MSC-EXPRESSED IMMUNOMODULATORS IN COMBINATION WITH CAR-T FOR CANCER THERAPY

20200345775 ยท 2020-11-05

Assignee

Inventors

Cpc classification

International classification

Abstract

This technology describes novel cell based combined therapeutic modalities that induces mechanism based tumor cell killing in a broad spectrum of sensitive and resistant tumors. These new agents are tumor specific and target a broad spectrum of solid tumors.

Claims

1. A method of treating a solid tumor cancer in a subject, the method comprising: a. administering a genetically modified T cell expressing on its cell surface a chimeric T cell antigen receptor comprising a heterologous binding domain that specifically binds a tumor antigen expressed on the surface of cells of the cancer, and an intracellular signaling domain, wherein binding of the heterologous binding domain to the tumor antigen on the surface of a cancer cell activates the intracellular signaling domain and the T cell; and b. administering a first genetically modified mesenchymal stem cell, that expresses a heterologous immunomodulatory polypeptide, wherein the heterologous immunomodulatory polypeptide potentiates cancer cell killing by the genetically modified T cell.

2. The method of claim 1, further comprising, before the administering steps, the step of resecting a solid tumor from the subject, wherein the resecting creates a cavity formerly occupied by tumor tissue.

3. The method of claim 1, wherein the first genetically modified mesenchymal stem cell is administered systemically.

4. The method of claim 2, wherein the first genetically modified mesenchymal stem cell is administered in the cavity formed by resection of the tumor.

5. The method of claim 1, wherein the first genetically modified mesenchymal stem cell is encapsulated in a matrix.

6. The method of claim 5, wherein the matrix permits cell migration out of the matrix.

7. The method of claim 5, wherein the matrix comprises a synthetic extracellular matrix.

8.-9. (canceled)

10. The method of claim 1, wherein the heterologous immunomodulatory polypeptide is a checkpoint inhibitor polypeptide.

11. The method of claim 1, wherein the heterologous immunomodulatory polypeptide is Interleukin (IL) IL-12, IL-2, IL-5, IL-15, interferon , interferon , interferon , or a combination thereof.

12. The method of claim 10, wherein the checkpoint inhibitor polypeptide comprises an antibody or antigen-binding domain thereof that binds a checkpoint polypeptide selected from the group consisting of PD-L1, PD-1, CTLA-4, TIM-3, LAG-3, or TIGIT.

13. The method of claim 10, wherein the checkpoint inhibitor polypeptide comprises an antibody or antigen-binding domain thereof that binds PD-L1.

14. The method of claim 1, wherein the heterologous binding domain comprises a nanobody or an scFv.

15. The method of claim 1, wherein the heterologous binding domain that specifically binds a tumor antigen expressed on the surface of cells of the cancer specifically binds a polypeptide selected from the group consisting of EGFRvIII, HER2, CD133, EGFR, IL13RA2, HER2, CSF1-R, L1-CAM, CTAG1B, GD2 and EGFR.

16. The method of claim 1, wherein the heterologous binding domain specifically binds to EGFRvIII.

17. The method of claim 1, wherein the genetically modified T cell is encapsulated in a matrix.

18. (canceled)

19. The method of claim 2, wherein the genetically modified T cell is administered to the cavity formed by resection of the tumor.

20.-21. (canceled)

22. The method of claim 1, wherein the first genetically modified mesenchymal stem cell additionally expresses a heterologous polypeptide selected from the group consisting of: TRAIL, EGFR nanobody-TRAIL fusion, Thrombospondin (TSP)-1, HSV-TK, cytosine deaminase (CD) or a combination thereof, or encodes and delivers an oncolytic virus.

23. (canceled)

24. The method of claim 1, further comprising administering a second genetically modified mesenchymal stem cell, the second genetically modified mesenchymal stem cell expressing a heterologous polypeptide other than that expressed by the first mesenchymal stem cell, wherein the heterologous polypeptide is selected from the group consisting of: Interleukin (IL)-12, IL-2, IL-5, IL-15, TRAIL, EGFR nanobody-TRAIL fusion, Thrombospondin (TSP)-1, interferon , interferon , interferon , HSV-TK, and cytosine deaminase (CD); or encodes and delivers an oncolytic virus; or a combination thereof.

25.-28. (canceled)

29. A composition comprising: a. a genetically modified T cell expressing on its cell surface a chimeric T cell antigen receptor comprising a heterologous binding domain that specifically binds a tumor antigen expressed on the surface of cells of a cancerous tumor, and an intracellular signaling domain, wherein binding of the heterologous binding domain to the tumor antigen on the surface of a cancer cell activates the intracellular signaling domain and the T cell; and b. a first genetically modified mesenchymal stem cell, that expresses a heterologous immunomodulatory polypeptide.

30.-42. (canceled)

43. A kit for treatment of a solid tumor, the kit comprising the composition of claim 29, and packaging materials therefor.

44.-45. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0066] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

[0067] FIGS. 1A-E depicts experimental data showing that surgical GBM tumor resection reduces myeloid derived suppressor cells (MDSCs) and enhances infiltration of DC and T cells. Mono nuclear cells isolated from whole brains from different tumor free (TF) and CT2A-FmC tumor bearing brains pre and post resection and stained with antibodies recognizing CD45, CD11b, Gr-1, CD11c, CD4 and CD8, and analyzed by flow cytometry. The percentage of (FIG. 1A) MDSC (CD45.sup.hig.sup.hCD11b.sup.hig.sup.hGr-1.sup.hig.sup.h) and (FIG. 1B) lymphocytes (CD45.sup.hig.sup.hCD11b.sup.low) are shown. FIG. 1C-E shows flow cytometry plots (C) and plots (D-E) showing CD4+ and CD8+ effector T cells at different time points.

[0068] FIG. 2A-E depicts experimental data showing that MSC-IFN has dual cytotoxic and immunomodulatory function. FIG. 2A shows RT-PCR analysis of IFNAR1/2 transcript in CT-2A and GL261 cDNA extracts. FIG. 2B shows Western blot analysis on CT2A cell lysates post-treatment with mIFN13 showing phosphorylation status of STAT1, p38. FIG. 2C shows representative flow cytometry density plots of cell cycle analysis. FIG. 2D shows plot showing viability of CT2A cells treated with MSC-mIFN13 and MSC-GFP conditioned medium. A representative fluorescence image MSC expressing mIFN13 is shown. FIG. 2E shows Kaplan-Meier survival curves of C57/B6 or SCID mice bearing CT2A-FmC injected intratumorally with MSC-mIFN13 or MSC-GFP.

[0069] FIG. 3A-E depicts experimental data showing that mouse GBM cells express PD-L1 and MSC-ScFv-PD-L1 have antitumor efficacy in resected GBM. FIG. 3A-B shows (A) Western blot and (B) flow cytometry analysis on mouse GBM cells to assess PD-L1 expression. Unstained cells shown as blue were used for comparison. FIG. 3C depicts the design of retroviral vector expressing secretable ScFv-PD-L1. FIG. 3D depicts a plot showing survival of GBM cells expressing EGFRvIII-Fluc treated with conditioned medium from MSC-ScFV-PD-L1 and EGFRvIII CAR T cells (GBM:T cells ratio 1:5.) Fluorescence image of MSC transduced with RV-ScFV-PD-L1 is shown. FIG. 3E shows Kaplan-Meier survival curves of C57/B6 mice bearing CT2A-FmC tumors intratumorally injected with MSC-ScFv-PD-L1 or MSC-GFP.

[0070] FIG. 4 depicts experimental data showing MSCs expressing CCL-2. Mouse and human MSC and GBM cells were cultured and Western blot analysis was performed using anti CCL2 antibody on the conditioned medium obtained after 24 hours of culturing cells.

[0071] FIG. 5A-C shows MSC-IFN treatment upregulates PD-L1 on tumor cells in vitro and in vivo. FIG. 5A-B shows Gl261-FmC were treated with (A) recombinant IFN or (B) co-cultured with MSC-IFN or MSC-GFP in the presence or absence of 10 g/mL IFNaR1 blocking antibody, MAR1-5A3 followed by FACS analysis of tumor cell PD-L1 expression 48 h post treatment. FIG. 5C shows FACS analysis showing PD-L1 expression on tumor cells isolated from GL261-FmC tumor bearing mice 3 days post-intratumoral injection with MSC-IFN or MSC-GFP.

[0072] FIG. 6A-F shows MSC mediated IL-12 expression induces CD4 and CD8 T cell response in vitro and influences tumor volumes in vivo. FIG. 6A shows Photomicrograph of mouse MSC expressing IL-12. FIG. 6B shows Western blot analysis showing expression of IL-12 in cells lysates and conditioned medium. FIG. 6C depicts a plot showing sorted T cells activated with anti-CD3 and anti-CD28 and cultured in presence of 1 L of conc. supernatant from MSC-IL-12 and MSC-GFP. FIG. 6D-E shows activated T cells were followed by intracellular staining for IFN and granzyme B. Plots showing % IFN+ cells in CD4 T cells (D) and % granzyme B+ cells in CD8+ T cells (E). Insets show representative flow cytometry plots. FIG. 6F shows that mice bearing syngeneic brain tumors were implanted intratumorally with 510.sup.5 MSC-IL-12 or MSC-GFP. Plot showing changes in tumor volumes over time.

[0073] FIG. 7A-D shows efficiency of Tet regulatable system. FIG. 7A shows regulatable dual promoter vector design. FIG. 7B-C shows plot and representative images showing activity of MSC expressing regulatable GFP-Fluc post 9 TB-Dox induction in vitro (1 g/mL) (B) and in mice implanted intracranially with MSC-GFP-Fluc (110.sup.5) and administered 9 TB-dox (10 mg/kg) i.p. twice daily with initial dose starting at 12 hours post MSC implantation (C). FIG. 7D shows Western blot analysis on the lysates MSC-N1KO transduced with LV-TET-IL2 and treated with 9 TB-Dox.

[0074] FIG. 8A-F shows EGFRvIII CAR engineered T cells have anti-tumor effects in culture. FIG. 8A shows human and mouse EGFRvIII CAR design. FIG. 8B shows lentiviral and retroviral constructs for transduction of T cells. FIG. 8C shows T cells were isolated from PBMCs and were activated with anti-CD3+28 beads for 24 hours followed by addition of LV-EGFRvII CAR-Fluc supernatant. Three days post-transduction, T cells were harvested for flow cytometry analysis where cells were gated on live cells by SYTOX live/dead staining followed by GFP expression, and transduced T cells served as control (C). FIG. 8D shows Western blot analysis with CD3z antibody. FIG. 8E-F shows human GBM-vIII-mcherry-fluc cells were co-cultured with CAR transduced T cells or un-transduced cells for 24 hours. Live GBM cells were detected by Rluc bioluminescence and mCherry fluorescence. % specific lysis was calculated.

[0075] FIG. 9A-B shows EGFRvIII CAR engineered T cells injected intravenously have no efficacy in mice bearing brain tumors. FIG. 10A depicts the experimental outline. FIG. 9B shows mice bearing human GBM expressing vIII variant of EGFR and Rluc were treated intravenously with EGFRvIII CAR T or T cells expressing Fluc (110.sup.6 cells). Mice were imaged sequentially for Fluc (T cells) and Rluc (Tumor cells) in vivo. Representative images and include T cell imaging, tumor imaging, and representative plots showing changes in tumor volumes post T cell treatment.

[0076] FIG. 10A-B shows EGFRvIII CAR engineered T cells implanted intratumorally have efficacy in mice bearing brain tumors. FIG. 10A shows the experimental outline. FIG. 10B shows Mice bearing human GBM expressing vIII variant of EGFR and Rluc were implanted intratumorally with EGFRvIII CAR T or T cells (510.sup.5 cells). Mice were imaged for tumor volumes by Rluc imaging in vivo. Representative images and plots showing changes in tumor volumes post T cell treatment are shown.

[0077] FIG. 11A-B shows sECM encapsulated EGFRvIII CAR engineered T cells and MSC releasing IL-12 placed in the tumor resection cavity have therapeutic benefits in mice bearing brain tumors. FIG. 11A shows the experimental outline. FIG. 11B shows mice bearing human GBM expressing vIII variant of EGFR and Fluc were resected and implanted with sECM encapsulated EGFRvII CAR T and MSC-IL-12 or MSC-GFP (510.sup.5 each population). Mice were imaged for tumor volumes by Fluc imaging in vivo. Representative plot showing changes in tumor volumes post treatment.

DETAILED DESCRIPTION

[0078] Cancer therapies exploiting the immune system's ability to destroy cells expressing particular cell-surface markers are showing success against cancers such as leukemias that do not form solid tumors. In particular, chimeric antigen receptor-expressing T cells (CAR T) are used, which artificially target cytotoxic T cells to kill tumor cells by introducing a modified T cell receptor construct to the T cells, in which the receptor's native antigen-binding domain is replaced with a binding domain, most often involving an antibody's antigen-binding domain, that binds a tumor antigen. CAR Ts are proving very effective against non-solid tumor cancers. However, targeting solid tumors with this approach is proving more challenging. The solid tumor microenvironment, it turns out, is immunosuppressive, often containing more than one layer of protection that obstructs the ability of immune cells to effectively reach and kill transformed cells of the tumor. As but one example, many tumors express immune checkpoint ligands, such as PD-L1, the normal functions of which are to assist in maintaining immune homeostasis and thereby avoid autoimmunity. A tumor expressing PD-L1 will tend to suppress the activity of cytotoxic T cells reaching the tumor by interaction with the negative immunoregulator PD-1 expressed on the T cells.

[0079] A particularly difficult scenario is presented in the case of brain tumors, such as glioblastoma, glioma and medulloblastoma. Among other things, the blood-brain barrier tends to limit access of systemically administered agents to the brain tissue and to tumors therein. Not only are glioblastomas difficult to reach with systemically administered agents, the form in which they grow and encroach into normal brain tissues renders them difficult to remove surgicallyglioblastomas, in particular, tend to extend tendrils out from the tumor mass that essentially ensure that surgery cannot capture all tumor cells.

[0080] One approach for overcoming the immunosuppressive effects of tumor-expressed immune checkpoint molecules in solid tumors is to use inhibitors of the immune checkpoint molecules, referred to as checkpoint inhibitors. Delivery of checkpoint inhibitors such as antibodies or constructs including antigen-binding domains thereof to the tumor microenvironment would be expected to counter the checkpoint molecule's suppressive signal and permit CAR Ts to effectively target the tumor's cells.

[0081] Systemic delivery of checkpoint inhibitors is effective in some instances, but comes with the likelihood of unwanted side effects, and limitations due to circulating half-life. One approach to addressing this is to administer a cell expressing the checkpoint inhibitor polypeptide, thereby providing a continuous supply of the inhibitor.

[0082] Methods of increasing T cell recruitment to tumors can improve the anti-tumor effects of CAR Ts. Mesenchymal stem cells are known to both home to sites of solid tumors, and to promote T cell recruitment. As such, MSCs would tend to be attractive candidates for the delivery of therapeutic molecules to the site of a tumor. However, MSCs are also well known for their immunosuppressive effectsthat is, MSCs suppress T cell proliferation and cytokine production, inhibit dendritic cell expansion and function, reduce natural killer (NK) cell activity, and enhance immunosuppressive Treg cell activities. See, e.g., Lee et al. Scientific Reports (2017). MSCs are known to recruit T cells to the site of a tumor, but their overall effect in the tumor microenvironment may hinder the effects of such recruited cells. Therefore, while MSCs have desirable characteristics for a cell to deliver an anti-tumor therapy, given their well-known immunosuppressive activities, one would not necessarily expect delivery of an anti-tumor agent, or even a checkpoint inhibitor to the site of a tumor by an MSC to assist with CAR T-mediated cancer cell killing. To the contrary, one would expect the immunosuppressive activities of MSCs to limit or impede the efficacy of CAR Ts. However, as described herein, the use of MSCs to deliver immunomodulatory agents can potentiate CAR-T cell-mediated cancer cell killing.

[0083] Further, the resection of a tumor promotes a reduction of myeloid-derived suppressor cells and a simultaneous recruitment of CD4/CD8 T cells. As such, apart from simply removing the cancerous tissue, resection can assist in countering the immunosuppressive tumor microenvironment, and can be combined with the approach of administering modified MSCs and CAR T cells as described herein, to beneficial effect.

[0084] Engineered stem cells and CAR T based therapies are used in cancer research. However, the art fails to teach the efficacy of creating and using bimodal MSC expressing immunomodulatory agents and immune checkpoint inhibitors and CART cells. Described herein is: (1) the local delivery of engineered stem cells and systemic delivery of tumor cell surface directed CAR T for efficient recruitment and functionality of CAR T; and (2) a bi-modal immunomodulatory stem cell that releases immune modulatory agents and immune check point inhibitors locally within the resected tumor microenvironment and influences tumor progression.

[0085] The MSCs described herein are engineered to deliver, for example, cytokines, immunomodulators, viruses, or other agents that complement the activity of co-administered CAR T cells targeting a solid tumor. The CAR T cells are engineered to be directed, for example, to tumors expressing EGFRvIII and IL13Ra2, cell surface receptors specifically expressed in tumor cells. The ability of engineered stem cells to target cell surface receptors on tumor cells to enhance the immune function and simultaneously recruit systemically injected CAR T cells under diverse conditions and with diverse delivery modalities can permit this approach to become a widely used tool in cancer therapeutics. The technology described herein is therefore a new class of therapeutics, ESC-CAR T (engineered stem cells and CAR T) and methods of using them in cancer therapy are taught herein.

[0086] Accordingly, one aspect of the technology described herein provides a method for treating a solid tumor comprising administering a genetically modified T cell expressing on its cell surface a chimeric T cell antigen receptor comprising a heterologous binding domain that specifically binds a tumor antigen expressed on the surface of cells of the cancer, and an intracellular signaling domain, wherein binding of the heterologous binding domain to the tumor antigen on the surface of a cancer cell activates the intracellular signaling domain and the T cell; and administering a first genetically modified mesenchymal stem cell (MSC), that expresses a heterologous immunomodulatory polypeptide, wherein the heterologous immunomodulatory polypeptide potentiates cancer cell killing by the genetically modified T cell.

[0087] Cancer as used herein can refer to a hyperproliferation of cells that exhibit a loss of normal cellular control that results in unregulated growth, lack of differentiation, local tissue invasion, and metastasis. Cancer can be a solid tumor, leukemia, lymphoma, or multiple myeloma. Methods and compositions described herein are mainly directed at the treatment of solid tumors. As used herein, the term tumor refers to an abnormal growth of cells or tissues, e.g., of malignant type or benign type. Non-limiting examples of solid tumors include Adrenocortical Tumor, Alveolar Soft Part Sarcoma, Carcinoma, Chondrosarcoma, Colorectal Carcinoma, Desmoid Tumors, Desmoplastic Small Round Cell Tumor, Endocrine Tumors, Endodermal Sinus Tumor, Epithelioid Hemangioendothelioma, Ewing Sarcoma, Germ Cell Tumors (Solid Tumor), Giant Cell Tumor of Bone and Soft Tissue, Glioblastoma, Hepatoblastoma, Hepatocellular Carcinoma, Melanoma, Nephroma, Neuroblastoma, Non-Rhabdomyosarcoma Soft Tissue Sarcoma (NRSTS), Osteosarcoma, Paraspinal Sarcoma, Renal Cell Carcinoma, Retinoblastoma, Rhabdomyosarcoma, Synovial Sarcoma, and Wilms Tumor. Solid tumors can be found in bones, muscles, the brain, or organs, and can be sarcomas or carcinomas, where the technology described herein can overcome barriers to solid tumor treatment with CAR T cells. It is contemplated that aspects of the technology described herein can be used to treat all types of solid tumor cancers, including cancers not listed in the instant specification.

CAR T Cells

[0088] As used herein, chimeric antigen receptor or CAR refers to an artificially constructed hybrid polypeptide comprising an antigen-binding domain (e.g., an antigen-binding portion of an antibody (e.g., a scFV)), a transmembrane domain, and a T-cell signaling and/or T-cell activation domain (e.g., intracellular signaling domain). CARs have the ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives T-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape. Moreover, when expressed in T-cells, CARs advantageously do not dimerize with endogenous T-cell receptor (TCR) alpha and beta chains. Most commonly, the CAR's extracellular binding domain is composed of a single chain variable fragment (scFv) derived from fusing the variable heavy and light regions of a murine or humanized monoclonal antibody. Alternatively, scFvs may be used that are derived from Fab's (instead of from an antibody, e.g., obtained from Fab libraries), in various embodiments, this scFv is fused to a transmembrane domain and then to an intracellular signaling domain. First-generation CARs include those that provide CD3zeta (CD3) signals upon antigen binding, Second-generation CARs provide both costimulation (e.g., CD28 or CD 137) and activation (CD3). Third-generation CARs provide multiple costimulatory (e.g., CD28 and CD 137) domains and activation domains (e.g., CD3). In one embodiment, the CAR polypeptide of the technology is selected to have high affinity or avidity for the antigen. Further discussion of CARs can be found, e.g., in Maus et al. Blood 2014 123:2624-35; Reardon et al. Neuro-Oncology 2014 16:1441-1458; Hoyos et al. Haematologica 2012 97:1622; Byrd et al. J Clin Oncol 2014 32:3039-47; Maher et al. Cancer Res 2009 69:4559-4562; and Tamada et al. Clin Cancer Res 2012 18:6436-6445; each of which is incorporated by reference herein in its entirety.

[0089] In some embodiments, a chimeric T cell antigen receptor comprises an extracellular binding domain that comprises a heterologous binding domain that specifically binds EGFRvIII; a transmembrane domain; one or more intracellular co-stimulatory signaling domains; and a primary signaling domain. As used herein, the terms, binding domain, extracellular domain, extracellular binding domain, antigen-specific binding domain, and extracellular antigen specific binding domain, are used interchangeably and provide a chimeric T cell antigen receptor with the ability to specifically bind to the target antigen of interest, e.g., EFGRvIII. The binding domain can be derived either from a natural, synthetic, semi-synthetic, or recombinant source.

[0090] In some embodiments, the binding domain of the chimeric T cell antigen receptor can be followed by one or more spacer domains, which refers to a region that moves the antigen binding domain away from the effector cell surface to enable proper cell/cell contact, antigen binding and activation. The spacer domain can be derived either from a natural, synthetic, semi-synthetic, or recombinant source.

[0091] The binding domain of the chimeric T cell antigen receptor is generally followed by one or more hinge domains, which plays a role in positioning the antigen binding domain away from the effector cell surface to permit proper cell/cell contact, antigen binding and activation. A chimeric T cell antigen receptor generally comprises one or more hinge domains between the binding domain and the transmembrane domain (TM). The hinge domain may be derived either from a natural, synthetic, semi-synthetic, or recombinant source. The hinge domain can include the amino acid sequence of a naturally occurring immunoglobulin hinge region or an altered immunoglobulin hinge region. Illustrative hinge domains suitable for use in the chimeric T cell antigen receptor described herein include the hinge region derived from the extracellular regions of type 1 membrane proteins such as CD8, CD4, CD28 and CD7, which may be wild-type hinge regions from these molecules or may be altered. In one embodiment, the hinge domain comprises a human CD8 hinge region. In another embodiment, the hinge region comprises a mouse CD28 hinge region.

[0092] The transmembrane domain is the portion of the chimeric T cell antigen receptor that fuses the extracellular binding portion and intracellular signaling domain and anchors the chimeric T cell antigen receptor to the plasma membrane of the immune effector cell. The TM domain may be derived either from a natural, synthetic, semi-synthetic, or recombinant source. The TM domain may be derived from (i.e., comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD3, CD3, CD4, CD5, CD8, CD9, CD 16, CD22, CD27, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD 134, CD137, CD152, CD 154, and PD1. In one embodiment, the transmembrane domain comprises a human CD8a transmembrane domain. In another embodiment, the transmembrane domain comprises a mouse CD28 transmembrane domain.

[0093] In some embodiments, chimeric T cell antigen receptors contemplated herein comprise an intracellular signaling domain. An intracellular signaling domain, refers to the part of a chimeric T cell antigen receptor that participates in transducing the message of effective chimeric T cell antigen receptor binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the chimeric T cell antigen receptor-bound target cell, or other cellular responses elicited with antigen binding to the extracellular domain of the chimeric T cell antigen receptor. In some embodiments, a chimeric T cell antigen receptor contemplated herein comprises an intracellular signaling domain that comprises one or more co-stimulatory signaling domain and a primary signaling domain.

[0094] As used herein, the term, co-stimulatory signaling domain, or co-stimulatory domain, refers to an intracellular signaling domain of a co-stimulatory molecule. Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen. Illustrative examples of such co-stimulatory molecules include CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (OX40), CD137 (4-1BB), CD150 (SLAMF1), CD152 (CTLA4), CD223 (LAGS), CD270 (HVEM), CD273 (PD-L2), CD274 (PD-L1), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70. In one embodiment, the intracellular domain is the intracellular domain of human 4-1BB. In another embodiment, the intracellular domain is the intracellular domain of mouse CD28.

[0095] Primary signaling domains regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Illustrative examples of ITAM containing primary signaling domains that are of particular use in the invention include those derived from TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, and CD66d. In one embodiment, the primary signaling domain is mouse CD3. In another embodiment, the primary signaling domain is human CD3.

[0096] In one embodiment, the chimeric T cell antigen receptor comprises a mouse CD8 leader sequence, a 3C10 scFv, a mouse CD28 hinge region, a mouse CD28 transmembrane domain, a mouse CD28 intracellular signaling domain, and a mouse CD3z primary signaling domain.

[0097] In another embodiment, the chimeric T cell antigen receptor comprises a human CD8 leader sequence, a 139 scFv, a human CD8 hinge region, a human CD8 transmembrane domain, a human 4-1BB intracellular signaling domain, and a human CD3 primary signaling domain.

[0098] In one embodiment, the chimeric T cell antigen receptor comprises a heterologous binding domain that binds a tumor antigen. As used herein, the term tumor antigen refers to antigens which are differentially expressed by cancer cells and can thereby be exploited in order to target cancer cells. Tumor antigens are antigens which can potentially stimulate tumor-specific immune responses. Some of these antigens are encoded, although not necessarily expressed, by normal cells. These antigens can be characterized as those which are normally silent (i.e., not expressed) in normal cells, those that are expressed only at certain stages of differentiation and those that are temporally expressed such as embryonic and fetal antigens. Other tumor antigens are encoded by mutant cellular genes, such as oncogenes (e.g., activated ras oncogene), suppressor genes (e.g., mutant p53), and fusion proteins resulting from internal deletions or chromosomal translocations. Still other tumor antigens can be encoded by viral genes such as those carried on RNA and DNA tumor viruses. Many tumor antigens have been defined in terms of multiple solid tumors: MAGE 1, 2, & 3, defined by immunity; MART-1/Melan-A, gp100, carcinoembryonic antigen (CEA), HER2, mucins (i.e., MUC-1), prostate-specific antigen (PSA), and prostatic acid phosphatase (PAP). In addition, viral proteins such as some encoded by hepatitis B (HBV), Epstein-Barr (EBV), and human papilloma (HPV) have been shown to be important in the development of hepatocellular carcinoma, lymphoma, and cervical cancer, respectively.

[0099] In one embodiment, the tumor antigen is EGFRvIII. As used herein, the term EGFRvII or Epidermal growth factor receptor or EGFR refers to a transmembrane protein that is a receptor for members of the epidermal growth factor family of extracellular protein ligands. EGFR is a member of the ErbB family of receptors. EGFR sequences are known for a number of species, e.g., human CD28 (NCBI Gene ID: 1956), mRNA (NCBI Ref Seq NM_001346897.1), and polypeptide sequences (NP_001333826.1, SEQ ID NO: 26), and mouse polypeptide sequences (NP_997538.1, SEQ ID NO: 27). EGFR can refer to human EGFR, including naturally occurring variants and alleles thereof. In some embodiments of, e.g., in veterinary applications, EGFR can refer to the CD28 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologues of human EGFR are readily identified for such species by one of skill in the art, e.g., using the NCBI orthologues search function or searching available sequence data for a given species for sequence similar to a reference EGFR sequence. Examples of antibodies that bind to EGFRvIII can be found in US20140322275A1 summarized in Table 1.

[0100] Over expression of EGFR signaling and mutations resulting in EGFR variants have been linked to disease states, such as cancer. Specifically, aberrant signaling of EGFR variant III (EGFRvIII) has been shown to be important in driving tumor progression and often correlates with poor prognosis; EGFRvIII is associated with increase proliferation of glioma cells in subjects diagnosed with glioblastoma.

[0101] EGFRvIII is the most common extracellular mutation of EGFR, and is also known as de2-7EGFR and EGFR. EGFRvIII results from in-frame deletion of 801 base pairs spanning exons 2-7 of the EGFR coding sequence, resulting in the deletion of 267 amino acids from the extracellular domain.

Antibody Reagents

[0102] As used herein, the term antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen. The term also refers to antibodies comprised of two immunoglobulin heavy chains and two immunoglobulin light chains as well as a variety of forms including full length antibodies and antigen-binding portions thereof; including, for example, an immunoglobulin molecule, a monoclonal antibody, a chimeric antibody, a CDR-grafted antibody, a humanized antibody, a Fab, a Fab, a F(ab)2, a Fv, a disulfide linked Fv, a scFv, a single domain antibody (dAb), a diabody, a multispecific antibody, a dual specific antibody, an anti-idiotypic antibody, a bispecific antibody, a functionally active epitope-binding portion thereof, and/or bifunctional hybrid antibodies.

[0103] In some embodiments, the antibody or antigen-binding portion thereof is a fully human antibody. In some embodiments, the antibody, antigen-binding portion thereof, is a humanized antibody or antibody reagent. In some embodiments, the antibody, antigen-binding portion thereof, is a fully humanized antibody or antibody reagent. In some embodiments, the antibody or antigen-binding portion thereof, is a chimeric antibody or antibody reagent. In some embodiments, the antibody, antigen-binding portion thereof, is a recombinant polypeptide. In some embodiments, the chimeric T cell antigen receptor comprises an extracellular domain that binds EGFRvIII, wherein the extracellular domain comprises a humanized or chimeric antibody or antigen-binding portion thereof.

[0104] The term human antibody refers to antibodies whose variable and constant regions correspond to or are derived from immunoglobulin sequences of the human germ line, as described, for example, by Kabat et al. (see Kabat, et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). However, the human antibodies can contain amino acid residues not encoded by human germ line immunoglobulin sequences (for example mutations which have been introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs, and in particular in CDR3. Recombinant human antibodies as described herein have variable regions and may also contain constant regions derived from immunoglobulin sequences of the human germ line (see Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). According to particular embodiments, however, such recombinant human antibodies are subjected to in-vitro mutagenesis (or to a somatic in-vivo mutagenesis, if an animal is used which is transgenic due to human Ig sequences) so that the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences which although related to or derived from VH and VL sequences of the human germ line, do not naturally exist in vivo within the human antibody germ line repertoire. According to particular embodiments, recombinant antibodies of this kind are the result of selective mutagenesis or back mutation or of both. Preferably, mutagenesis leads to an affinity to the target which is greater, and/or an affinity to non-target structures which is smaller than that of the parent antibody. Generating a humanized antibody from the sequences and information provided herein can be practiced by those of ordinary skill in the art without undue experimentation. In one approach, there are four general steps employed to humanize a monoclonal antibody, see, e.g., U.S. Pat. Nos. 5,585,089; 6,835,823; 6,824,989. These are: (1) determining the nucleotide and predicted amino acid sequence of the starting antibody light and heavy variable domains; (2) designing the humanized antibody, i.e., deciding which antibody framework region to use during the humanizing process; (3) the actual humanizing methodologies/techniques; and (4) the transfection and expression of the humanized antibody.

[0105] Usually the CDR regions in humanized antibodies and human antibody variants are substantially identical, and more usually, identical to the corresponding CDR regions in the mouse or human antibody from which they were derived. In some embodiments, it is possible to make one or more conservative amino acid substitutions of CDR residues without appreciably affecting the binding affinity of the resulting humanized immunoglobulin or human antibody variant. In some embodiments, substitutions of CDR regions can enhance binding affinity.

[0106] In some embodiments, the antibody is a nanobody. As used herein, a nanobody refers to a single-domain antibody comprising a single monomeric variable antibody domain. A nanobody selectively binds to a specific antigen, similar to an antibody. A nanobody is typically small in size, ranging from 12-15 kDa. Methods for designing and producing nanobodies are known in the art and are further described in Ghahroudi, FEBS Letters. September 1997, 414:3 (521-526), which is incorporated herein in its entirety by reference.

[0107] In some embodiments, the checkpoint inhibitor polypeptide as described herein comprises an antibody or antigen-binding domain thereof that binds a checkpoint polypeptide selected from the group consisting of PD-L1, PD-1, CTLA-4, TIM-3, LAG-3, or TIGIT. In some embodiments, the antibody binds to an amino acid sequence complimentary to any one of the sequences described herein SEQ ID NO: 1-27. Table 1 summarizes examples of antibodies that can be used in the compositions and methods described herein.

TABLE-US-00001 TABLE 1 SUMMARY OF ANTIBODY TARGETS AND ANTIBODIES Polypeptide Protein SEQ ID NOs: Antibodies Antibody SEQ ID NOs: References CTLA-4 SEQ ID NO: 3, ipilimumab SEQ ID NO: 16, Metzler et al. Nat SEQ ID NO: 8 (CTLA-4; Bristol Meyers SEQ ID NO: 17 Struct Biol. 1997; Squibb); US20150283234 tremelimumab (CTLA-4; Medimmune); PD-1 SEQ ID NO: 2, pembrolizumab (PD- SEQ ID NO: 18, US2012135408; SEQ ID NO: 15 1; Merck); nivolumab SEQ ID NO: 19, US2013173223 (PD-1; Bristol Meyers SEQ ID NO: 20, Squibb); AUNP12 SEQ ID NO: 21 (PD-1; Aurigene); PD-L1 SEQ ID NO: 1, atezolizumab (PD-L1; SEQ ID NO: 22 US8217149B2 SEQ ID NOs: 12-14 Genentech); SEQ ID NO: 23 MPDL3280A (PD-L1; Roche); MEDI4736 (PD-L1; AstraZeneca); MSB0010718C (PD- L1; EMD Serono); avelumab (PD-L1; Merck); MSB0010718C (PD- L1; EMD Serono); durvalumab (PD-L1; Medimmune); TIM-3 SEQ ID NO: 4, TSR-022 (TIM3; SEQ ID NO: 24; WO2018129553A1 SEQ ID NO: 10 Tesaro) SEQ ID NO: 25 LAG-3 SEQ ID NO: 5, IMP321 (LAG3: See Sequences in US9579382B2; SEQ ID NO: 11 Immuntep); BMS- US20110150892A1 US20110150892A1 986016 (LAG3; Bristol Meyers Squibb); TIGIT SEQ ID NOs: 6-7 Anti-Tigit (Compugen See Sequences (e.g. US20180280506A1 Ltd) SEQ ID NOs: 160 and 165) in US20180280506A1 EGFRvIII SEQ ID NOs: 26-27 Anti-EGFRvIII See Sequences (e.g. US20140322275A1 (University of SEQ ID NO: 11) in Pennsylvania, US20140322275A1 Novartis Inst for BioMedical Res Inc.)

Genetically Modified Mesenchymal Stem Cells

[0108] A mesenchymal stem cell (MSC) is a self-renewing, multipotent stem cell that comprises the capacity to differentiate into various cell types including, but not limited to, white adipocytes, brown adipocytes, myoblast, skeletal muscle, cardiac muscle, smooth muscle, chondrocytes, and a mature osteoblast upon introduction of proper differentiation cues. An MSC can be produced using techniques known in the art, for example, by a process comprising obtaining a cell by dispersing an embryonic stem (ES) cell colony and culturing the cell with MSC conditioned media. A population of MSCs can be confirmed by assessing the surface markers of the MSC population. For example, at a minimum, 95% or more of an MSC cell population expresses CD73/5-Nucleotidase, CD90/Thy1, and CD105/Endoglin, and 2% or less of an MSC cell population expresses CD34, CD45, CD11b/Integrin alpha M or CD14, CD79 alpha or CD19, and HLA Class II. The expression of these surface markers can be assessed using techniques known in the art, e.g., FACS analysis.

[0109] MSCs can be easily extracted and, given their propensity to move to the site of tumors, are useful for the delivery of therapeutics to said tumors and tumor microenviroments. MSCs tumor tropism (movement to the site of a tumor) is thought to be driven by paracrine signaling between the tumor microenvironment and the corresponding receptors on the cell surface of the MSC. Further discussion of MSCs therapeutic uses is found, for example, in Sage et al., Cytotherapy 18: 1435-1445 (2016).

[0110] MSCs recruit monocytes, T cells and dendritic cells to sites of inflammation following an infection or injury (e.g., tumor resection) via expression of chemokine (CC motif) ligand 2 (CCL2, as known as MCP-1 and small inducible cytokine A2). CCL2 sequences are known for a number of species, e.g., human CD28 (NCBI Gene ID: 6347). CCL2 can refer to human CCL2, including naturally occurring variants and alleles thereof. In some embodiments of, e.g., in veterinary applications, CCL2 can refer to the CCL2 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CCL2 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CCL2 sequence. It is contemplated that an MSC genetically modified to express increased levels of CCL2 (compared to wild-type CCL2 levels) will have a greater capacity to recruit T cells to the site of injury (e.g., tumor resection) compared to a wild-type MSC.

[0111] In one embodiment, a cell (e.g., a T cell, or MSC) is genetically modified to express a polypeptide comprising an immunomodulator. An immunomodulator refers to an agent with the capacity to modify the immune system of a subject, for example, the polypeptide can induce, amplify, attenuate, or prevent an immune response. It should be understood that while any antigen can be an immunomodulator in the sense that it induces an immune response, an immunomodulator as the term is used herein modifies the immune microenvironment of a tumor, e.g., in terms of recruitment of immune effectors, activity of immune effectors, or suppression of immunosuppressive factors, their expression, or their activity. Immunomodulators can be naturally occurring (for example a regulatory T cell, or cell signaling molecules), or engineered (e.g., immunotherapies). Exemplary immunomodulators include, e.g., check point inhibitors, afutuzumab (available from Roche), pegfilgrastim (Neulasta), IL-12, IL-2, IL-5, IL-15, TRAIL, EGFR nanobody-TRAIL fusion, Thrombospondin (TSP)-1, interferon , interferon , interferon , HSV-TK, cytosine deaminase (CD), oncolytic viruses such as oHSV, oHSV-TRAIL, oHSV-GMCSF, or adenovirus.

[0112] In one embodiment, the immunomodulatory peptide potentiates cancer cell killing. As used herein, potentiates cancer cell killing refers to the increased capacity for a cancer cell to be killed by a genetically modified T cell in the presence of a genetically modified MSC comprising an immunodulatory polypeptide compared to the capacity for a cancer cell to be killed by a genetically modified T cell either alone, or alternatively, in the presence of an MSC that does not comprise an immunodulatory polypeptide.

[0113] The presence of an immunomodulatory peptide as described herein increases the efficacy of a genetically modified T cell to kill a cancer cell.

[0114] In one embodiment, the immunomodulatory polypeptide is a checkpoint inhibitor polypeptide. In one embodiment, the checkpoint inhibitor polypeptide is an antibody, antibody reagent, or an antigen-binding fragment thereof that specifically binds to at least one immune checkpoint polypeptide. Common checkpoints that are targeted for therapeutics include, but are not limited to PD-1, TIGIT, CTLA4, TIM3, LAG3 and PD-L1. Inhibitors of their checkpoint activities are known in the art. Non-limiting examples of checkpoint inhibitors (with checkpoint targets and manufacturers noted in parentheses) can include: MGA271 (B7-H3: MacroGenics); ipilimumab (CTLA-4; Bristol Meyers Squibb); pembrolizumab (PD-1; Merck); nivolumab (PD-1; Bristol Meyers Squibb); atezolizumab (PD-L1; Genentech); galiximab (B7.1; Biogen); IMP321 (LAG3: Immuntep); BMS-986016 (LAG3; Bristol Meyers Squibb); SMB-663513 (CD137; Bristol-Meyers Squibb); PF-05082566 (CD137; Pfizer); IPH2101 (KIR; Innate Pharma); KW-0761 (CCR4; Kyowa Kirin); CDX-1127 (CD27; CellDex); MEDI-6769 (Ox40; MedImmune); CP-870,893 (CD40; Genentech); tremelimumab (CTLA-4; Medimmune); pidilizumab (PD-1; Medivation); MPDL3280A (PD-L1; Roche); MEDI4736 (PD-L1; AstraZeneca); MSB0010718C (PD-L1; EMD Serono); AUNP12 (PD-1; Aurigene); avelumab (PD-L1; Merck); durvalumab (PD-L1; Medimmune); TSR-022 (TIM3; Tesaro). In one embodiment, a checkpoint inhibitor polypeptide comprises an antibody or antigen-binding reagent thereof that binds PD-L1.

[0115] As used herein, PD-1 or programmed cell death 1 or cluster of differentiation 279 or CD279 is a surface receptor protein that suppresses the immune system expressed by T cells and pro-B cells. PD-1 is encoded by the PDCD-1 gene (Gene ID: 5133). Sequences for PD-1 are known for a number of species, e.g., human PD-L1 mRNA sequences (e.g., NM_005018.2) and polypeptide sequences (e.g., NP_005009.2, SEQ ID NO: 2), as well as murine PD-1 polypeptide sequences (e.g., NP_032824.1, SEQ ID NO: 15), together with any naturally occurring allelic, splice variants, and processed forms thereof.

[0116] As used herein, PD-L1 or programmed cell death 1 ligand 1 or cluster of differentiation 274 or CD274 or B7 homolog 1 or B7-H1 is a protein that suppresses the immune system expressed by T cells, natural killer cells, macrophages, myeloid dendritic cells, epithelial cells, B-cells, and vascular endothelial cells. PD-L1 is encoded by the PD-L1 gene (Gene ID: 29126). Sequences for PD-L1 are known for a number of species, e.g., human PD-L1 isoforms a, b, and c mRNA sequences (e.g., the PD-L1 NCBI Reference Sequences are NM_014143.3, NM_001267706.1, NR 052005.1) and polypeptide sequences (e.g., NP_054862.1, SEQ ID NO: 1, 001254635.1, SEQ ID NO: 12, and NP_001300958.1, SEQ ID NO: 13), as well as murine PD-L1 polypeptide sequences (e.g., NP_068693.1, SEQ ID NO: 14), together with any naturally occurring allelic, splice variants, and processed forms thereof.

[0117] Binding of PD-L1 to its receptor, PD-1, transmits an inhibitory signal that reduces the proliferation of T cells and can induce apoptosis. Aberrant PD-L1 and/or PD-1 signalling has been shown to promote cancer cell evasion in various tumors. PD-L1/PD-1 blockade can be accomplished by a variety of mechanisms including antibodies that bind PD-1 or its ligand, PD-L1. Examples of PD-1 and PD-L1 blockers are described in U.S. Pat. Nos. 7,488,802; 7,943,743; 8,008,449; 8,168,757; 8,217,149, and PCT Published Patent Application Nos: WO03042402, WO2008156712, WO2010089411, WO2010036959, WO2011066342, WO2011159877, WO2011082400, and WO2011161699; which are incorporated by reference herein in their entireties. In certain embodiments, the PD-1 inhibitors include anti-PD-L1 antibodies. PD-1 inhibitors include anti-PD-1 antibodies and similar binding proteins such as anti-PD-1 antibody clone RMP1-14, nivolumab (MDX 1106, BMS 936558, ONO 4538), a fully human IgG4 antibody that binds to and blocks the activation of PD-1 by its ligands PD-L1 and PD-L2; lambrolizumab (MK-3475 or SCH 900475), a humanized monoclonal IgG4 antibody against PD-1; CT-011 a humanized antibody that binds PD-1; AMP-224, a fusion protein of B7-DC; an antibody Fc portion; BMS-936559 (MDX-1105-01) for PD-L1 (B7-H1) blockade.

[0118] As used herein, TIGIT or T-Cell Immunoreceptor With Ig And ITIM Domains refers to an immunoglobin protein of the PVR (poliovirus receptor) family encoded by the TIGIT gene. Sequences for TIGIT are known for a number of species, e.g., human TIGIT (the TIGIT NCBI Gene ID is 201633) mRNA sequences (e.g., NM_173799.3), and polypeptide sequences (e.g., NP_776160.2, SEQ ID NO: 6), as well as murine TIGIT polypeptide sequences (e.g., NP_001139797.1, SEQ ID NO: 7), together with any naturally occurring allelic, splice variants, and processed forms thereof. Anti-TIGIT antibodies are known in the art and described herein, for example, in Table 1 and references therein.

[0119] Nucleic acids encoding the binding domains of any of the checkpoint inhibitor antibodies described herein or known in the art can be used to engineer the expression of a checkpoint inhibitor by an MSC as described herein. Similarly, nucleic acids encoding the binding domains of a tumor antigen-binding antibody as described herein or as known in the art can be used to engineer the expression of a chimeric T cell antigen receptor as described herein.

[0120] As used herein, CTLA-4 or cytotoxic T-lymphocyte-associated protein 4 or CD152 refers to a protein receptor that down regulates immune responses and is constitutively expressed by regulatory T cells. CTLA-4 is encoded by the CTLA-4 gene (Gene ID: 1493). Sequences for CTLA-4 are known for a number of species, e.g., human CTLA-4 mRNA sequences (e.g., NM_005214.5), and polypeptide sequences (e.g., NP_005205.2, SEQ ID NO: 3) as well as murine CTLA-4 polypeptide sequences (e.g., NP_033973.2, SEQ ID NO: 8), together with any naturally occurring allelic, splice variants, and processed forms thereof. Anti-CTLA-4 antibodies are known in the art and described herein, for example, in Table 1 and references therein.

[0121] As used herein, TIM-3 or T-cell immunoglobulin and mucin-domain containing-3 or Hepatitis A virus cellular receptor or HAVCR2 refers to a cell surface protein expressed by CD4+ Th1 and CD8+ Tc1 cells that mediates T cell exhaustion and loss of function. TIM-3 is encoded by the HAVCR2 gene (Gene ID: 84868). Sequences for TIM-3 are known for a number of species, e.g., human TIM-3 mRNA sequences (e.g., NM_032782.4), and polypeptide sequences (e.g., NP_116171.3, SEQ ID NO: 4 and SEQ ID NO: 9) as well as murine TIM-3 polypeptide sequences (e.g., NP_599011.2, SEQ ID NO: 10), together with any naturally occurring allelic, splice variants, and processed forms thereof. Anti-TIM-3 antibodies are known in the art and described herein, for example, in Table 1 and references therein.

[0122] As used herein, LAG-3 or lymphocyte-activation gene 3 or cluster of differentiation 223 or CD223 refers to a cell surface molecule that negatively regulates cell proliferation, activation, and homeostasis of T cells in a similar mechanism to PD-1 and CTLA-4. LAG-3 is expressed by activated T cells, natural killer cells, B cells, and plasmacytoid dendritic cells. LAG-3 is encoded by the LAG3 gene (Gene ID: 3902). Sequences for LAG-3 are known for a number of species, e.g., human LAG-3 mRNA sequences (e.g., NM_002286.5), and polypeptide sequences (e.g., NP_002277.4, SEQ ID NO: 5) as well as murine LAG-3 polypeptide sequences (e.g., NP_002277.4, SEQ ID NO: 11), together with any naturally occurring allelic, splice variants, and processed forms thereof. Anti-LAG-3 antibodies are known in the art and described herein, for example, in Table 1 and references therein.

[0123] In one embodiment, a second genetically modified MSC is engineered to deliver a heterologous polypeptide comprising a cytokine, (e.g., Interleukin (IL)-12B (NCBI Gene ID: 3593), IL-2 (NCBI Gene ID: 3558), IL-5 (NCBI Gene ID: 3567), IL-15 (NCBI Gene ID: 3600), TNF-related apoptosis-inducing ligand (TRAIL; also known as TNF superfamily member 10, TL2, CD253, or TNLG6A; NCBI Gene ID: 8743), an EGFR nanobody-TRAIL fusion, Thrombospondin (THBS)-1 (NCBI Gene ID: 7057), an interferon (e.g., interferon -1 (NCBI Gene ID: 3439), interferon -1 (NCBI Gene ID: 3456), or interferon (NCBI Gene ID: 3458)), Herpes simplex virus-1 Thymidine kinase (HSV-TK; NCBI Gene ID: 7083), or cytosine deaminase (e.g., E. coli (CD; NCBI Gene ID: 944996). Unless otherwise noted, these polypeptides can refer to human polypeptides, including naturally occurring variants and alleles thereof. In some embodiments of, e.g., in veterinary applications, the polypeptides can refer to the polypeptides of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of these polypeptides are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a given reference sequence.

[0124] It is also contemplated that an MSC can be used to deliver an oncolytic virus, e.g., an oncolytic HSV, adenovirus, or other oncolytic construct. Delivery of oncolytic viruses is further described in Application Nos. PCT/US2013/031,949 and PCT/2014/069,734, which are incorporated herein by reference in their entireties. Non-limiting examples of oncolytic viruses include oncolytic Herpes Simplex Viruses (oHSV), HSV-TRAIL, and oHSV-granulocyte-macrophage colony-stimulating factor (GMC SF).

Local Cell Delivery and Matrix Encapsulation

[0125] Local delivery of cells, whether genetically modified MSCs as described herein or CAR-T's as described herein, can provide benefits for cancer therapy. In one aspect, local delivery can provide a high local concentration of the therapeutic polypeptide(s) or effector cells. However, one of the benefits of CAR-T therapy is that the targeting moiety on the chimeric receptor permits localization to the cancer cells via systemic delivery, and one of the benefits of MSCs to deliver therapeutic polypeptides to the tumor microenvironment is their natural tumor-homing activity. These benefits of systemic administration can be hampered for certain tumor types, notably brain tumors, where the blood-brain barrier can limit access of systemically administered cells to a tumor. For this reason, local delivery to the site of a tumor, and especially considering the immunostimulatory effects of tumor resection demonstrated herein, local delivery of therapeutic cells to the site of tumor resection, can be of particular benefit for the treatment of brain tumors, including but not limited to GBM, which are notoriously difficult to treat.

[0126] In one embodiment, the genetically modified MSCs are encapsulated in a matrix. In another embodiment, the CAR-T cells are encapsulated in a matrix. In another embodiment, both the MSCs and the CAR-T cells are encapsulated in a matrix. This can assist in retaining MSCs in a given location, such as a tumor resection cavity. The matrix can minimize wash out of cells from the resection cavity, e.g., by CSF in the case of brain tumors.

[0127] A matrix useful in the methods and compositions described herein will permit MSCs and/or CAR-T's to migrate away from the matrix, rather than containing the cells within the matrix permanently. As used herein, matrix refers to a biological material that comprises a biocompatible substrate that can be used as a material that is suitable for implantation into a subject or into which a cell population can be deposited. A biocompatible substrate does not cause toxic or injurious effects once implanted in the subject. The biocompatible substrate can but need not necessarily provide the supportive framework that allows cells to attach to it, and grow on it. Cultured populations of cells (e.g., genetically modified MSCs or CAR-Ts) can be prepared with the biocompatible substrate (i.e., the matrix), which provides the appropriate interstitial distances required, e.g., for cell-cell interaction. As used herein, encapsulated refers to a cell that is enclosed within the matrix.

[0128] A matrix can be used to aid in further controlling and directing a cell or population of genetically modified MSCs and CAR T cells as described herein. A matrix can be designed or selected to provide environmental cues to control and direct the migration of cells to a site of injury or disease. A structure can be engineered from a nanometer to micrometer to millimeter to macroscopic length, and can further comprise or be based on factors such as, but not limited to, material mechanical properties, material solubility, spatial patterning of bioactive compounds, spatial patterning of topological features, soluble bioactive compounds, mechanical perturbation (cyclical or static strain, stress, shear, etc.), electrical stimulation, and thermal perturbation.

[0129] In one embodiment, the matrix comprises a synthetic matrix. In one embodiment, the matrix comprises a thiol-modified hyaluronic acid and a thiol-reactive cross-linker molecule. In one embodiment, the thiol-reactive cross-linker molecule is polyethylene glycol diacrylate. Further description of components useful in constructing a matrix, as well as instruction for making a matrix, can be found in U.S. patent application Ser. No. 15/225,202, which is incorporated herein in its entirety by reference.

[0130] Methods of encapsulation of stem cells are known in the art and can be found, for example, in Shah et al. Biomatter. 2013 and Kauer et al. Nature Neuroscience. 2013.

[0131] For example, the synthetic extracellular matrix (ECM) components, such as those from Hystem and Extralink (Glycosan Hystem-C, Biotime Inc.), can be reconstituted according to the manufacturer's protocols. Stem cells (e.g. 110.sup.5, 210.sup.5 or 410.sup.5 cells) can be re-suspended in Hystem (e.g. 14 l) and the matrix is cross-linked by adding Extralink (e.g. 6 l). After about 20 minutes (gelation time) at 25 C., the stein cell and ECM hydrogel can be placed in the center of different sizes (35 or 60 mm) of glass-bottomed dish. Bioluminescence imaging can be used to determine the viability of the MSCs expressing a detectable label. To assess the numbers of cells expressing immunomodulatory polypeptides and the amounts of such polypeptides expressed, methods known in the art can be used such as flow cytometry, Western blotting, immunohistochemistry, or enzyme-linked immunosorbent assay (ELISA).

Detectable Labels

[0132] For tracking purposes, cells can be tagged with a detectable label. As used herein, the term detectable label refers to a composition capable of producing a detectable signal indicative of the presence of a target. Detectable labels include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means. Suitable labels include fluorescent molecules, radioisotopes, nucleotide chromophores, enzymes, substrates, chemiluminescent moieties, bioluminescent moieties, and the like. As such, a label is any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means needed for the methods and devices described herein.

[0133] A wide variety of fluorescent reporter dyes are known in the art. Typically, the fluorophore is an aromatic or heteroaromatic compound and can be a pyrene, anthracene, naphthalene, acridine, stilbene, indole, benzoindole, oxazole, thiazole, benzothiazole, cyanine, carbocyanine, salicylate, anthranilate, coumarin, fluorescein, rhodamine or other like compound.

[0134] Exemplary fluorophores include, but are not limited to, 1,5 IAEDANS; 1,8-ANS; 4-Methylumbelliferone; 5-carboxy-2,7-dichlorofluorescein; 5-Carboxyfluorescein (5-FAM); 5-Carboxynapthofluorescein (pH 10); 5-Carboxytetramethylrhodamine (5-TAMRA); 5-FAM (5-Carboxyfluorescein); 5-Hydroxy Tryptamine (HAT); 5-ROX (carboxy-X-rhodamine); 5-TAMRA (5-Carboxytetramethylrhodamine); 6-Carboxyrhodamine 6G; 6-CR 6G; 6-JOE; 7-Amino-4-methylcoumarin; 7-Aminoactinomycin D (7-AAD); 7-Hydroxy-4-methylcoumarin; 9-Amino-6-chloro-2-methoxyacridine; ABQ; Acid Fuchsin; ACMA (9-Amino-6-chloro-2-methoxyacridine); Acridine Orange; Acridine Red; Acridine Yellow; Acriflavin; Acriflavin Feulgen SITSA; Aequorin (Photoprotein); Alexa Fluor 350; Alexa Fluor 430; Alexa. Fluor 488; Alexa Fluor 532; Alexa Fluor 546; Alexa Fluor 568; Alexa Fluor 594; Alexa Fluor 633; Alexa Fluor 647; Alexa Fluor 660; Alexa Fluor 680; Alizarin Complexon; Alizarin Red; Allophycocyanin (APC); AMC, AMCA-S; AMCA (Aminomethylcoumarin); AMCA-X; Aminoactinomycin D; Aminocoumarin; Anilin Blue; Anthrocyl stearate; APC-Cy7; APTS; Astrazon Brilliant Red 4G; Astrazon Orange R; Astrazon Red 6B; Astrazon Yellow 7 GLL; Atabrine; ATTO-TAGTM CBQCA; ATTO-TAG FQ; Auramine; Aurophosphine G; Aurophosphine; BAO 9 (Bisaminophenyloxadiazole); BCECF (high pH); BCECF (low pH); Berberine Sulphate; Beta Lactamase; BFP blue shifted GFP (Y66H); BG-647; Bimane; Bisbenzamide; Blancophor FFG; Blancophor SV; BOBO-1; BOBO-3; Bodipy 492/515; Bodipy 493/503; Bodipy 500/510; Bodipy 505/515; Bodipy 530/550; Bodipy 542/563; Bodipy 558/568; Bodipy 564/570; Bodipy 576/589; Bodipy 581/591; Bodipy 630/650-X; Bodipy 650/665-X; Bodipy 665/676; Bodipy Fl; Bodipy FL ATP; Bodipy Fl-Ceramide; Bodipy R6G SE; Bodipy TMR; Bodipy TMR-X conjugate; Bodipy TMR-X, SE; Bodipy TR; Bodipy TR ATP; Bodipy TR-X SE; BO-PRO-1; BO-PRO-3; Brilliant Sulphoflavin FF; Calcein; Calcein Blue; Calcium Crimson; Calcium Green; Calcium Green-1 Ca2+ Dye; Calcium Green-2 Ca2+; Calcium Green-5N Ca2+; Calcium Green-C18 Ca2+; Calcium Orange; Calcofluor White; Carboxy-X-rhodamine (5-ROX); Cascade Blue; Cascade Yellow; Catecholamine; CFDA; CFPCyan Fluorescent Protein; Chlorophyll; Chromomycin A; Chromomycin A; CMFDA; Coelenterazine; Coelenterazine cp; Coelenterazine f; Coelenterazine fcp; Coelenterazine h; Coelenterazine hcp; Coelenterazine ip; Coelenterazine O; Coumarin Phalloidin; CPM Methylcoumarin; CTC; Cy2; Cy3.1 8; Cy3.5; Cy3; Cy5.1 8; Cy5.5; Cy5; Cy7; Cyan GFP; cyclic AMP Fluorosensor (FiCRhR); d2; Dabcyl; Dansyl; Dansyl Amine; Dansyl Cadaverine; Dansyl Chloride; Dansyl DHPE; Dansyl fluoride; DAPI; Dapoxyl; Dapoxyl 2; Dapoxyl 3; DCFDA; DCFH (Dichlorodihydrofluorescein Diacetate); DDAO; DHR (Dihydorhodamine 123); Di-4-ANEPPS; Di-8-ANEPPS (non-ratio); DiA (4-Di-16-ASP); DIDS; Dihydorhodamine 123 (DHR); DiO (DiOC18(3)); DiR; DiR (DiIC18(7)); Dopamine; DsRed; DTAF; DY-630-NHS; DY-635-NHS; EBFP; ECFP; EGFP; ELF 97; Eosin; Erythrosin; Erythrosin ITC; Ethidium homodimer-1 (EthD-1); Euchrysin; Europium (III) chloride; Europium; EYFP; Fast Blue; FDA; Feulgen (Pararosaniline); FITC; FL-645; Flazo Orange; Fluo-3; Fluo-4; Fluorescein Diacetate; Fluoro-Emerald; Fluoro-Gold (Hydroxystilbamidine); Fluor-Ruby; FluorX; FM 1-43TM; FM 4-46; Fura Red (high pH); Fura-2, high calcium; Fura-2, low calcium; Genacryl Brilliant Red B; Genacryl Brilliant Yellow 10GF; Genacryl Pink 3G; Genacryl Yellow 5GF; GFP (S65T); GFP red shifted (rsGFP); GFP wild type, non-UV excitation (wtGFP); GFP wild type, UV excitation (wtGFP); GFPuv; Gloxalic Acid; Granular Blue; Haematoporphyrin; Hoechst 33258; Hoechst 33342; Hoechst 34580; HPTS; Hydroxycoumarin; Hydroxystilbamidine (FluoroGold); Hydroxytryptamine; Indodicarbocyanine (DiD); Indotricarbocyanine (DiR); Intrawhite Cf; JC-1; JO-JO-1; JO-PRO-1; LaserPro; Laurodan; LDS 751; Leucophor PAF; Leucophor SF; Leucophor WS; Lissamine Rhodamine; Lissamine Rhodamine B; LOLO-1; LO-PRO-1; Lucifer Yellow; Mag Green; Magdala Red (Phloxin B); Magnesium Green; Magnesium Orange; Malachite Green; Marina Blue; Maxilon Brilliant Flavin 10 GFF; Maxilon Brilliant Flavin 8 GFF; Merocyanin; Methoxycoumarin; Mitotracker Green FM; Mitotracker Orange; Mitotracker Red; Mitramycin; Monobromobimane; Monobromobimane (mBBr-GSH); Monochlorobimane; MPS (Methyl Green Pyronine Stilbene); NBD; NBD Amine; Nile Red; Nitrobenzoxadidole; Noradrenaline; Nuclear Fast Red; Nuclear Yellow; Nylosan Brilliant lavin E8G; Oregon Green; Oregon Green 488-X; Oregon Green 488; Oregon Green 500; Oregon Green 514; Pacific Blue; Pararosaniline (Feulgen); PE-Cy5; PE-Cy7; PerCP; PerCP-Cy5.5; PE-TexasRed (Red 613); Phloxin B (Magdala Red); Phorwite AR; Phorwite BKL; Phorwite Rev; Phorwite RPA; Phosphine 3R; PhotoResist; Phycoerythrin B [PE]; Phycoerythrin R [PE]; PKH26; PKH67; PMIA; Pontochrome Blue Black; POPO-1; POPO-3; PO-PRO-1; PO-PRO-3; Primuline; Procion Yellow; Propidium Iodid (PI); PyMPO; Pyrene; Pyronine; Pyronine B; Pyrozal Brilliant Flavin 7GF; QSY 7; Quinacrine Mustard; Resorufin; RH 414; Rhod-2; Rhodamine; Rhodamine 110; Rhodamine 123; Rhodamine 5 GLD; Rhodamine 6G; Rhodamine B 540; Rhodamine B 200; Rhodamine B extra; Rhodamine BB; Rhodamine BG; Rhodamine Green; Rhodamine Phallicidine; Rhodamine Phalloidine; Rhodamine Red; Rhodamine WT; Rose Bengal; R-phycoerythrin (PE); red shifted GFP (rsGFP, S65T); S65A; S65C; S65L; S65T; Sapphire GFP; Serotonin; Sevron Brilliant Red 2B; Sevron Brilliant Red 4G; Sevron Brilliant Red B; Sevron Orange; Sevron Yellow L; sgBFP; sgBFP (super glow BFP); sgGFP; sgGFP (super glow GFP); SITS; SITS (Primuline); SITS (Stilbene Isothiosulphonic Acid); SPQ (6-methoxy-N-(3-sulfopropyl)-quinolinium); Stilbene; Sulphorhodamine B can C; Sulphorhodamine G Extra; Tetracycline; Tetramethylrhodamine; Texas Red; Texas Red-X conjugate; Thiadicarbocyanine (DiSC3); Thiazine Red R; Thiazole Orange; Thioflavin 5; Thioflavin S; Thioflavin TCN; Thiolyte; Thiozole Orange; Tinopol CBS (Calcofluor White); TMR; TO-PRO-1; TO-PRO-3; TO-PRO-5; TOTO-1; TOTO-3; TriColor (PE-Cy5); TRITC (TetramethylRodamineIsoThioCyanate); True Blue; TruRed; Ultralite; Uranine B; Uvitex SFC; wt GFP; WW 781; XL665; X-Rhodamine; XRITC; Xylene Orange; Y66F; Y66H; Y66W; Yellow GFP; YFP; YO-PRO-1; YO-PRO-3; YOYO-1; and YOYO-3. Many suitable forms of these fluorescent compounds are available and can be used.

[0135] Other exemplary detectable labels include luminescent and bioluminescent markers (e.g., biotin, luciferase (e.g., bacterial, firefly, click beetle and the like), luciferin, and aequorin), radiolabels (e.g., 3H, 1251, 35S, 14C, or 32P), enzymes (e.g., galactosidases, glucorinidases, phosphatases (e.g., alkaline phosphatase), peroxidases (e.g., horseradish peroxidase), and cholinesterases), and calorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, and latex) beads. Patents teaching the use of such labels include U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149, and 4,366,241, each of which is incorporated herein by reference.

[0136] Means of detecting such labels are well known to those of skill in the art. Thus, for example, radiolabels can be detected using photographic film or scintillation counters, fluorescent markers can be detected using a photo-detector to detect emitted light. Enzymatic labels are typically detected by providing the enzyme with an enzyme substrate and detecting the reaction product produced by the action of the enzyme on the enzyme substrate, and calorimetric labels can be detected by visualizing the colored label

Administration

[0137] In some embodiments, the methods described herein relate to treating a subject having or diagnosed a solid tumor cancer by administering a mammalian cell comprising any of the genetically modified T cell described herein, and a modified MSC that expresses an immunomodulatory polypeptide. In one embodiment, the solid tumor has been resected prior to administration. Subjects having a condition (e.g., glioblastoma) can be identified by a physician using current methods of diagnosing the condition. Symptoms and/or complications of the condition, which characterize these conditions and aid in diagnosis are well known in the art and include but are not limited to, fatigue, persistent infections, and persistent bleeding. Tests that may aid in a diagnosis of, e.g. the condition, but are not limited to, blood screening and imaging (e.g., PET scan), and are known in the art for a given condition. A family history for a condition, or exposure to risk factors for a condition can also aid in determining if a subject is likely to have the condition or in making a diagnosis of the condition.

[0138] In one embodiment, the genetically modified MSC described herein are administered directly into the cavity formed by resection of the tumor, and the genetically modified T cells described herein are administered systemically. In another embodiment, the genetically modified MSCs and the genetically modified T cells are administered directly into the cavity formed by resection of the tumor at substantially the same time. In another embodiment, the genetically modified MSCs and the genetically modified T cells are administered systemically at substantially the same time, or at different time points. In yet another embodiment, the genetically modified MSC are administered systemically, and the genetically modified T cells are administered directly into the cavity formed by resection of the tumor. The natural tumor-homing activity of MSCs can assist in the tumor-localization of systemically-administered MSCs.

[0139] The compositions described herein can be administered to a subject having or diagnosed as having a condition. In some embodiments, the methods described herein comprise administering an effective amount of activated genetically modified T cells and genetically modified MSCs as described herein to a subject in order to alleviate a symptom of the condition. As used herein, alleviating a symptom of the condition is ameliorating any condition or symptom associated with the condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. In one embodiment, the compositions described herein are administered systemically or locally. In a preferred embodiment, the compositions described herein are administered intravenously. In another embodiment, the compositions described herein are administered at the site of the tumor or tumor resection.

[0140] The term effective amount as used herein refers to the amount of genetically modified T cells and genetically modified MSCs needed to alleviate at least one or more symptom of the disease (e.g., glioblastoma), and relates to a sufficient amount of the cell preparation or composition to provide the desired effect. The term therapeutically effective amount therefore refers to an amount genetically modified T cells and MSCs that is sufficient to provide a particular anti-condition effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a condition), or reverse a symptom of the condition. Thus, it is not generally practicable to specify an exact effective amount. However, for any given case, an appropriate effective amount can be determined by one of ordinary skill in the art using only routine experimentation.

[0141] Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals. The dosage can vary depending upon the dosage form employed and the route of administration utilized.

[0142] While MSCs will most often be administered locally and CAR T cells systemically, in one aspect, the technology described herein relates to a pharmaceutical composition comprising activated genetically modified T cells and modified MSCs as described herein, and optionally a pharmaceutically acceptable carrier. The active ingredients of the pharmaceutical composition at a minimum comprise genetically modified T cells and genetically modified MSCs as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of genetically modified T cells and genetically modified MSCs as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of genetically modified T cells and genetically modified MSCs as described herein. Pharmaceutically acceptable carriers for cell-based therapeutic formulation include saline and aqueous buffer solutions, Ringer's solution, and serum component, such as serum albumin, HDL and LDL. The terms such as excipient, carrier, pharmaceutically acceptable carrier or the like are used interchangeably herein.

[0143] In some embodiments, the pharmaceutical composition comprising genetically modified T cells and genetically modified MSCs cells as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, the components apart from the genetically modified T cells and genetically modified MSCs themselves are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. Any of these can be added to the preparation of genetically modified T cells and MSCs prior to administration.

[0144] Suitable vehicles that can be used to provide parenteral dosage forms of genetically modified T cells and MSCs as disclosed within are well known to those skilled in the art. Examples include, without limitation: saline solution; glucose solution; aqueous vehicles including but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.

Dosage

[0145] Unit dosage form as the term is used herein refers to a dosage suitable for one administration. By way of example a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag. In one embodiment, a unit dosage form is administered in a single administration. In another embodiment, more than one unit dosage form can be administered simultaneously.

[0146] A pharmaceutical composition comprising the genetically modified T cells and genetically modified MSCs described herein can generally be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, in some instances 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. If necessary, genetically modified T cells and/or genetically modified MSCs can also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).

[0147] In certain aspects, it may be desired to administer genetically modified T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom as described herein, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain aspects, T cells can be activated from blood draws of from 10 cc to 400 cc. In certain aspects, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.

[0148] Modes of administration can include, for example intravenous (i.v.) injection or infusion. The compositions described herein can be administered to a patient transarterially, intratumorally, intranodally, or intramedullary. In some embodiments, the compositions of genetically modified T cells and genetically modified MSCs may be injected directly into a tumor, lymph node, or site of infection. In one embodiment, the compositions described herein are administered into a body cavity or body fluid (e.g., ascites, pleural fluid, peritoneal fluid, or cerebrospinal fluid).

[0149] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices.

[0150] In some embodiments, a single treatment regimen is required. In others, administration of one or more subsequent doses or treatment regimens can be performed. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer. In some embodiments, no additional treatments are administered following the initial treatment. In one embodiment, genetically modified T cells are administered once, and genetically modified MSCs are administered at least one additional time. In one embodiment, genetically modified MSCs are administered once, and genetically modified T cells are administered at least one additional time.

[0151] The dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen. The dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.

[0152] Table 2 shows non-limiting examples of known tumor antigens associated with a particular cancer type.

TABLE-US-00002 TABLE 2 Tumor antigens associated with a given cancer. Cancer Tumor Antigen Glioblastoma EGFRvIII Glioma HER2 Medulloblastoma CD133 EGFR IL13RA2 Melanoma L1-CAM CTAG1B GD2 Breast Cancer HER2 Non-small Cell Lung Cancer EGFR

EXAMPLES

Example 1: Dual Stem Cell and CAR-T Based Immune Therapies for Resected Tumors

[0153] As tissue damage is known to result in activation of both innate and adaptive immune response 1, flow cytometry analysis indicates a gradual, time-dependent increase in the number of mononuclear cells up to day 6 post-tumor resection. Furthermore, sub-analysis on mononuclear cells indicated that significant numbers of myeloid derived suppressor cells (MDSC) resided within CT2A-Fmc tumors, which were markedly reduced after tumor resection (FIG. 1A). Tumor resection enhanced recruitment of both CD4+ and CD8+ effector T cells into resected area at day 5 post-tumor resection (FIGS. 1B-E). Together, these results indicate that surgical resection of CT2A tumors greatly decreases the number of tumor-associated MDSCs and simultaneously increases the number of effector T lymphocytes recruited into the remaining tumor area. These studies are promising and provide a new platform for testing novel immune based therapeutics in such models.

[0154] IFN belongs to type I interferons that bind to the interferon-/ cell surface receptor complex (IFNAR).sup.2 and induces the classical JAK-STAT pathway as well as PI3K and p38 MAPK pathways.sup.3. A number of pre-clinical studies have shown that IFN has direct anti-tumor activity.sup.4-6 and also acts as an immunostimulatory molecule by indirectly provoking an antitumor response via modulation of the immune system.sup.7-9. However, despite these bi-functional modes of action, the clinical translation of IFN treatments for cancer so far has been restricted by its short half-life and systemic toxicity.sup.10-12. While not wishing to be bound by theory, it was hypothesized that stem cell-based on-site delivery could address the issues related to the short half-life of IFN, while achieving therapeutic concentrations locally without causing systemic toxicity.sup.13,14. Based on this rationale, lenti- and retro-viral vectors were generated bearing a highly secretable variant of human and mouse IFN, and mouse MSCs were transduced to express mIFN (MSC-mIFN). The in vitro data reveal that mouse GBM cells express IFN receptors, IFNAR1/2, and MSC-released mIFN results in phosphorylation of STAT1 and p38 and suppresses proliferation of mouse GBM via induction of cell cycle arrest (FIG. 2A-D). In vivo, intratumoral injection of MSC-mIFN into established CT2A-FmC tumors resulted in a significantly prolonged survival in immunocompetent (C57/B6) as compared to immunocompromised (SCID) mice (FIG. 2E). Based on in vivo findings, the immunomodulatory effects from the direct anti-GBM response of mIFN were considered.

[0155] PD-L1 expression across different cancer types is seen in a small subset of tumor cells and previous studies have shown only limited correlation between basic PD-L1 expression levels and immune checkpoint blockade efficacy.sup.15,16. Moreover, GBM are considered immunologically cold and have low levels of T and NK cell infiltrations which might be responsible for their limited PD-L1 levels in GBM. Although IFN has bimodal immunomodulatory and cytotoxic functions, it has also been known to upregulate PD-L1 expression on tumor cells via the JAK/STAT/IRF1 signaling pathway.sup.17, thus influencing immune-modulatory function of IFN. It has been shown that both recombinant IFN and MSC-IFN treatment results in the increased PD-L1 expression on GBM tumor cells in culture. This upregulation can be blocked by the use of IFNaR1 blocking antibody, MAR1, 5A3 (FIGS. 5A-B). In vivo, intratumoral implantation of MSC-IFN results in the upregulation of PD-L1 on tumor cells as compared to controls (FIG. 5C). These findings are exciting and support the rationale for the combined use of MSC mediated delivery of IFN and ScFV-PD-L1 in GBM.

[0156] PD-L1 has been identified as a factor associated with poor prognosis in a range of cancers, and was reported to be mainly induced by PTEN loss in GBM.sup.18. Previous studies have shown that PTEN loss increases PD-L1 expression in colorectal cancer.sup.19 and promotes immune resistance in GBM.sup.20. Immune checkpoint blockade with monoclonal antibodies targeting PD-1 or PD-L1 has recently shown favorable results in the clinical therapy of multiple cancer types.sup.21,22. Despite important clinical benefits, systemically delivered anti PD-1 and PD-L1 therapies are associated with a diverse spectrum of immune-related adverse events (irAEs) that are occasionally severe or even fatal.sup.23,24. Thus, it would be ideal to use MSC that release both IFN and ScFV-PDL1 and demonstrate their therapeutic efficacy in mouse tumor cells of GBM.

[0157] A retroviral vector was constructed bearing human and mouse specific ScFv-PDL1 encoding murine Ig -chain V-J2-C signal peptide and the single chain variable region of the YW234.55.S70 antibody against murine PD-L1 and assessed for its therapeutic in vitro and in vivo. Specifically, mouse GBM express cell surface PD-L1, and MSC engineered to express ScFv-PDL1 (MSC-SCFv-PDL1) suppress tumor growth in vitro (using EGFRvIII CAR T assay) and in vivo and increase survival of mice bearing tumors (FIG. 3A-E). These findings lend validity to the use of MSC delivered immune checkpoint inhibitors in GBM and further strengthen the rationale for the locally-delivered MSC mediated IFN and immune checkpoint therapies in resected solid tumors.

[0158] Chimeric antigen receptor (CAR) T cells.sup.25 have demonstrated impressive clinical efficacy for a number of hematological cancers, however their success has been limited in solid tumors.sup.26. Previous studies have developed CARs directed to the mutant variant of cell surface receptor, EGFR (EGFRvIII; known to be specifically expressed in GBM.sup.27) and shown their efficacy in mouse models of intact GBM.sup.28. Although these studies offer promise, inadequate recruitment of CAR T cells and their functionality in the immune-evasive environment of tumors.sup.25 remain a serious challenge in developing optimal CAR T therapies for GBM. The chemokine CCL2 is known to play an important role in the recruitment of T cells to tumors.sup.29-31 and recent loss of function studies reveal that MSCs express significant levels of CCL2, allowing their long lasting contact with T cells.sup.32. It was confirmed that both human and mouse MSC express CCL2 (FIG. 4) and implantation of encapsulated MSC in the tumor resection-cavity can lead to heightened tropism of adoptively transferred CAR T cells. The fate of systemically delivered imageable EGFRvIII-CAR T can be assessed in mouse tumor models of resection.

[0159] Immunomodulatory cytokines can stimulate vigorous antitumor responses and are candidates for increasing CAR T cell efficacy in solid tumors. While any cytokine that promotes immune cell activation or cytotoxic activity can be of benefit, IL-12 in particular has been explored as a candidate for tumor immunotherapy, due to its ability to activate both innate and adaptive immunity.sup.33. However, its short half-life, severe side effects associated with systemic administration.sup.42,4333,34 and a very narrow therapeutic benefit have hampered its use in this manner. Described herein are studies that demonstrate the benefit of local delivery of IL-12 directly into the tumor microenvironment. IL-12 is a heterodimeric protein composed of p35 and p40 subunits that bridges the innate and adaptive immune system.sup.35. IL-12 p35 subunit can homodimerize and IL-12 p40 subunit can associate with IL23a subunit to form IL23.sup.35, therefore bioactive IL-12 requires the expression of both p40 and p35, and correct heterodimer assembly.sup.36. A dual promoter vector was constructed bearing secretable p35 and p40 subunits of IL-12, separated by a linker sequence that has been optimized previously.sup.37. Limiting IL-12 expression to within the tumor microenvironment may reduce unwanted toxicity while enhancing CAR T cell functionality; therefore, MSCs were engineered to express and deliver IL-12. The data presented here indicate that MSCs can be readily engineered to express functional IL-12 (FIGS. 6A-E) and MSC-IL-12 significantly influences tumor growth in vivo (FIG. 6F).

[0160] Prolonged treatment with IL-12 has shown detrimental effects on antitumor activity of T cells, leading to T cell exhaustion.sup.38. The regulatable release of IL-12 via MSC should overcome the problems associated with systemic and constitutive delivery of IL-12. Utilizing the pCW57.1 Dox-inducible lentiviral vector (Addgene).sup.39, double promoter lentiviral vectors were created for Tet regulatable GFP-Fluc, p40 and p35 subunits of IL-12 and ScFV-PDL1 (FIG. 7A). The data indicate that mouse MSC expressing GFP-Fluc are tightly regulated using 9-tert-Butyl Doxycycline (9 TB-Dox) both in vitro and in vivo (FIG. 7B-C). Furthermore, the data indicate that MSC transduced with LV-TET-IL12 show a tightly regulated time dependent increase in IL-12 expression post 9 TB-Dox treatment (FIG. 7D).

[0161] Previous studies have shown loss of functionality of CART cells post-tumor recruitment due to the up-regulation of inhibitory circuits.sup.40. Recent studies have indicated that PD-L1 upregulation in the tumor microenvironment results in PD-1 mediated inhibition of T cell function.sup.41. While not wishing to be bound by theory, it was hypothesized that if CAR T cells become exhausted in solid tumors.sup.40, immune-checkpoint blockade can improve the potency of CAR T cell therapies.sup.21,22 against such tumors. The combined efficacy of engineered MSCs expressing scFV-PDL1 and CAR T therapy in syngeneic GBM models of resection were tested. Mouse- and human-specific EGFRvIII CARs were created and engineered with dual promoter lentiviral and retroviral vectors respectively bearing GFP-Fluc and EGFRvIII specific ScFv for generation of human and mouse CAR T cells (FIG. 8A-B). The data show that T cells can be activated and transduced efficiently with LVs (FIG. 8C-E), with their functionality shown in vitro (FIG. 8F). These findings lend validity to the use of MSC in recruiting CAR T cells to solid tumors and further strengthen the rationale for the locally delivered MSC and systemically delivered CAR T in resected solid tumors.

Example 3: Intravenously Injected CAR-T Cells are not Effective Against Brain Tumors

[0162] CAR T cells were intravenously injected into mice bearing brain tumors (FIG. 9).

[0163] CAR T cells were delivered on day 10 post-tumor implantation (FIG. 9A). Fluc imaging of intravenously-administered CAR T cells show that there is not a significant difference between CAR T cells and control T cells delivered intravenously (FIG. 9B).

Example 4: Intratumorally Implanted CAR-T Cells have Therapeutic Efficacy

[0164] EGFRII CAR T cells were implanted intratumorally on days 8 and 12 post tumor implantation (FIG. 10A). As a control, T cells were also implanted into control animals. Fluc imaging revealed that CAR T cells delivered intratumorally had dramatic therapeutic efficacy in mice with brain tumors (FIG. 10B).

Example 5: The Combination of CAR T Cells and IL-12-Producing MSCs Encapsulated in the sECM and Implanted in the GBM Tumor Resection Cavity have Therapeutic Efficacy

[0165] While resection of the primary GBM tumor mass has shown clinical benefit, adjuvant chemotherapy post-tumor resection has provided limited additional benefit.sup.42-45. One of the major impediments to the efficient delivery of systemically delivered therapeutic agents is the blood brain barrier (BBB).sup.46 and vascular dysfunction in the tumor.sup.47. Additionally, many of the currently used drugs have a short systemic half-life and peak concentrations which prevent drugs from ultimately reaching the brain and accumulating to therapeutic concentrations within individual brain tumor cells.sup.48. These factors necessitate exploration of local delivery options of therapeutics to the tumors in the brain. It has been shown that stem cells exhibit potent pathotropic migratory properties, rendering them attractive for use as targeted delivery vectors in tumor therapy.sup.43,49-53. In particular, MSC are attractive for manipulation as they (i) exhibit high metabolic activity and thus strong expression of transgenes in vitro and in vivo; (ii) survive and integrate in the brain after transplantation; and (iii) have significantly low immunogenicity in the brain.sup.54,55. It has been shown that both mouse and human MSC engineered to express dual imaging marker, GFP-Fluc survive in the brains of immune-competent C57BL/6 and immune-compromised SCID mice up to at least 2 weeks.sup.56,57.

[0166] These attributes render MSCs well-suited for targeted therapeutic delivery vehicles and strengthen the rationale for their use in GBM therapy. Although, direct intratumoral injection of therapeutic stem cells in intracranial tumors is effective, there are a number of limitations to test stem cell-based therapeutic interventions in mouse model of GBM resection that mimics the clinical scenario of tumor resection and treatment post-resection. These include developing methods to introduce stem cells into the resection cavity to prevent rapid wash-out of a significant number of cells by cerebrospinal fluid (CSF).

[0167] Previous reports have described the efficacy of second generation.sup.58 and IL-12 secreting armored CAR T cells.sup.59. IL-12 was shown to significantly augment CAR T-cell efficacy in vitro and led to eradication of disseminated disease in a portion of treated mice.sup.59. Recently IL-12 armored CAR T cells were shown to overcome the inhibitory ascitic microenvironment, alter the ascitic cytokine and TAM microenvironment, and overcome PD-L1-mediated inhibition.sup.60. Due to their ability to provide a physiologic environment that promotes T cell and stem cell survival while permitting easy in vivo transplantation and cell retention, biodegradable sECM have been utilized in a variety of rodent models. It has been shown that sECM encapsulated stem cells expressing imageable GFP-Fluc when implanted in the GBM tumor resection cavity survive longer than non-encapsulated stem cells.sup.61. These data lend strong validity to the use of CART cells and MSC-IL-12 to target cells in the tumor microenvironment post-tumor resection. The present data indicate that the resection-induced immune reaction can be further modulated towards a tumor-specific immune response via local delivery of sECM-encapsulated EGFRvIII CAR T and MSCs expressing IL-12, resulting in the suppression of growth of residual tumors (FIG. 11A-B). Therefore, modulating non-specific immune reaction post-tumor debulking towards a tumor-specific immune response provides an ideal immunotherapy strategy in GBM treatment, where complete resection is not generally possible, and where the blood brain barrier can hamper tumor localization by MSCs or CAR-Ts administered systemically. Where it is demonstrated herein to be effective against the highly treatment-refractory GBM, this approach is specifically contemplated for use following the resection of any solid tumor.

REFERENCES

[0168] 1. Valparaiso, A. P., Vicente, D. A., Bograd, B. A., Elster, E. A. & Davis, T. A. Modeling acute traumatic injury. The Journal of surgical research 194, 220-232 (2015). [0169] 2. Platanias, L. C. Mechanisms of type-I- and type-II-interferon-mediated signalling. Nature reviews. Immunology 5, 375-386 (2005). [0170] 3. Pokrovskaja, K., Panaretakis, T. & Grander, D. Alternative signaling pathways regulating type I interferon-induced apoptosis. J Interferon Cytokine Res 25, 799-810 (2005). [0171] 4. Dong, Z., et al. Suppression of angiogenesis, tumorigenicity, and metastasis by human prostate cancer cells engineered to produce interferon-beta. Cancer Res 59, 872-879 (1999). [0172] 5. Qin, X. Q., et al. Interferon-beta gene therapy inhibits tumor formation and causes regression of established tumors in immune-deficient mice. Proc Natl Acad Sci USA 95, 14411-14416 (1998). [0173] 6. Lykhova, A. A., et al. Suppression of proliferation, tumorigenicity and metastasis of lung cancer cells after their transduction by interferon-beta gene in baculovirus vector. Cytokine 71, 318-326 (2014). [0174] 7. Fuertes, M. B., et al. Host type I IFN signals are required for antitumor CD8+ T cell responses through CD8{alpha}+ dendritic cells. J Exp Med 208, 2005-2016 (2011). [0175] 8. Jablonska, J., Leschner, S., Westphal, K., Lienenklaus, S. & Weiss, S. Neutrophils responsive to endogenous IFN-beta regulate tumor angiogenesis and growth in a mouse tumor model. The Journal of clinical investigation 120, 1151-1164 (2010). [0176] 9. Tough, D. F., Borrow, P. & Sprent, J. Induction of bystander T cell proliferation by viruses and type I interferon in vivo. Science 272, 1947-1950 (1996). [0177] 10. Fierlbeck, G., et al. Pharmacodynamics of recombinant IFN-beta during long-term treatment of malignant melanoma. J Interferon Cytokine Res 16, 777-781 (1996). [0178] 11. Salmon, P., Le Cotonnec, J. Y., Galazka, A., Abdul-Ahad, A. & Darragh, A. Pharmacokinetics and pharmacodynamics of recombinant human interferon-beta in healthy male volunteers. J Interferon Cytokine Res 16, 759-764 (1996). [0179] 12. Trinchieri, G. Type I interferon: friend or foe? J Exp Med 207, 2053-2063 (2010). [0180] 13. Choi, S. H., et al. Tumor resection boosts therapeutic efficacy of encapsulated stem cells expressing a highly secretable variant of interferon-beta in glioblastomas. Clin Cancer Res (2017). [0181] 14. Stuckey, D. W., Hingtgen, S. D., Karakas, N., Rich, B. E. & Shah, K. Engineering toxin-resistant therapeutic stem cells to treat brain tumors. Stem Cells (2014). [0182] 15. Gibney, G. T., Weiner, L. M. & Atkins, M. B. Predictive biomarkers for checkpoint inhibitor-based immunotherapy. Lancet Oncol 17, e542-e551 (2016). [0183] 16. Zou, W., Wolchok, J. D. & Chen, L. PD-L1 (B7-H1) and PD-1 pathway blockade for cancer therapy: Mechanisms, response biomarkers, and combinations. Science translational medicine 8, 328rv324 (2016). [0184] 17. Garcia-Diaz, A., et al. Interferon Receptor Signaling Pathways Regulating PD-L1 and PD-L2 Expression. Cell reports 19, 1189-1201 (2017). [0185] 18. Parsa, A. T., et al. Loss of tumor suppressor PTEN function increases B7-H1 expression and immunoresistance in glioma. Nature medicine 13, 84-88 (2007). [0186] 19. Song, M., et al. PTEN loss increases PD-L1 protein expression and affects the correlation between PD-L1 expression and clinical parameters in colorectal cancer. PloS one 8, e65821 (2013). [0187] 20. Peng, W., et al. Loss of PTEN Promotes Resistance to T Cell-Mediated Immunotherapy. Cancer discovery 6, 202-216 (2016). [0188] 21. Reardon, D. A., et al. Glioblastoma Eradication Following Immune Checkpoint Blockade in an Orthotopic, Immunocompetent Model. Cancer Immunol Res 4, 124-135 (2016). [0189] 22. Sharma, P. & Allison, J. P. The future of immune checkpoint therapy. Science 348, 56-61 (2015). [0190] 23. Champiat, S., et al. Management of immune checkpoint blockade dysimmune toxicities: a collaborative position paper. Ann Oncol 27, 559-574 (2016). [0191] 24. Naidoo, J., et al. Toxicities of the anti-PD-1 and anti-PD-L1 immune checkpoint antibodies. Ann Oncol 27, 1362 (2016). [0192] 25. Scarfo, I. & Maus, M. V. Current approaches to increase CAR T cell potency in solid tumors: targeting the tumor microenvironment. J Immunother Cancer 5, 28 (2017). [0193] 26. Priceman, S. J., Forman, S. J. & Brown, C. E. Smart CARs engineered for cancer immunotherapy. Curr Opin Oncol 27, 466-474 (2015). [0194] 27. Wong, A. J., et al. Increased expression of the epidermal growth factor receptor gene in malignant gliomas is invariably associated with gene amplification. Proc Natl Acad Sci USA 84, 6899-6903 (1987). [0195] 28. Johnson, L. A., et al. Rational development and characterization of humanized anti-EGFR variant III chimeric antigen receptor T cells for glioblastoma. Science translational medicine 7, 275ra222 (2015). [0196] 29. Brown, C. E., et al. Tumor-derived chemokine MCP-1/CCL2 is sufficient for mediating tumor tropism of adoptively transferred T cells. J Immunol 179, 3332-3341 (2007). [0197] 30. Lanca, T., et al. Protective role of the inflammatory CCR2/CCL2 chemokine pathway through recruitment of type 1 cytotoxic gammadelta T lymphocytes to tumor beds. J Immunol 190, 6673-6680 (2013). [0198] 31. Lanca, T. & Silva-Santos, B. Recruitment of gammadelta T lymphocytes to tumors: A new role for the pleiotropic chemokine CCL2. Oncoimmunology 2, e25461 (2013). [0199] 32. Lee, H. K., et al. CCL2 deficient mesenchymal stem cells fail to establish long-lasting contact with T cells and no longer ameliorate lupus symptoms. Scientific reports 7, 41258 (2017). [0200] 33. Lasek, W., Zagozdzon, R. & Jakobisiak, M. Interleukin 12: still a promising candidate for tumor immunotherapy? Cancer immunology, immunotherapy: CII 63, 419-435 (2014). [0201] 34. Alkayyal, A. A., et al. NK-Cell Recruitment Is Necessary for Eradication of Peritoneal Carcinomatosis with an IL12-Expressing Maraba Virus Cellular Vaccine. Cancer Immunol Res 5, 211-221 (2017). [0202] 35. Del Vecchio, M., et al. Interleukin-12: biological properties and clinical application. Clin Cancer Res 13, 4677-4685 (2007). [0203] 36. Gubler, U., et al. Coexpression of two distinct genes is required to generate secreted bioactive cytotoxic lymphocyte maturation factor. Proc Natl Acad Sci USA 88, 4143-4147 (1991). [0204] 37. van de Water, J. A., et al. Therapeutic stem cells expressing variants of EGFR-specific nanobodies have antitumor effects. Proc Natl Acad Sci USA 109, 16642-16647 (2012). [0205] 38. Yang, Z. Z., et al. IL-12 upregulates TIM-3 expression and induces T cell exhaustion in patients with follicular B cell non-Hodgkin lymphoma. The Journal of clinical investigation 122, 1271-1282 (2012). [0206] 39. Wang, T., Wei, J. J., Sabatini, D. M. & Lander, E. S. Genetic screens in human cells using the CRISPR-Cas9 system. Science 343, 80-84 (2014). [0207] 40. Moon, E. K., et al. Multifactorial T-cell hypofunction that is reversible can limit the efficacy of chimeric antigen receptor-transduced human T cells in solid tumors. Clin Cancer Res 20, 4262-4273 (2014). [0208] 41. Cherkassky, L., et al. Human CART cells with cell-intrinsic PD-1 checkpoint blockade resist tumor-mediated inhibition. The Journal of clinical investigation 126, 3130-3144 (2016). [0209] 42. Minniti, G., et al. Radiotherapy plus concomitant and adjuvant temozolomide for glioblastoma in elderly patients. J Neurooncol 88, 97-103 (2008). [0210] 43. Shah, K. Stem cell-based therapies for tumors in the brain: are we there yet? Neuro Oncol 18, 1066-1078 (2016). [0211] 44. Wen, P. Y., et al. Phase I/II study of erlotinib and temsirolimus for patients with recurrent malignant gliomas: North American Brain Tumor Consortium trial 04-02. Neuro Oncol 16, 567-578 (2014). [0212] 45. Wen, P. Y. & Kesari, S. Malignant gliomas in adults. N Engl J Med 359, 492-507 (2008). [0213] 46. Muldoon, L. L., et al. Chemotherapy delivery issues in central nervous system malignancy: a reality check. J Clin Oncol 25, 2295-2305 (2007). [0214] 47. Jain, R. K., et al. Angiogenesis in brain tumours. Nat Rev Neurosci 8, 610-622 (2007). [0215] 48. Sarin, H. Recent progress towards development of effective systemic chemotherapy for the treatment of malignant brain tumors. J Transl Med 7, 77 (2009). [0216] 49. Aboody, K. S., et al. Neural stem cell-mediated enzyme/prodrug therapy for glioma: preclinical studies. Science translational medicine 5, 184ra159 (2013). [0217] 50. Ehtesham, M., et al. The use of interleukin 12-secreting neural stem cells for the treatment of intracranial glioma. Cancer Res 62, 5657-5663 (2002). [0218] 51. Lee, J., et al. Cellular and genetic characterization of human adult bone marrow-derived neural stem-like cells: a potential antiglioma cellular vector. Cancer Res 63, 8877-8889 (2003). [0219] 52. Nakamizo, A., et al. Human bone marrow-derived mesenchymal stem cells in the treatment of gliomas. Cancer Res 65, 3307-3318 (2005). [0220] 53. Stuckey, D. W. & Shah, K. Stem cell-based therapies for cancer treatment: separating hope from hype. Nat Rev Cancer 14, 683-691 (2014). [0221] 54. Aboody, K. S., et al. Neural stem cells display extensive tropism for pathology in adult brain: evidence from intracranial gliomas. Proc Natl Acad Sci USA 97, 12846-12851 (2000). [0222] 55. Corsten, M. F. & Shah, K. Therapeutic stem-cells for cancer treatment: hopes and hurdles in tactical warfare. Lancet Oncol 9, 376-384 (2008). [0223] 56. Martinez-Quintanilla, J., et al. Therapeutic efficacy and fate of bimodal engineered stem cells in malignant brain tumors. Stem Cells 31, 1706-1714 (2013). [0224] 57. Sasportas, L. S., et al. Assessment of therapeutic efficacy and fate of engineered human mesenchymal stem cells for cancer therapy. Proc Natl Acad Sci USA 106, 4822-4827 (2009). [0225] 58. Chekmasova, A. A., et al. Successful eradication of established peritoneal ovarian tumors in SCID-Beige mice following adoptive transfer of T cells genetically targeted to the MUC16 antigen. Clin Cancer Res 16, 3594-3606 (2010). [0226] 59. Koneru, M., Purdon, T. J., Spriggs, D., Koneru, S. & Brentjens, R. J. IL-12 secreting tumor-targeted chimeric antigen receptor T cells eradicate ovarian tumors in vivo. Oncoimmunology 4, e994446 (2015). [0227] 60. Yeku, O. O., Purdon, T. J., Koneru, M., Spriggs, D. & Brentjens, R. J. Armored CAR T cells enhance antitumor efficacy and overcome the tumor microenvironment. Scientific reports 7, 10541 (2017). [0228] 61. Kauer, T. M., Figueiredo, J. L., Hingtgen, S. & Shah, K. Encapsulated therapeutic stem cells implanted in the tumor resection cavity induce cell death in gliomas. Nat Neurosci (2012).

TABLE-US-00003 SEQUENCES (PD-L1-Homosapiens-Isoforma) SEQIDNO:1 1 MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME 61 DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG 121 ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT 181 TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH 241 LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET (PD-1-Homosapiens) SEQIDNO:2 1 MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS 61 ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT 121 YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS 181 LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP 241 CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL (CTLA-4-Homosapiens) SEQIDNO:3 1 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY 61 ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR 121 AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL 181 LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN (TIM-3-Homosapiens) SEQIDNO:4 1 MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCP 61 YSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWF 121 NDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTG 181 TPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSV 241 ESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMD 301 GIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHTRLDYIGDSKN 361 VLNDVQHGREDEDGLFTL (LAG-3-Homosapiens) SEQIDNO:5 1 MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAG 61 VTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV 121 QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLR 181 ASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWG 241 CILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP 301 PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGS 361 PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERL 421 LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRP 481 RRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL SEQIDNO:6 (TIGIT-Homosapiens) 1 MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWE 61 QQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTG 121 RIFLEVLESSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLR 181 RKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFF 241 TETG (TIGIT-Musmusculus) SEQIDNO:7 1 MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDW 61 KQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYK 121 GRIFLKVQESSVAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTE 181 AEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKT 241 G (CTLA-4Musmusculus) SEQIDNO:8 1 MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEY 61 SPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLR 121 AVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFL 181 VTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN (TIM-3-Homosapiens) SEQIDNO:9 1 MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV 61 FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND 121 EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA 181 NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI 241 SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM 301 P (TIM-3-Musmusculus) SEQIDNO:10 1 MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPW 61 SQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMN 121 DKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWA 181 DEIKDSGETIRTAIHIGVGVSAGLTLALIIGVLILKWYSCKKKKLSSLSLITLANLPPGG 241 LANAGAVRIRSEENIYTIEENVYEVENSNEYYCYVNSQQPS (LAG-3-Musmusculus) SEQIDNO:11 1 MREDLLLGFLLLGLLWEAPVVSSGPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGG 61 VIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEE 121 RGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDW 181 VLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYR 241 DGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHLPPGVGTPSLLIAKWTPPGGGPE 301 LPVAGKSGNFTLHLEAVGLAQAGTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGK 361 LLCEVTPASGKERFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYA 421 AESSSGAHSARRISGDLKGGHLVLVLILGALSLFLLVAGAFGFHWWRKQLLLRRFSALEH 481 GIQPFPAQRKIEELERELETEMGQEPEPEPEPQLEPEPRQL (PD-L1-Homosapiens-isoformb) SEQIDNO:12 1 MRIFAVFIFMTYWHLLNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQV 61 LSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHP 121 PNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET (PD-L-1-Homosapiens-isoformc) SEQIDNO:13 1 MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME 61 DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG 121 ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT 181 TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPGNILNVSIKICLT 241 LSPST (PD-L-1-Musmusculus) SEQIDNO:14 1 MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKE 61 DEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIISYGG 121 ADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSV 181 TTSRTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQNHTAELIIPELPATHPPQNRTHW 241 VLLGSILLFLIVVSTVLLFLRKQVRMLDVEKCGVEDTSSKNRNDTQFEET (PD-1-Musmusculus) SEQIDNO:15 1 MWVRQVPWSFTWAVLQLSWQSGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWS 61 EDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI 121 YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQGMVIGIMSALVGI 181 PVLLLLAWALAVFCSTSMSEARGAGSKDDTLKEEPSAAPVPSVAYEELDFQGREKTPELP 241 TACVHTEYATIVFTEGLGASAMGRRGSADGLQGPRPPRHEDGHCSWPL (Ipilimumabheavychain-US20150283234) SEQIDNO:16 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK (Ipilimumablightchain-US20150283234) SEQIDNO:17 EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (Pembrolizumabheavychainsequence-US2012135408) SEQIDNO:18 QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNF NEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSLGK SEQIDNO:19 (Pembrolizumablightchainsequence-US2012135408) EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLES GVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (Nivolumab-heavychainsequence-US2013173223) SEQIDNO:20 QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV MHEALHNHYTQKSLSLSLGK (Nivolumab-lightchainsequence-US2013173223) SEQIDNO:21 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (Atezolizumab-heavychainsequence) SEQIDNO:22 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYY ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYAST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK (Atezolizumab-lightchainsequence) SEQIDNO:23 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (anti-TIMantibodyheavychain-WO2018129553A1) SEQIDNO:24 EVQLLESGGGLVQPGGSLRLSCAAASGFTFSSYDMSWVRQAPGKGLDWVSTISG GGTYTYYQDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASMDYWGQG TTVTVSSA (anti-TIMantibodylightchain-WO2018129553A1) SEQIDNO:25 DIQMTQSPSSLSASVGDRVTITCRASQSIRRYLNWYHQKPGKAPKLLIYGASTLQ SGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQSHSAPLTFGGGTKVEIKR (EGFRvIII-Homosapiens) SEQIDNO:26 1 MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV 61 VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA 121 VLSNYDANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRG 181 KSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKY 241 SFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEF 301 KDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFL 361 LIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISG 421 NKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS 481 CRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHY 541 IDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS 601 IATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLR 661 ILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYV 721 MASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGM 781 NYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALES 841 ILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYM 901 IMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEE 961 DMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSF 1021 LQRYSSDPTGALTEDSIDDTFLPVPGEWLVWKQSCSSTSSTHSAAASLQCPSQVLPPASP 1081 EGETVADLQTQ (EGFRvIII-Musmusculus) SEQIDNO:27 1 MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV 61 VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA 121 ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL 181 QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC 241 TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV 301 VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK 361 YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF 421 ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL 481 FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN 541 ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM 601 GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV 661 VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL 721 GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL 781 GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL 841 AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW 901 SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR 961 PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI 1021 PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTED 1081 NIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN 1141 TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV 1201 APPSSEFIGA