioned 3 of (ii). In some cases, the nucleic acid also includes a nucleotide sequence that encodes a tag (e.g., positioned such that it is in frame with at least one of the nucleotide sequences that encode the other components [(i), (ii), and (iii)].
(88) Nucleic acids encoding a surface accessible fusion protein include a nucleotide sequence that encodes a surface accessible fusion protein (a fusion protein having a signal polypeptide, a protein of interest (POI), a stalk polypeptide, and a surface anchor polypeptide)(and in some cases a tag). In some cases, the nucleotide sequence that encodes a surface accessible fusion protein is operably linked to a promoter that is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.).
(89) As such, in some cases, a subject nucleic acid (e.g., encoding a surface accessible fusion protein) includes (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a protein of interest (POI); (iii) a third nucleotide sequence that encodes a synthetic stalk polypeptide; and (iv) a fourth nucleotide sequence that encodes a surface anchor polypeptide. In some such cases, (i), (ii), (iii), and (iv) are positioned, from 5 to 3, in order [(i), (ii), (iii), and (iv)], and are in frame with one another such that they collectively encode a surface accessible fusion protein that includes the signal polypeptide, the POI, the stalk polypeptide, and the surface anchor polypeptide (e.g., in some cases in that order). In some cases, the encoded surface accessible fusion protein also includes a tag such that the nucleic acid includes a nucleotide sequence that encodes that tag. In some cases nucleotide sequence encoding the surface accessible fusion protein is operably linked to a promoter that is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.).
(90) In some cases, a subject nucleic acid (e.g., encoding a surface accessible fusion protein) includes (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a surface anchor polypeptide (e.g., a TM domain when the surface accessible fusion protein is a type II membrane protein); (iii) a third nucleotide sequence that encodes a synthetic stalk polypeptide; and (iv) a fourth nucleotide sequence that encodes a protein of interest (POI). In some such cases, (i), (ii), (iii), and (iv) are positioned, from 5 to 3, in order [(i), (ii), (iii), and (iv)], and are in frame with one another such that they collectively encode a surface accessible fusion protein that includes the signal polypeptide, the surface anchor polypeptide, the stalk polypeptide, and the POI (e.g., in some cases in that order). In some cases, the encoded surface accessible fusion protein also includes a tag such that the nucleic acid includes a nucleotide sequence that encodes that tag. In some cases nucleotide sequence encoding the surface accessible fusion protein is operably linked to a promoter that is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.).
(91) As used herein, a promoter sequence or promoter is a DNA regulatory region capable of binding RNA polymerase and initiating transcription of a downstream (3 direction) coding or non-coding sequence. For purposes of the present disclosure, the promoter sequence is bounded at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include at least the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter sequence will be found protein binding domains responsible for the binding of RNA polymerase. Eukaryotic promoters will often, but not always, contain TATA boxes and CAT boxes. Various promoters, including inducible promoters, may be used to drive the various vectors of the present invention. A promoter can be a constitutively active promoter (i.e., a promoter that is constitutively in an active/ON state). A promoter can be an inducible promoter (i.e., a promoter whose state, active/ON or inactive/OFF, is controlled by an external stimulus, e.g., the presence of a particular temperature, compound, or protein).
(92) Any convenient promoter can be used and many promoters are readily available to one of ordinary skill in the art. It will be appreciated that a promoter must be functional in the cell in which the surface accessible fusion protein is to be expressed (e.g., eukaryotic cell, fungal cell, yeast cell, vertebrate cell, mammalian cell, invertebrate cell, etc.). Examples of promoters useful in yeast expression vectors, include but are not limited to: AOX1 promoter, galactose inducible promoters (e.g., pGAL1, pGAL1-10, pGal4, pGal10, etc.), phosphoglycerate kinase (pPGK) promoter, cytochrome c (pCYC1) promoter, alcohol dehydrogenase I (pADH1) promoter, and the like.
(93) Additional exemplary promoters include, but are not limited to the SV40 early promoter, mouse mammary tumor virus long terminal repeat (LTR) promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a rous sarcoma virus (RSV) promoter, a human U6 small nuclear promoter (U6) (Miyagishi et al., Nature Biotechnology 20, 497-500 (2002)), an enhanced U6 promoter (e.g., Xia et al., Nucleic Acids Res. 2003 Sep. 1; 31(17)), a human H1 promoter (H1), and the like.
(94) Examples of inducible promoters include, but are not limited toT7 RNA polymerase promoter, T3 RNA polymerase promoter, Isopropyl-beta-D-thiogalactopyranoside (IPTG)-regulated promoter, lactose induced promoter, heat shock promoter, Tetracycline-regulated promoter, Steroid-regulated promoter, Metal-regulated promoter, estrogen receptor-regulated promoter, etc. Inducible promoters can therefore be regulated by molecules including, but not limited to, doxycycline; RNA polymerase, e.g., T7 RNA polymerase; an estrogen receptor; an estrogen receptor fusion; etc.
(95) Any of the above described nucleic acids can be a recombinant expression vector (which can include any convenient promoter for expressing a subject surface accessible fusion protein, including, but not limited to, any of the promoters described above). In some embodiments, a subject recombinant expression vector is operable in a host cell to direct the expression and display of a surface accessible fusion protein. In some embodiments, a subject recombinant expression vector is operable in a yeast cell to direct the expression and display of a surface accessible fusion protein.
(96) A wide range of recombinant expression vectors are known in the art and available commercially which meet various requirements for recombinant gene expression in yeast. Most yeast vectors are shuttle vectors, which contain sequences permitting them to be selected and propagated in bacteria (e.g, E. coli), thus allowing for convenient amplification and subsequent alteration in vitro. Many common yeast shuttle vectors originated from pBR322. They contain an origin of replication promoting high copy-number maintenance in E. coli (e.g., ColE1 origin of replication), and a selectable antibiotic marker (e.g., the .beta.-lactamase gene, tetracycline resistance gene conferring resistance to, respectively, ampicillin and tetracycline). Specific yeast shuttle vectors include, but are not limited to those described in U.S. Pat. Nos. 5,866,404 and 6,897,353. Additional yeast vectors useful for practicing the methods described herein, for example, but not limited to, the expression of a subject surface accessible fusion protein in a species such as Pichia pastoris (i.e., a Pichia pastoris host cell), are described in U.S. Pat. Nos. 5,707,828, 6,730,499, U.S. Patent Publication No. 20060270041, and PCT Publication Nos. WO2005040395 and WO200231178.
(97) Yeast vectors can contain marker genes that allow selection of transformants containing the desired plasmid. Examples of the most commonly used yeast marker genes include, but are not limited to, URA3, HIS3, LEU2, TRP1 and LYS2, which complement specific auxotrophic mutations in the host cell. The URA3 and LYS2 yeast marker genes have an additional advantage because they allow the use of both positive and negative selection schemes. Selectable marker genes conferring dominant drug resistant phenotype to the yeast host cell, such as the hph and nat genes conferring resistance to hygromycin B and nourseothricin, respectively (see, Sato et al., Yeast 22:583-591 (2005)) may also be used. Most currently used yeast shuttle vectors fall into one of the following three broad categories: (i) integrative vectors, (ii) autonomously replicating high copy-number vectors, or (iii) autonomously replicating low copy-number vectors.
(98) Numerous suitable expression vectors are known to those of skill in the art, and many are commercially available. The following vectors are provided by way of example; for eukaryotic host cells: pXT1, pSG5 (Stratagene), pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia). However, any other vector may be used so long as it is compatible with the host cell.
(99) In some embodiments, the recombinant expression vector is a viral construct, e.g., a recombinant adeno-associated virus construct (see, e.g., U.S. Pat. No. 7,078,387), a recombinant adenoviral construct, a recombinant lentiviral construct, a recombinant retroviral construct, etc. Suitable expression vectors include, but are not limited to, viral vectors (e.g. viral vectors based on vaccinia virus; poliovirus; adenovirus (see, e.g., Li et al., Invest Opthalmol Vis Sci 35:2543 2549, 1994; Borras et al., Gene Ther 6:515 524, 1999; Li and Davidson, PNAS 92:7700 7704, 1995; Sakamoto et al., H Gene Ther 5:1088 1097, 1999; WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655); adeno-associated virus (see, e.g., Ali et al., Hum Gene Ther 9:81 86, 1998, Flannery et al., PNAS 94:6916 6921, 1997; Bennett et al., Invest Opthalmol Vis Sci 38:2857 2863, 1997; Jomary et al., Gene Ther 4:683 690, 1997, Rolling et al., Hum Gene Ther 10:641 648, 1999; Ali et al., Hum Mol Genet 5:591 594, 1996; Srivastava in WO 93/09239, Samulski et al., J. Vir. (1989) 63:3822-3828; Mendelson et al., Virol. (1988) 166:154-165; and Flotte et al., PNAS (1993) 90:10613-10617); SV40; herpes simplex virus; human immunodeficiency virus (see, e.g., Miyoshi et al., PNAS 94:10319 23, 1997; Takahashi et al., J Virol 73:7812 7816, 1999); a retroviral vector (e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus); and the like.
(100) Depending on the host/vector system utilized, any of a number of suitable transcription and translation control elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. may be used in an expression vector (see e.g., Bitter et al. (1987) Methods in Enzymology, 153:516-544).
(101) In some cases, the nucleotides encoding the components of a subject surface accessible fusion protein are operatively linked to a transcription terminator sequence (e.g. to facilitate proper mRNA processing). Thus, in some cases, a subject recombinant expression vector includes a terminator sequence. Examples of transcription termination elements (terminator sequences) include, but are not limited to, the termination sequences of several yeast genes, such as CYC1, ADH1, ARO4, TRP1, ACT1, AND YPT1. Any convenient termination sequence can be used.
(102) One illustrative example of a subject DNA nucleic acid having a nucleotide sequence that encodes a subject surface accessible fusion protein is the 8584 nucleotide (nt) vector set forth in SEQ ID NO: 6. In this example, the signal polypeptide is mating factor alpha leader, which is encoded by nucleotides 856-1113 (SEQ ID NO: 1); the protein of interest (POI) is CV1, which is encoded by nucleotides 1123-1479 (SEQ ID NO: 2); the synthetic stalk polypeptide (649 amino acids) is encoded by nucleotides 1513-3459 (SEQ ID NO: 4); and the surface anchor polypeptide is a synthetic hybrid GPI sequence, which is encoded by nucleotides 3466-3576 (SEQ ID NO: 5). This example nucleic acid also has nucleotides that encode an HA epitope tag (nucleotides 1486-1512) (SEQ ID NO: 3).
(103) Host Cells
(104) Aspects of the disclosure include cells (i.e., host cells) that include the above described surface accessible fusion proteins and/or nucleic acids (e.g, nucleic acids for expressing surface accessible fusion proteins, and/or nucleic acids encoding surface accessible fusion proteins). The term host cell is used herein to refer to a cell in which a subject surface accessible fusion protein is to be expressed and displayed; or to refer to a cell in which a nucleic acid is to be propagated. A host cell can be used to express a subject surface accessible fusion protein from a subject nucleic acid such as a recombinant expression vector (e.g., a eukaryotic host cell) and/or to propagate a subject recombinant expression vector (e.g., a eukaryotic host cell or a prokaryotic host cell).
(105) In some cases, a subject host cell is a prokaryotic cell. For example, in some cases, a subject recombinant expression vector (having nucleotides that encode a surface accessible fusion protein) is inside of a prokaryotic cell for the purposes of propagation and/or purification of the recombinant expression vector. As such, in some cases, a prokaryotic cell (e.g., a bacterial cell such as an E. coli cell) includes a nucleic acid (e.g. a recombinant expression vector) as described above.
(106) In some cases, a suitable host cell is a cell of a single-cell eukaryotic organism, a fungal cell, a yeast cell, an animal cell, a cell from an invertebrate animal (e.g. fruit fly, cnidarian, echinoderm, nematode, etc.), a cell from a vertebrate animal (e.g., fish, amphibian, reptile, bird, mammal), a cell from a mammal (e.g., a pig, a cow, a goat, a sheep, a rodent, a rat, a mouse, a non-human primate, a human, etc.), etc.
(107) In some cases, a suitable host cell is a fungal cell. Any fungal cell (e.g., any convenient species of fungus) is suitable. In some cases, a suitable host cell is a yeast cell. Any convenient species of yeast cell can be used. Illustrative examples of suitable yeast species (i.e., species of suitable yeast cell) include, but are not limited to: Saccharomyces cerevisiae, Schizosaccharomyces pombe, Saccharomyces uvaruium, Pichia pastoris (syn. Komagataella pastoris), Hansenula polymorpha (syn. Ogataea parapolymorpha), Yarrowia lipolytica, Pichia stipitis (syn. Scheffersomyces stipitis), Kluyveromyces marxianus, Pachysolen tannophilus, Candida boidinii, Candida albicans, and Candida sorenensi.
(108) Suitable methods for introducing nucleic acids (e.g., recombinant expression vectors) (also referred to as transformation and/or transfection) include e.g., viral infection, transfection, lipofection, nucleofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct micro injection, nanoparticle-mediated nucleic acid delivery (see, e.g., Panyam et., al Adv Drug Deliv Rev. 2012 Sep. 13. pii: 50169-409X(12)00283-9. doi: 10.1016/j.addr.2012.09.023), and the like. Any convenient method can be used.
(109) The choice of method of introducing nucleic acid is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place. For example, when transforming fungal cells such as yeast, protocols such as those utilizing lithium acetate, single-stranded carrier DNA, and/or PEG (in some cases coupled with heat shock) can be used. One of ordinary skill in the art would be readily able to determine an appropriate protocol for introducing a subject nucleic acid into a desired host cell. A general discussion of various transformation methods can be found in Ausubel, et al., Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995.
(110) For example, for viral vector delivery, cells are contacted with viral particles comprising a subject nucleic acid. Retroviruses, for example, lentiviruses, are particularly suitable. Commonly used retroviral vectors are defective, i.e. unable to produce viral proteins required for productive infection. Rather, replication of the vector requires growth in a packaging cell line. To generate viral particles comprising nucleic acids of interest, the retroviral nucleic acids comprising the nucleic acid are packaged into viral capsids by a packaging cell line. Different packaging cell lines provide a different envelope protein (ecotropic, amphotropic or xenotropic) to be incorporated into the capsid, this envelope protein determining the specificity of the viral particle for the cells (ecotropic for murine and rat; amphotropic for most mammalian cell types including human, dog and mouse; and xenotropic for most mammalian cell types except murine cells). The appropriate packaging cell line may be used to ensure that the cells are targeted by the packaged viral particles. Methods of introducing retroviral vectors having a nucleic acid of interest into packaging cell lines and of collecting the viral particles that are generated by the packaging lines are known in the art.
(111) Methods
(112) Aspects of the disclosure include methods of using the above described surface accessible fusion proteins and nucleic acids. Methods are provided for: (i) expressing a protein of interest (POI) in a eukaryotic cell (e.g., displaying a POI on the surface of a eukaryotic cell); (ii) measuring the binding of an agent to a POI (e.g., in some cases determining whether an agent can bind to a POI); (iii) identifying an agent (a compound) that binds to a POI (e.g., screening test compounds for an agent that binds to a POI); (iv) identifying a polypeptide that binds to an agent (e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a pre-determined value); (v) generating a variant polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived; and the like.
(113) (i) Methods of Expressing
(114) In some embodiments, the subject method is a method of expressing a protein of interest (POI) in a eukaryotic cell (e.g., displaying a POI on the surface of a eukaryotic cell). Such methods include introducing into a cell (e.g., any desired host cell) a subject surface accessible fusion protein that includes the POI. For example, such a method can include introducing into a eukaryotic cell (e.g., a host cell, as described above, such as a fungal cell, a yeast cell, a mammalian cell, etc.) a nucleic acid having a nucleotide sequence that encodes a surface accessible fusion protein, where the surface accessible fusion protein includes a signal polypeptide, a POI, a stalk polypeptide, and a surface anchor polypeptide (and in some cases a tag). A surface accessible fusion protein that includes the POI can be introduced into a cell: (i) directly as a protein (e.g., in some cases using a protein transduction domain); (ii) as an RNA encoding the protein; (iii) or as a DNA encoding the protein. In some cases (e.g., when the surface accessible fusion protein is introduced into a cell as DNA) the nucleotides encoding a surface accessible fusion protein are operably linked to a promoter that is operable in the cell.
(115) In some cases, a method of expressing a protein of interest (POI) in a eukaryotic cell (e.g., displaying a POI on the surface of a eukaryotic cell) further includes any combination of steps of the methods described below.
(116) (ii) Methods of Measuring the Binding
(117) In some embodiments, the subject method is a method of measuring the binding of an agent to a POI (e.g., in some cases determining whether an agent can bind to a POI). Methods of measuring the binding of an agent to a POI can include displaying the POI on the surface of a eukaryotic cell (e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.)(e.g., see methods of expressing above).
(118) Methods of measuring the binding of an agent to a POI include contacting the eukaryotic cell (the cell expressing the POI by displaying the POI on the surface of the cell as a surface accessible fusion protein) with an agent. An agent (also referred to herein as a test compound) can be any agent that can bind to a POI. For example, suitable agents include any chemical entity, pharmaceutical, drug, peptide, antibody, antibody binding fragment, small molecule compound, including both known and potential therapeutic compounds, that can be tested (e.g., screened) for its potential binding to one or more POIs. For example, in some cases, the POI includes an antigen binding domain of an antibody and the agent (e.g., test agent) is a peptide (in some cases a variant of a peptide known to bind to the antibody). In some cases, the POI is an epitope (or a variant of a known epitope) for an antibody and the agent is the antibody or an antigen binding domain from the antibody. In some cases, the POI is the binding region of a ligand or receptor (or a variant thereof) of a ligand/receptor pair.
(119) In some cases, the agent includes a detectable label (e.g., the agent can be directly or indirectly detectable). In some cases, the agent is directly labeled (e.g., the agent can include a directly detectable adduct, such as a fluorescent adduct). In some cases, the agent is indirectly labeled (e.g, the agent can include an indirectly detectable adduct, such as biotin).
(120) In some cases, measuring the amount of the agent bound to the POI (i.e., bound to the surface accessible fusion protein) can be accomplished by measuring the amount of the agent (e.g., quantitatively or qualitatively, as described below) bound to the cell expressing the surface accessible fusion protein.
(121) Measuring an amount as used herein can provide qualitative or quantitative results, and thus, the phrase as used herein encompasses quantitative as well as qualitative measures. For example, in some cases where measuring an amount is qualitative, measuring the amount of an agent bound to a POI includes determining whether an agent is bound or not bound to the POI (e.g., bound or not bound to a cell expressing a surface accessible fusion protein that includes the POI; present or not present at the end of the protocol, etc.). In some cases, measuring the amount of agent bound to a POI includes determining whether an agent is bound or not bound to the POI above a particular threshold of binding. Thus, in some cases, a step of measuring an amount includes is a step of determining whether an agent is bound or not bound to a POI (e.g., to a surface accessible fusion protein, to a cell expressing a surface accessible fusion protein, etc.). In some cases, measuring an amount provides a simple yes or no determination of whether an agent is present.
(122) Likewise, in some embodiments, measuring an amount includes determining a quantitative measure of the amount of agent bound to a surface accessible fusion protein (e.g., using flow cytometry, ELISA, or any other method that can quantitatively measure the amount of agent present at the end of a given protocol, e.g., present after a final washing step). The amount (level) of agent bound can be expressed in arbitrary units associated with a particular assay (e.g., fluorescence units, e.g., mean fluorescence intensity (MFI)), or can be expressed as an absolute value with defined units (e.g., number of molecules (e.g., moles), number of protein molecules, concentration of agent, etc.). Additionally, a quantitatively measured amount (level) can be compared to the amount of a reference value to derive a normalized value that represents a normalized measured amount. Thus, a step of measuring an amount can be a detecting in a qualitative manner (present vs absent; yes, above a predetermined threshold vs no, not above a predetermined threshold; etc.) or a quantitative manner.
(123) Techniques such as flow cytometry and ELISA can be used in both qualitative and quantitative steps of measuring. For example, both of the techniques can be used to determine a quantitative amount (e.g., in fluorescent units such as mean fluorescent intensity (MFI)) of an agent that is present, but can also be used to simply determine if the amount present is present above a particular threshold.
(124) (iii) Methods of Identifying an Agent
(125) In some embodiments, the subject method is a method of identifying an agent (a compound) that binds to a POI (e.g., screening test compounds for an agent that binds to a POI). Methods of identifying an agent that binds to a POI include displaying the POI on the surface of a eukaryotic cell (e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.), contacting the cell with an agent, and measuring the amount (quantitatively and/or qualitatively) of agent that is bound to the cell.
(126) In some cases, a given surface accessible fusion protein can be displayed on the surface of two or more cells (e.g., on the surface of cells in two or more separate populations of cells), and each cell (e.g., each separate population of cells) is contacted with a different agent. Thus, two or more agents (e.g., a library of agents) can be screened to identify which, if any, of the agents binds to the cells expressing the POI as a surface accessible fusion protein.
(127) As noted above, in some cases, the POI includes an antigen binding domain of an antibody and the agent (e.g., test agent) is a peptide (in some cases a variant of a peptide known to bind to the antibody); in some cases, the POI is an epitope (or a variant of a known epitope) for an antibody and the agent is the antibody or an antigen binding domain from the antibody; and in some cases, the POI is the binding region of a ligand or receptor (or a variant thereof) of a ligand/receptor pair. In some such cases, a method can include a step of mutagenesis (e.g., using any convenient method, such as random or site-directed PCR protocols). For example, two or more test agents (e.g., a library of test agents) can be generated (e.g. two or more agents that are variants of one another), and the agents can be used to contact cells expressing a subject surface accessible fusion protein, and those agents that bind to the cells can be identified.
(128) In some cases, the concentration of an agent can be controlled so that only those agents that bind with a particular affinity (or better) will be identified. In some cases, different concentrations of a given agent can be used to contact each cell (e.g., separate populations of cells). As such, the methods can be used to determine whether the binding of an agent to a given POI is maintained at different concentrations of agent (which, for example, can be used to estimate an affinity of the agent for the POI). For example, an agent can be used at 10 nM, 100 nM, and 1000 nM to contact three different cell populations, each expressing the same surface accessible fusion protein. Whether or not the agent is bound can be determined for each concentration, and an estimate of binding affinity can be made. For example, an agent that binds at all three concentrations can be said to bind to a given POI with a higher affinity than an agent that binds at 1000 nM but does not bind at 100 nM or 10 nM.
(129) In some cases, a cell expressing a surface accessible fusion protein can be contacted at the same time (simultaneously) with two or more agents, where the agents are distinguishable from one another (e.g., where each agent has a different detectable label). As an illustrative example, a given cell or population of cells can be contacted with 10 different agents, where each agent includes a different detectable label (e.g., a different fluorescent label). After the appropriate washes, the amount of each detectable label can be measured (quantitatively and/or qualitatively). For example, one may use such a method to pool multiple different agents to identify those that bind to the surface accessible fusion protein from those that don't.
(130) (iv) Methods of Identifying a Polypeptide
(131) In some embodiments, the subject method is a method of identifying a polypeptide that binds to an agent (e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a pre-determined value). Methods of identifying a polypeptide that binds to an agent include displaying the POI on the surface of a eukaryotic cell (e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.). Such methods can be identical to those above for methods of identifying an agent, but this case the used may be held constant (or used at particular concentrations), but the agent is used to contact two or more cells, where at least two of the two or more cells expresses (is displaying) a different POI in the form of a different surface accessible fusion protein. For each cell (or each population of cells), binding of the agent can be measured (qualitatively or quantitatively), and one can thereby determine which of the two or more POIs can bind to a given agent (or to a given concentration of a given agent).
(132) (v) Methods of Generating a Variant Polypeptide
(133) In some embodiments, the subject method is a method of generating a variant polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived. Such methods include a step generating one or more variant polypeptides (e.g., using any convenient method to generate a variant, e.g., PCR based mutagenesis). For example, the variant polypeptides would be identical to the starting surface accessible fusion protein, with the exception that they would different by one or more amino acids at the POI portion of the surface accessible fusion protein. Measuring the amount of binding of an agent with one or more of the generated variants would then be used to identify which of the variants bind to the agent.
(134) As noted above, in some cases, a POI includes an antigen binding domain of an antibody and the agent (e.g., test agent) is a peptide (in some cases a variant of a peptide known to bind to the antibody); in some cases, the POI is an epitope (or a variant of a known epitope) for an antibody and the agent is the antibody or an antigen binding domain from the antibody; and in some cases, the POI is the binding region of a ligand or receptor (or a variant thereof) of a ligand/receptor pair. In some such cases, a method can include a step of mutagenesis (e.g., using any convenient method, such as random or site-directed PCR protocols). For example, two or more POIs (two or more surface accessible fusion proteins) can be generated (e.g., to generate a library of surface accessible fusion proteins) (e.g., where the POIs are variants of one another and/or variants of a staring POI). An agent can then be used to contact cells (e.g., different populations of cells) expressing the two or more surface accessible fusion proteins (the variants), and those POIs that bind to the agent can then be identified.
(135) Similar to the above, in some cases, the concentration of an agent can be controlled so that only those POIs that bind with a particular affinity (or better) to the agent will be identified. In some cases, different concentrations of a given agent can be used to contact the each cell (e.g., separate populations of cells, multiple copies of a library of cells, etc.). As such, the methods can be used to identify only those POIs that can bind to a given agent when the agent is present at a given concentration. As an illustrative example, one may contact two or more different POIs (via contacting cells expressing surface accessible fusion proteins) with an agent at a given concentration (e.g., 100 nM), and they may identify a large number of POIs that bind the agent. The POIs could then be re-screened using a lower concentration of agent (e.g., 10 nM), to limit the number of POIs identified.
(136) For any or all of the above methods, various control may be used. For example, a surface accessible fusion protein having a control POI (or no POI) can be used to provide a control for the amount of signal expected in the absence of binding. Various such controls would be readily contemplated by one of ordinary skill in the art and any convenient control can be used.
(137) Kits
(138) Also provided are kits for use in the methods. The subject kits can include any of above described surface accessible fusion proteins and/or nucleic acids. For example, in some cases, a suitable kit includes a nucleic acid (e.g., a recombinant expression vector) for expressing a surface accessible fusion protein, or a nucleic acid (e.g., a recombinant expression vector) encoding a surface accessible fusion protein, as described above. In some cases, a kit includes two or more DNA nucleic acids (e.g., recombinant expression vectors).
(139) In some cases, a kit includes two or more subject DNA nucleic acids (e.g., recombinant expression vectors) for expressing a surface accessible fusion protein. The kits can include nucleic acids that include nucleotides encoding a POI, nucleic acids that do not include nucleotides encoding a POI, nucleic acids that include an insertion site for inserting nucleotides encoding a POI, etc. In some cases, at least two of the two or more DNA nucleic acids include an insertion site for inserting a POI.
(140) In some cases, the synthetic stalk polypeptides encoded by at least two of the two or more DNA nucleic acids are of different lengths. For example, in some cases, the stalk polypeptides (e.g., synthetic stalk polypeptides) encoded by at least two of the two or more DNA nucleic acids have a length in a range of: from 20 to 100 amino acids, from 40 amino acids to 100 amino acids, from 101 to 200 amino acids, from 201 to 300 amino acids, from 301 to 400 amino acids, from 401 to 500 amino acids, from 501 to 600 amino acids, from 601 to 700 amino acids, from 701 to 800 amino acids, from 801 to 900 amino acids, from 901 to 1000 amino acids, or from 1001 to 1500 amino acids. In some cases, the synthetic stalk polypeptides encoded by at least two of the two or more DNA nucleic acids are of different lengths and each have a length in a range of: from 20 to 100 amino acids, from 40 amino acids to 100 amino acids, from 101 to 200 amino acids, from 201 to 300 amino acids, from 301 to 400 amino acids, from 401 to 500 amino acids, from 501 to 600 amino acids, from 601 to 700 amino acids, from 701 to 800 amino acids, from 801 to 900 amino acids, from 901 to 1000 amino acids, or from 1001 to 1500 amino acids. As such, in some cases, a kit can include multiple DNA nucleic acids (e.g., for expressing a subject surface accessible fusion protein), where the stalk polypeptides encoded by multiple DNA nucleic acids span a range of lengths.
(141) In some cases, the synthetic stalk polypeptides encoded by at least two of the two or more DNA nucleic acids have different sequences (e.g., even if they are of the same length).
(142) As an illustrative example, one nucleic acid (e.g., recombinant expression) of a kit might encode a stalk polypeptide with a length in a range of from 20 to 100 amino acids, and another might encode a stalk polypeptide with a length in a range of from 101 to 200 amino acids. In other words, a kit may have multiple nucleic acids (e.g., recombinant expression vectors) encoding multiple different stalk polypeptides (e.g, differing by length and/or by sequence). Such a kit would allow one to perform the subject methods using multiple different surface accessible fusion proteins, even if in some cases the POI was the same for different fusion proteins. In the same vein, in some cases, at least two of the two or more DNA nucleic acids encode different signal polypeptides, different tags (and/or a different arrangement of tags, i.e., different positioning of the nucleotides encoding the tags relative to the other encoded components), and/or different surface anchor polypeptides (e.g., different GPI anchors). In some cases, at least two of the two or more DNA nucleic acids have different insertion sites. Any or all combinations of the above are contemplated.
(143) Any of the above-described kits can further include one or more additional reagents, where such additional reagents can be selected from: a dilution buffer; a reconstitution solution; a wash buffer; a control reagent; a control expression vector; a reagent; a host cell having a subject nucleic acid; a host cell not having a subject nucleic acid (e.g. a nucleic acid for expressing a surface accessible fusion protein, a nucleic acid encoding a surface accessible fusion protein, etc.), and the like. Components of a subject kit can be in separate containers (e.g., different tubes, different wells of a multiwell plate, etc.), and can in some cases be combined in a single container.
(144) In addition to the above components, the subject kits may further include (in certain embodiments) instructions for practicing the subject methods. These instructions may be present in the subject kits in a variety of forms, one or more of which may be present in the kit. One form in which these instructions may be present is as printed information on a suitable medium or substrate, e.g., a piece or pieces of paper on which the information is printed, in the packaging of the kit, in a package insert, and the like. Yet another form of these instructions is a computer readable medium, e.g., diskette, compact disk (CD), flash drive, and the like, on which the information has been recorded. Yet another form of these instructions that may be present is a website address which may be used via the internet to access the information at a removed site.
(145) Utility
(146) The compositions and methods described herein can be used to develop new fungal cells (e.g., new yeast strains) for various purposes, including but not limited to fermentative production of chemicals and polypeptides. In addition, the compositions and methods described herein may be used for a variety of research purposes, including the expression of mutagenized proteins or other combinatorial libraries on yeast. In contrast to other methods, the compositions and methods described herein use monocistronic vectors, enabling use in a wide variety of yeast strains and species. Moreover, the compositions and methods described herein allow selective (tunable) accessibility to a protein of interest (e.g., by varying the length of the stalk polypeptide), which can controlled to limit the molecular weight of a substrate or binding partner. Expression of proteins on the surface of eukaryotic cells (e.g., fungal cells, yeast cells etc.) is widely used in industry for a diverse array of purposes. The compositions and methods described herein allow straightforward and simple expression of any desired protein (a protein of interest) fused to a synthetic stalk polypeptide. Because a POI can be displayed as part of a surface accessible fusion protein using a monocistronic vector, the system is readily portable to a variety of yeast strains and species.
(147) The invention now being fully described, it will be apparent to one of ordinary skill in the art that various changes and modifications can be made without departing from the spirit or scope of the invention.
EXPERIMENTAL
(148) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
(149) All publications and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
(150) The present invention has been described in terms of particular embodiments found or proposed by the present inventor to comprise preferred modes for the practice of the invention. It will be appreciated by those of skill in the art that, in light of the present disclosure, numerous modifications and changes can be made in the particular embodiments exemplified without departing from the intended scope of the invention. For example, due to codon redundancy, changes can be made in the underlying DNA sequence without affecting the protein sequence. Moreover, due to biological functional equivalency considerations, changes can be made in protein structure without affecting the biological action in kind or amount. All such modifications are intended to be included within the scope of the appended claims.
EXAMPLES
Example 1
(151)
(152)
(153)
Example 2: Directed Evolution of Human PD-L1 Protein for High-Affinity PD-1 Binding
(154) Objective:
(155) to identify mutant variants of PD-L1 that bind to T cell-expressed PD-1 with high affinity and specificity, thereby acting as a competitive inhibitor of interactions with PD-L1 expressed on the surface of tumor cells or tumor-infiltrating immune cells.
(156) Approach:
(157) select a stable subunit of the human PD-L1 protein from the region that interacts with the PD-1 protein; select amino acid residues likely to be important for this interaction, and by PCR and Gibson cloning, generate a library of plasmids that encode mutant variants of PD-L1 attached to a GPI-linked anchor (as per the primary technology described in the patent); electroporate library of plasmids into yeast or fungal strain; induce surface display of mutant proteins; select for high-affinity binders by assessing interaction with a tagged, soluble, recombinant PD-1 protein; upon isolation of a pool of high-affinity PD-1 binders, extract DNA from the resulting yeast population and sequence the variants present; assess binding affinity of sequences and assemble consensus variant sequences to maximize binding affinity.
Example 3: Directed Evolution of a Soluble Fragment of Human IL2R for High-Affinity Binding to IL-2
(158) Objective:
(159) to identify mutant variants of the cytokine receptor subunit IL2R that bind to endogenous IL-2 with high affinity and specificity, thereby acting as a competitive sink to inactivate the interaction of IL-2 with endogenous IL-2 receptor complexes.
(160) Approach:
(161) select a stable subunit of the human IL2R protein from the region that interacts with the IL-2 protein; select amino add residues likely to be important for this interaction, and by PCR and Gibson cloning, generate a library of plasmids that encode mutant variants of IL2R attached to a GPI-linked anchor (as per the primary technology described in the patent); electroporate library of plasmids into yeast or fungal strain; induce surface display of mutant proteins; select for high-affinity binders by assessing interaction with a tagged, soluble, recombinant IL-2 protein; upon isolation of a pool of high-affinity IL-2 binders, extract DNA from the resulting yeast population and sequence the variants present; assess binding affinity of sequences and assemble consensus variant sequences to maximize binding affinity.
Example 4: Yeast Surface Display of Human Antibody Libraries
(162) Objective:
(163) to express human antibody binding domains, either as fragments of antigen binding (Fab) or single chain variable fragments (scFv), on the surface of yeast for the purpose of generating high-affinity, high-specificity therapeutic human monoclonal antibodies against any known cell surface or secreted protein.
(164) Approach:
(165) By gene synthesis, generate a library of plasmids that encode variants of human antibody binding regions (either in Fab or scFv format) fused to a GPI-linked anchor (as per the primary technology described in the patent); electroporate library of plasmids into yeast or fungal strain; induce surface display of antibody fragments; select for high-affinity binders by assessing interaction with a tagged, soluble, recombinant protein corresponding to the desired region of protein binding (for example, to generate a therapeutic antibody which would bind PD-1 and block its interaction with PD-L1, one would pan the library using a tagged fragment of PD-1 that included the interacting region with PD-L1); upon isolation of a pool of high-affinity binders, extract DNA from the resulting yeast population and sequence the antibody variants present; assess binding affinity of individual sequences as recombinant antibodies.
Example 5: Yeast Surface Display of Alternative Scaffold Libraries
(166) Objective:
(167) to express alternative scaffold libraries, including but not limited to fibronectins, immunoglobulins, knottins, DARPins, anticalins, on the surface of yeast for the purpose of generating high-affinity, high-specificity therapeutic human monoclonal antibodies against any known cell surface or secreted protein.
(168) Approach:
(169) By gene synthesis, generate a library of plasmids that encode variants of human antibody binding regions (either in Fab or scFv format) fused to a GPI-linked anchor (as per the primary technology described in the patent); electroporate library of plasmids into yeast or fungal strain; induce surface display of alternative scaffold proteins; select for high-affinity binders by assessing interaction with a tagged, soluble, recombinant protein corresponding to the desired region of protein binding (for example, to generate a therapeutic alternative scaffold protein which would bind PD-1 and block its interaction with PD-L1, one would pan the library using a tagged fragment of PD-1 that included the interacting region with PD-L1); upon isolation of a pool of high-affinity binders, extract DNA from the resulting yeast population and sequence the alternative scaffolds present; assess binding affinity of individual sequences as recombinant proteins.
Example 6: Yeast Surface Display of Translated cDNAs to Identify Interacting Proteins of a Target of Interest in an Unbiased Fashion
(170) Objective:
(171) to express the proteins encoded by cDNA collections, for example from a tumor-derived cell line, or a normal cell type, on the surface of yeast for the purpose of panning with a protein of interest, in order to identify novel interacting partners based on binding to the protein of interest.
(172) Approach:
(173) By gene synthesis, generate a library of plasmids that encode cDNAs derived from a cell type of interest fused to a GPI-linked anchor (as per the primary technology described in the patent); electroporate library of plasmids into yeast or fungal strain; induce surface display of alternative scaffold proteins; select for high-affinity binders by assessing interaction with a tagged, soluble, recombinant protein of interest; upon isolation of a pool of yeast that express proteins that interact with the protein of interest, extract DNA from the resulting yeast population and sequence the alternative scaffolds present to identify the responsible cDNAs.