Immunoassay standards and measurement of tau using intra-assay calibration standards
10823739 ยท 2020-11-03
Assignee
Inventors
- Paul Rhyne (Princeton, NJ, US)
- Adam J. Simon (Princeton, NJ, US)
- Flora Berisha (Princeton, NJ, US)
- Robert John Neely (Princeton, NJ, US)
- Christopher J. Spedaliere (Princeton, NJ, US)
- Claudio Mapelli (Princeton, NJ)
Cpc classification
C07K19/00
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides novel peptides, compositions, and methods for creating quantitative novel compositions, as well as methods for creating quantitative standards to calibrate analytes. These peptides, compositions, and methods enable the creation of standards and calibrators for analyzing analytes and measuring clinical biomarkers (e.g., Tau). Also provided are kits comprising the peptides or compositions described herein, for use in assays (e.g., sandwich immunoassays).
Claims
1. A modified peptide that consists of an N-terminal reactive region, a C-terminal reactive region, and a PEG6 linker region, wherein: (a) the N-terminal reactive region consists of an amino acid sequence selected from the group of SEQ ID NOs: 7, 8, 9, and 10; and (b) the C-terminal reactive region consists of an amino acid sequence selected from the group of SEQ ID NOs: 7, 8, 9 and 10; and (c) wherein the linker region consists essentially of a PEG6 linker.
2. The modified peptide of claim 1, wherein the N-terminal and C-terminal reactive regions respectively consists of the amino acid sequences selected from the group consisting of SEQ ID NOs: 7 and 9, SEQ ID NOs: 7 and 8, SEQ ID NOs: 8 and SEQ ID NOs: 8 and 7, SEQ ID NOs: 10 and 9, SEQ ID NOs: 9 and 7, SEQ ID NOs: 9 and 8; and, SEQ ID Nos: 9 and 10, respectively.
3. The modified peptide of claim 2, wherein the N-terminal and C-terminal reactive regions consists essentially of the amino acid sequences set forth in SEQ ID NOs: 7 and 9, respectively.
4. The modified peptide of claim 1, wherein the PEG6 linker has the following structure: ##STR00003##
5. The modified peptide of claim 1, wherein the linker region is a non-immunoreactive domain.
6. The modified peptide of claim 2 wherein the peptide is SEQ ID: 24.
7. A composition comprising the modified peptide of claim 1 and a carrier.
8. A composition comprising a modified peptide consisting of an N-terminal reactive region, a C-terminal reactive region, and a PEG6 linker region, wherein the N-terminal and C-terminal reactive regions are linked by the PEG6 linker region and wherein said modified peptide is selected from the group consisting of: (a) the N-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 7 and the C-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 9; (b) the N-terminal region consists of the amino acid sequence set forth in SEQ ID NO: 8 and the C-terminal region consists essentially of the amino acid sequence set forth in SEQ ID NO: 7; (c) the N-terminal region consists of the amino acid sequence set forth in SEQ ID NO: 8 and the C-terminal reactive region consists essentially of the amino acid sequence set forth in SEQ ID NO: 9; (d) the N-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 10 and the C-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 9; (e) the N-terminal region consists of the amino acid sequence set forth in SEQ ID NO: 7 and the C-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 8; (f) the N-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 9 and the C-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 7; and (g) the N-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 9 and the C-terminal reactive region consists of the amino acid sequence set forth in SEQ ID NO: 8.
9. The modified peptide of claim 8, wherein the N-terminal and C-terminal reactive regions consist of the amino acid sequences set forth in SEQ ID NOs: 7 and 9, respectively.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION OF THE INVENTION
(10) The invention relates to peptides, modified peptides, and compositions that can be used as reference standards and calibrators to measure clinical biomarkers (e.g., Tau) in an immunoassay, as well as methods of measuring the quantity of Tau (e.g., Tau352, Tau381, Tau 383, Tau 410, Tau 412, or Tau 441) in a biological sample. Specifically, the present invention is aimed at creating non-aggregating, non-precipitating, and non-surface-adhering peptide reference standards for Tau for use in immunoassay formats.
I. Definitions
(11) In order that the present disclosure may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
(12) As used herein, the term Tau refers to a microtubule associated protein found in neuronal cells. There are six isoforms of Tau in the human brain resulting from RNA splicing (Himmler, Drechsel et al. 1989). These isoforms differ from one another in having three or four microtubule binding repeats (R) of 31-32 amino acids each in the C-terminal domain, and two, one or none amino terminal inserts (N) of 29 amino acids each (Goedert, Spillantini et al. 1989). Tau can be modified by phosphorylation, glycosylation, and other modifications (Hampel, Blennow et al. 2010). Tau contains repeated C-terminal microtubule binding domains and variable N-terminal domains and differences in the number and type of repeating domains results in the six isoforms (Himmler, Drechsel et al. 1989; Avila, Lucas et al. 2004; Hampel, Blennow et al. 2010). The sequence for the core domain of Tau is identical between the six isoforms and the epitopes used in the design of the present invention are all contained in the core domain, allowing these peptides to represent all six isoforms of Tau (
(13) TABLE-US-00001 TABLE1 TauPeptideSequences Descriptionof Peptide/Modified AminoAcidSequence PeptideSequence (SEQIDNO:1) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTD NativeTau441amino AGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLV acidsequence DEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG HVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPP GQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINK KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTS KCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG L (SEQIDNO:2) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTD NativeTau410amino AGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLV acidsequence DEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG HVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPP GQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYK PVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQ SKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE IVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADE VSASLAKQGL (SEQIDNO:3) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTD NativeTau412amino AGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIG acidsequence DTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPP KSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVV RTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQ PGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIV YKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDR VQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG AEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLA DEVSASLAKQGL (SEQIDNO:4) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTD NativeTau381amino AGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIG acidsequence DTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPP KSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVV RTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQ PGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVK SEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL (SEQIDNO:5) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTD NativeTau383amino AGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSD acidsequence DKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPA PKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTP PTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKS KIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIK HVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVE VKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF RENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSID MVDSPQLATLADEVSASLAKQGL (SEQIDNO:6) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTD NativeTau352amino AGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSD acidsequence DKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPA PKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTP PTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKS KIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIH HKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK KIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLS NVSSTGSIDMVDSPQLATLADEVSASLAKQGL
(14) As used herein, the term antibody is used in the broadest sense, and specifically covers monoclonal antibodies (including full length monoclonal antibodies or fragments thereof, such as Fab fragments and single chain antibodies), polyclonal antibodies, multispecific antibodies (i.e., bispecific antibodies), and genetically engineered antibodies, including affinity matured antibodies. Antibody can also refer to an antibody or antibody fragments fused to carrier proteins/organisms, such as phage or other display carriers, that have the same properties as isolated antibodies.
(15) As used herein, the term isolated, as used herein with reference to peptides, refers to a preparation of protein or protein complex (e.g., modified peptide molecule) that is essentially free from contaminating proteins normally present with the protein or complex (i.e., in the cellular milieu in which the protein or complex is found endogenously). Thus, an isolated protein complex is isolated from cellular components that normally would contaminate or interfere with the study of the peptide or complex in isolation. It is to be understood, however, that such an isolated complex may incorporate other proteins the modulation of which, by the protein or protein complex, is being investigated.
(16) As used herein, the term isolated as also used herein with respect to nucleic acids, such as DNA or RNA, refers to molecules in a form which does not occur in nature. Moreover, an isolated nucleic acid is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
(17) As used herein, the term nucleic acid refers to polynucleotide, such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA). The term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs, and, as applicable to the embodiment being described, single-stranded (such as sense or antisense) and double-stranded polynucleotide. Nucleic acid can also refer to a peptide nucleic acid PNA or an artificially synthesized DNA or RNA.
(18) As used herein, the term peptides, proteins, and polypeptides are used interchangeably herein. The term purified protein refers to a preparation of protein or proteins that are preferably isolated from or otherwise substantially free of other proteins normally associated with the protein(s) in a cell or cell lysate.
(19) As used herein, the term modified peptide refers to a peptide that has been modified relative to the native sequence of that peptide. For example, a modification may include the removal of a deleterious domain or the addition of a linker within the native peptide sequence.
(20) As used herein, the term binding refers to direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, ionic, and/or hydrogen-bond interactions under physiological conditions. Likewise, complex formation, between two or more polypeptides, refers to a direct association between polypeptides, due to, for example, covalent, electrostatic, hydrophobic, ionic, and/or hydrogen-bond interactions under physiological conditions.
(21) As used herein, the term domain refers to a region of protein that comprises a particular structure and/or performs a particular function (e.g., microtubule binding domain, phosphorylation domain, etc.).
(22) As used herein, the term immunoreactive domain refers to a region of protein that comprises a particular amino acid sequence that can be recognized by an antibody. This region includes amino acid sequences that contain modifications such as glycosylation, methylation, phosphorylation, or any other post-translational modifications known to one of ordinary skill in the art. Examples of amino acids that can be phosphorylated are tyrosine, serine, or threonine amino acids. An immunoreactive domain that includes amino acids that are phosphorylated would also be characterized as a phosphorylation domain. An immunoreactive domain also includes two or more regions of a protein that are in close proximity to one another in the protein's native folded state, which together comprise an antibody binding site.
(23) As used herein, the term immunoassay refers to a biochemical test that utilizes one or more antibodies to measure the presence or concentration of an analyte (e.g., Tau) in a biological matrix. This assay can produce a measurable signal in response to a specific binding if an antibody to an immunoreactive domain of a specific protein or peptide.
II. Reference Standards
(24) Provided herein are isolated peptides and modified peptides that can be used as reference standards and calibrators to measure clinical biomarkers (e.g., Tau). In one embodiment, the reference standard comprises an isolated peptide (e.g., an immunoreactive region). In a particular embodiment, the peptide has the amino acid sequence set forth in SEQ ID NO: 7, 8, 9, 10, 11, 12, or 13, as set forth below in Table 2. Phosphorylated regions of Tau can also be used to generate modified peptides for use as reference standards, e.g., peptides having the amino acid sequence set forth in SEQ ID NO: 14 or 15.
(25) TABLE-US-00002 TABLE2 Peptides/ImmunoreactiveRegions AminoAcidSequence Description KSGDRSGYSSPGSPGTPGSR nativeTauaminoacids (SEQIDNO:7) (190-209) RGAAPPGQKGQANATR nativeTauaminoacids (SEQIDNO:8) (155-170) LPTPPTREPKKVAVVR nativeTauaminoacids (SEQIDNO:9) (215-230) KTPPSSGEPPKSGDRS nativeTauaminoacids (SEQIDNO:10) (180-195) SGDRSGYSSP nativeTauaminoacids (SEQIDNO:11) (191-200) GAAPPGQKGQAN nativeTauaminoacids (SEQIDNO:12) (156-167) IPAKTPPAPKT(PO.sub.4)PPSSGEPPK nativeTauaminoacids (SEQIDNO:13) (171-190);aminoacid T181isphosphorylated REPKKVAVVRT(PO.sub.4)PPKSPSSAK nativeTauaminoacids (SEQIDNO:14) (221-240);aminoacid T231isphosphorylated *A11 amino acid numbers for the peptides correspond to the Tau 441 sequence.
(26) In another embodiment, the reference standard is a modified peptide, e.g., comprising a linker, a deletion, or substitution in an immunoreactive and/or non-immunoreactive domain. For example, in one embodiment, the modified peptide comprises an N-terminal immunoreactive region, a C-terminal immunoreactive region and a linker region, wherein the immunoreactive regions are defined by particular amino acid sequences. In another embodiment, the modified peptide comprises an N-terminal immunoreactive region, a C-terminal immunoreactive region, and a linker region, wherein:
(27) (a) the N-terminal immunoreactive region comprises or has an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 8, 9, and 10; and/or
(28) (b) the C-terminal immunoreactive region comprises or has an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 8, 9, and 10,
(29) and wherein the N-terminal and C-terminal immunoreactive regions are different amino acid sequences.
(30) In another embodiment, the modified peptide comprises N-terminal and C-terminal immunoreactive regions comprising or having amino acid sequences selected from the group consisting of SEQ ID NOs:7 and 9, SEQ ID NOs:7 and 8, SEQ ID NOs:8 and 9, and SEQ ID NOs:9 and 10, respectively. In another embodiment, the N-terminal and C-terminal immunoreactive regions comprise or have the amino acid sequences set forth in SEQ ID NOs:7 and 9, respectively. In a particular embodiment, the modified peptide is: KSGDRSGYSSPGSPGTPGSR-Generic Linker-LPTPPTREPKKVAVVR (SEQ ID NO: 16). In another embodiment, the modified peptide is: RGAAPPGQKGQANATR-Generic Linker-KSGDRSGYSSPGSPGTPGSR (SEQ ID NO:17), RGAAPPGQKGQANATR-Generic Linker-LPTPPTREPKKVAVVR (SEQ ID NO:18), or KTPPSSGEPPKSGDRS-Generic Linker-LPTPPTREPKKVAVVR (SEQ ID NO:19).
(31) In another embodiment, the modified peptide comprises an N-terminal immunoreactive region, a C-terminal immunoreactive region, and a linker region, wherein:
(32) (a) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:7 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:9;
(33) (b) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:8 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:7;
(34) (c) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:8 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:9;
(35) (d) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:10 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:9;
(36) (e) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:7 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:8;
(37) (f) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:9 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:7;
(38) (g) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:9 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:8;
(39) (h) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:12 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:14;
(40) (i) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:12 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:11;
(41) (j) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:13 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:15; or
(42) (k) the N-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:15 and the C-terminal immunoreactive region comprises or has the amino acid sequence set forth in SEQ ID NO:14.
(43) In a particular embodiment, the N-terminal and C-terminal immunoreactive regions comprise or have the amino acid sequences set forth in SEQ ID NOs: 7 and 9, respectively.
(44) In another embodiment, the modified peptide is shown below in Table 3:
(45) TABLE-US-00003 TABLE3 ModifiedPeptides/Constructs Descriptionof AminoAcidSequence Peptide/ModifiedPeptideSequence KSGDRSGYSSPGSPGTPGSR-Generic nativeTauaminoacids(190- Linker-LPTPPTREPKKVAVVR 209)-GenericLinker-nativeTau (SEQIDNO:16) aminoacids(215-230) RGAAPPGQKGQANATR-Generic nativeTauaminoacids Linker-KSGDRSGYSSPGSPGTPGSR (155-170)-GenericLinker-native (SEQIDNO:17) Tauaminoacids(190-209) RGAAPPGQKGQANATR-Generic nativeTauaminoacids(155- Linker-LPTPPTREPKKVAVVR 170)-GenericLinker-nativeTau (SEQIDNO:18) aminoacids(215-230) KTPPSSGEPPKSGDRS-Generic nativeTauaminoacids(180-195)- Linker-LPTPPTREPKKVAVVR GenericLinker-nativeTauamino (SEQIDNO:19) acids(215-230) RGAAPPGQKGQANATR-(PEG)6- nativeTauaminoacids KSGDRSGYSSPGSPGTPGSR (155-170)-(PEG)6-nativeTauamino (SEQIDNO:20) acids(190-209) RGAAPPGQKGQANATRGGSGGSKS nativeTauaminoacids GDRSGYSSPGSPGTPGSR (155-170)-GGSGGS-nativeTau (SEQIDNO:21) aminoacids(190-209) KSGDRSGYSSPGSPGTPGSR- nativeTauaminoacids(190- (PEG)6-RGAAPPGQKGQANATR 209)-(PEG)6-nativeTauamino (SEQIDNO:22) acids(155-170) KSGDRSGYSSPGSPGTPGSR-GGSG nativeTauaminoacids GS-RGAAPPGQKGQANATR (190-209)-GGSGGS-nativeTau (SEQIDNO:23) aminoacids(155-170) KSGDRSGYSSPGSPGTPGSR- nativeTauaminoacids(190- (PEG)6-LPTPPTREPKKVAVVR 209)-(PEG)6-nativeTauamino (SEQIDNO:24) acids(215-230) KSGDRSGYSSPGSPGTPGSR- nativeTauaminoacids(190- GGSGGS-LPTPPTREPKKVAVVR 209)-GGSGGS-nativeTauamino (SEQIDNO:25) acids(215-230) LPTPPTREPKKVAVVR-(PEG)6- nativeTauaminoacids(215- KSGDRSGYSSPGSPGTPGSR 230)-(PEG)6-nativeTauamino (SEQIDNO:26) acids(190-209) LPTPPTREPKKVAVVR-GGSGGS- nativeTauaminoacids(215- KSGDRSGYSSPGSPGTPGSR 230)-GGSGGS-nativeTauamino (SEQIDNO:27) acids(190-209) RGAAPPGQKGQANATR-GGSGGS- nativeTauaminoacids(155- LPTPPTREPKKVAVVR 170)-GGSGGS-nativeTauamino (SEQIDNO:28) acids(215-230) LPTPPTREPKKVAVVR-(PEG)6- nativeTauaminoacids(215- RGAAPPGQKGQANATR 230)-(PEG)6-nativeTauamino (SEQIDNO:29) acids(155-170) LPTPPTREPKKVAVVR-GGSGGS- nativeTauaminoacids(215- RGAAPPGQKGQANATR 230)-GGSGGS-nativeTauamino (SEQIDNO:30) acids(155-170) KSGDRSGYSSPGSPGTPGSR-Generic nativeTauaminoacids(190- Linker-RGAAPPGQKGQANATR 209)-GenericLinker-nativeTau (SEQIDNO:31) aminoacids(155-170) LPTPPTREPKKVAVVR-Generic nativeTauaminoacids(215- Linker-KSGDRSGYSSPGSPGTPGSR 230)-GenericLinker-nativeTau (SEQIDNO:32) aminoacids(190-209) RGAAPPGQKGQANATR-Generic nativeTauaminoacids(155- Linker-LPTPPTREPKKVAVVR 170)-GenericLinker-nativeTau (SEQIDNO:33) aminoacids(215-230) LPTPPTREPKKVAVVR-Generic nativeTauaminoacids(215- Linker-RGAAPPGQKGQANATR 230)-GenericLinker-nativeTau (SEQIDNO:34) aminoacids(155-170) GAAPPGQKGQAN-GenericLinker-R nativeTauaminoacids(156-167)- EPKKVAVVRT(PO.sub.4)PPKSPSSAK genericlinker-nativeTauamino (SEQIDNO:35) acids(221-240);aminoacidT231is phosphorylated GAAPPGQKGQAN-GenericLinker- nativeTauaminoacids(156-167)- SGDRSGYSSP genericlinker-nativeTauamino (SEQIDNO:36) acids(191-200) IPAKTPPAPKT(PO.sub.4)PPSSGEPPK- nativeTauaminoacids(171-190)- GenericLinker-SGDRSGYSSP genericlinker-nativeTauamino (SEQIDNO:37) acids(191-200);aminoacidT180is phosphorylated SGDRSGYSSP-GenericLinker- nativeTauaminoacids(191-200)- REPKKVAVVRT(PO.sub.4)PPKSPSSAK genericlinker-nativeTauamino (SEQIDNO:38) acids(221-240);aminoacidT231is phosphorylated *All amino acid numbers for the modified peptides correspond to the Tau 441 sequence.
(46) The performance of the reference standards (e.g., immunoassay reference standards) or calibrators described herein should have comparable performance to native Tau in an immunoassay. Recombinant full length Tau proteins can be purchased commercially from a number of vendors as a catalog item (Signal Chem and rPeptide). Standard methods can be used to verify the abundance of the full length protein (Smith, Krohn et al., 1985). Additionally, standard methods can be used to verify the abundance of the full length construction from truncated species using mass spectrometry techniques, such as amino acid analysis, that are well known in the field (Kanu et al., 2008).
III. Linkers
(47) Any suitable linker region can be used in the modified peptides described herein (e.g., to link two peptides or immunoreactive regions). In one embodiment, amino acids that do not aggregate are contemplated as the linker. In another embodiment, the amino acids that do not aggregate are in the form of a hydrophilic spacer. In another embodiment, a series of charged residues are used as a linker between the two immunoreactive regions. In another embodiment, any polymer with chemistry able to couple to amino acid residues is used as a linker or spacer. This polymer includes linear polymers, as well as those of known branched topology, such as dendrimers and branched co-polymers.
(48) In one embodiment, the bond between the peptide backbone and linker comprises a covalent bond, avidin-biotin complex or any other stable bond. In another embodiment, the construct does not lead to self-aggregation or nonspecific absorption to laboratory plastics, in particular polypropylene, polystyrene, polycarbonate and other laboratory plastic resins of which pipette tips, tubes, plates and other vessels that hold fluids in which the analyte of interest can be measured.
(49) Exemplary linkers include, but are not limited to, polyethylene glycol, a glutamic acid residue, a glycine residue, a serine residue, an alanine residue, a lysine residue, a lipid, a globular protein, a nucleic acid (including but not limited to DNA, RNA, and PNA), an alkyl chain, or any other linkage that adds to the stability of the two peptides of interest in the immunoassay.
(50) In one embodiment, various forms of polyethylene glycol (PEG) are used as a linker. In a particular embodiment, PEG6 is used to join two peptides. In one embodiment, the linker region comprises a PEG6 linker, e.g., having the following structure:
(51) ##STR00002##
(52) In another embodiment, the linker region comprises or has the amino acid sequence set forth in SEQ ID NO:40 (GGSGGS). In another embodiment, the linker region is a non-immunoreactive domain.
IV. Methods
(53) Provided herein are methods for generating a peptide, modified peptide, or compositions thereof, as well as methods of using the same as a reference standard or calibrator (e.g., in an immunoassay) to measure the abundance of an analyte (e.g., Tau 352, Tau 381, Tau 383, Tau 410, Tau 412, or Tau 441) in a biological sample (e.g., blood, serum, plasma, peripheral blood mononuclear cells, peripheral blood lymphocytes tissue, cerebrospinal fluid or cells). In one aspect, the invention relates to methods of measuring the clinical markers (e.g., Tau) with the reference standards of the invention using, for example, an immunoassay.
(54) An immunoassay often requires biologically specific capture reagents, such as antibodies, to capture the analytes or biomarkers of interest (e.g., Tau). Antibodies can be produced by methods well known in the art, e.g., by immunizing animals with the biomarkers as antigens. Biomarkers can be isolated from samples based on their binding characteristics. Alternatively, if the amino acid sequence of a polypeptide biomarker is known, the polypeptide can be synthesized and used to generate antibodies by methods well known in the art. Examples of biomarkers include, but are not limited to Tau peptides and phosphorylated Tau peptides.
(55) Exemplary immunoassays include, for example, sandwich immunoassays, such as ELISAs (Enzyme-Linked ImmunoSorbent Assays) or fluorescence-based immunoassays, as well as other enzyme immunoassays. In one embodiment, the immunoassay is a SELDI-based immunoassay, wherein a biospecific capture reagent for the biomarker is attached to the surface of a mass spectrometry (MS) probe, such as a pre-activated PROTEINCHIP array. The biomarker is then specifically captured on the biochip through this reagent, and the captured biomarker is detected by mass spectrometry.
(56) In another embodiment, the immunoassay is a single antibody immunoassay, often run in a competitive or competition mode for immunoreactive binding sites to measure Tau in a biological sample. For example, a single antibody specific to Tau is immobilized to a solid surface, such as a well in a microtiter plate, a bead, or other immunoassay relevant surface. The antibody can be covalently linked via many different methods, such as EDC mediated linkage of carboxyl and amine groups, or via passive absorbance or through a Protein A or Protein G interface. A Tau competitor is then generated from a Tau standard or calibrator containing the full length Tau peptide or a modified version that retains the epitope of the capture antibody. The Tau competitor is used to generate competition between the native Tau in the biological sample and the binding site (paratope) on the immobilized antibody. A paratope is a term used to describe the binding region of the antibody that recognizes the epitope or immunoreactive domain on the analyte. The Tau competitor is tagged for detection purposes. In one embodiment, the tag is an enzyme, such as horseradish peroxidase or alkaline phosphatase. In another embodiment, the tag is a fluorescein such as phycoerythrin. In yet another embodiment, the tag is another tag, such as biotin or ruthenium. In yet another embodiment, the tag is a nucleic acid such as DNA, RNA or PNA, where by detection of the antibody is quantitated using sensitive technology to detect the nucleic acid flag, such as Polymerase Chain Reaction (PCR). A single concentration of the Tau competitor is used in the assay and would be determined based on the ability to compete with the natural levels of Tau found in biological samples.
(57) In another embodiment, the immunoassay is a double sandwich immunoassay or ELISA (see, e.g.,
(58) In another aspect, the immunoassay is an intra-assay calibration system. In this approach, an immunoassay format, such as the Ortho Clinical Diagnostics VITROS system (see, e.g.,
(59) In one embodiment, the suspension array technology is the Luminex xMAP technology. Luminex xMAP technology uses latex beads that contain a ratio of two fluorescent dyes. Different bead sets are created by altering the ratio of these two dyes. The beads are mixed together to form a suspension array. The bead mixture is analyzed by an instrument that identifies each bead by the fluorescence ratio as it passes in front of a laser. These bead sets have different modifications on their surface that are used for the covalent attachment of molecules such as proteins, peptides, antibodies, etc. This allows the assay to be performed on the surface of these beads. Assays are quantitated through the incorporation of a third fluorescent label, such as phycoerythrin to a reporter antibody directed at the analyte of interest (e.g., Tau). A second laser in the instrument measures the fluorescence of this reporter label as the beads move through the instrument.
(60) In one embodiment, the method comprises: a) attaching a reference standard to at least two beads thereby forming a first bead set and a second bead set, wherein the reference standard comprises an epitope recognized by a first detection antibody and wherein each bead set comprises a different concentration of the reference standard; b) attaching a capture antibody specific to Tau to a third bead set; c) combining the bead sets together to form a suspension array; d) applying the biological sample to the suspension array whereby Tau binds to the capture antibody on the third bead set; e) adding a first detection antibody to the suspension array, wherein the first detection antibody binds the reference standard and Tau bound to the capture antibody; f) measuring a first signal from the first detection antibody bound to the reference standard in the first bead set; g) measuring a second signal from the first detection antibody bound to the reference standard in the second bead set; h) generating a standard curve based upon the first and second signals; and i) quantitating the amount of Tau in the third bead set by measuring a third signal from the first detection antibody and comparing the third signal to the first and second signal measurements on the standard curve,
wherein the reference standard comprises any one of the compositions described herein.
(61) In another embodiment, the assay is made quantitative by establishing a calibration curve. In another embodiment, quantitation is performed by making a set of Tau standards or calibrators that are either the full length Tau peptide or a modified version that retains the epitope of the capture antibody. These untagged standards or calibrators are prepared in either buffer or a biological matrix that does not contain Tau. In one embodiment, the calibration curve is established by mixing one of the concentrations of the untagged standards or calibrators with the tagged Tau competitor to the immobilized antibody. The resulting signal value from each tested concentration of untagged standard or calibrator is used to generate a standard curve; plotting the concentration of the untagged Tau standards or calibrators versus the resulting signal values. Once a standard quantitative curve is established, an assay is used to determine the levels of Tau in biological samples by mixing the tagged Tau competitor at the same fixed concentration with the biological sample. The resulting signal value is plotted on the standard curve to determine the level of Tau in the biological sample.
(62) The analyte and/or reference standard may be bound to a variety of surfaces. A surface can be any solid phase surface to which an antibody or reference standard can be immobilized by covalent linkage, passive absorbance, biotin-streptavidin or any other linkage known to one of ordinary skill in the art. For example, the surface may be a bead, plate, slides, fiber, surface plasmon resonance sensors or any solid surface.
(63) In another embodiment, the method is performed in a multi-well plate, nitrocellulose filter or on a glass slide. In another embodiment, the first and second signals are detected by fluorescence. For example, the first signal and second signal may be a signal selected from the group consisting of phycoerythrin, alexa 532, streptavidin-phycoerythrin and streptavidin-Alexa 532. In another embodiment, the signal is detected by enzymatic activity (i.e., horseradish peroxidase or alkaline phosphatase), chemiluminescence, radioactivity, infra-red emission, fluorescence resonance energy transfer (FRET) or any other method known to one of ordinary skill in the art.
V. Kits
(64) In another aspect, the invention provides a kit for conducting an immunoassay to detect a Tau peptide, wherein the kit comprise a reference standard (e.g., peptide, modified peptide, or composition) of the invention. The kits may include a label indicating the intended use of the contents of the kit (e.g., in the methods described herein). The term label includes any writing, marketing materials or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
(65) The present invention is further illustrated by the following examples which should not be construed as limiting. The entire contents of Sequence Listing, Figures and all references, patents and published patent applications cited throughout this application are expressly incorporated herein by reference.
EXAMPLES
Materials
(66) All full length recombinant Tau proteins were obtained from SignalChem (SC, cat # T08-54N)) as a 0.2 mg/mL stock in Phosphate Buffered Saline (PBS), pH 7.4 or 50 mM Tris, pH 7.5, containing 150 mM NaCl, 0.25 mM DTT, o.1 mM PMSF, 25% glycerol. All modified peptides were received as lyophilized powder and were obtained from The American Peptide Company (AP), BaChem (BC), and Anaspec (AN). These peptides were synthesized using solid phase methods known to those skilled in the art (see, for example, Barany, G. et al., Gross, E. et al., (1980); and Stewart, et al. (1984).
(67) Stability of a Tau peptide, native Tau amino acids (190-209)-(PEG)6-native Tau amino acids (215-230); (SEQ ID NO:16) was measured by storing the dissolved peptides at 2-8 C. and 20 C. and periodically measuring the signal given by the peptides in a sandwich immunoassay. As shown in
(68) Mouse anti-Tau antibodies (1A4.C3 and F11-1-1) were obtained via protein-G purification of culture supernatants produced by the relevant hybridoma cell lines. Phycoerythrin-streptavidin conjugate was obtained from Jackson Immunoresearch (West Grove, Pa.). Tween-20, 1-ethyl-3-[3 dimethylaminopropyl]carbodiimide hydrochloride (EDC), sodium azide, IgG free Bovine Serum Albumin 10 (BSA), and sodium phosphate were purchased from Sigma-Aldrich Corporation (St. Louis, Mo.). Phosphate buffered saline (PBS) was obtained from Mediatech Incorporated (Herndon, Va.). Carboxylated Luminex beads were purchased from Bio-Rad Incorporated (Hercules, Calif.). Phycoerythrin label goat anti-mouse IgG antibody was obtained from Jackson Immunoresearch (West Grove, Pa.).
Example 1
VITROS Immunoassay
(69) A schematic of a VITROS immunoassay is shown in
(70) The bound HRP conjugate was then measured by a luminescent reaction. Specifically, a reagent containing luminogenic substrates (a luminol derivative and a peracid salt) and an electron transfer agent were added to the wells. The HRP in the bound conjugate catalyzes the oxidation of the luminol derivative, producing light. The electron transfer agent (a substituted acetanilide) increases the level of light produced and prolongs its emission. The light signals were then detected on a Vitros ECiQ clinical analyzer using an enhanced chemiluminescent substrate. The raw luminescence units (ALU) measured by the instrument were fit to a 4-parameter logistic model to create a standard curve, as described below in Example 3. The amount of HRP conjugate bound is directly proportional to the concentration of Tau present. The measured concentrations of Tau in human CSF samples are shown in Table 4, as set forth below.
(71) TABLE-US-00004 TABLE 4 Tau Levels Measured in Human CSF CSF Diagnosis Vitros Tau (pg/mL) 1 AD 1440 2 AD 1057 3 AD 861 4 AD 1010 5 AD 977 6 Normal 351 7 Normal 354 8 Normal 217 9 Normal 196 10 Normal 419
(72) In a specific example, a modified Tau peptide, native Tau amino acids (190-209)-(PEG)6-native Tau amino acids (215-230); (SEQ ID NO:16)) was used as a reference standard. The standard curve generated using is described in further detail below in Example 3 and is shown in
Example 2
Intra-Assay Bead Approach
(73)
Example 3
Calibration Curve
(74) To determine the amount of Tau in a biological sample using the sandwich based assay described in Example 1, a calibration curve was created. Specifically, a calibration curve was generated by harmonizing the signal given by the modified peptide (Table 3, native Tau amino acids (190-209)-(PEG)6-native Tau amino acids (215-230)) with that given by native Tau 441 (Table 1, SEQ ID NO: 1) in a buffer matrix. Briefly, a standard curve was generated by first diluting the modified peptide into calibrator matrix at specific concentration levels within the linear range of the assay. The modified peptides are diluted to a corresponding molar equivalent of native Tau 441 while taking the percent peptide, purity, and molecular mass of the modified peptide and the purity of native Tau 441 into account. The levels of the modified peptide were then run in the immunoassay as described in Example 1, along with a separate set of native calibrator standards made with recombinant Tau 441 (Table 1, SEQ ID 1). The raw ALU values generated from the synthetic tau peptides were fit to the native Tau 441 standard curve and a concentration equivalent to Tau 441 (pg/mL) was assigned for each modified peptide level. These assigned values for the modified peptides were then plotted against ALU to generate the calibration curve. This calibration curve was then used to measure the levels of Tau in a biological fluid. A modified peptide calibration curve generated as described in Example 1 is shown in
Example 4
Epitope Mapping for Anti-Tau Antibody 9E9 by Luminex Method
(75)
(76) Peptides 9-16, as well as peptides consisting of known epitopes for commercially available antibodies (BT2, HT7, Tau 5, and Taul), were fused to luminex beads using standard amine couple chemistries. For epitope mapping, purified antibodies were incubated with the luminex bead sets and run on a Bioplex 100 instrument.
(77) As shown in
Example 5
Epitope Mapping of Anti-Tau Antibody 9E9 by Biacore
(78) Antibody 9E9 also was characterized using Biacore T100 (immobilized to the CM5 gold surface by amino coupling). 9E9 (10 g/mL in 10 Mm Sodium Acetate Buffer) was injected onto active CM5 at 1-ul/min for seven minutes to a final immobilization of 10000RU. The surface was then deactivated by passage of 1 M ethanolamine. Short 8 AA long peptides spanning the region from AA 186-199 (peptide overlay) were flowed over the chip for binding activity. Specifically, recombinant Tau 441 (positive control) (final conc. 25 nM) followed by IL-23 (negative control), and peptides 15-17 at two concentrations, 25 g/mL and 125 g/mL. The surface was regenerated by a 30 ul/min of Glycine pH 1.75. Dilutions were prepared using 1HBS-EP buffer. Data was analyzed using Biacore Evaluation software 1.0.
(79) As shown in
(80) TABLE-US-00005 SUMMARY OF SEQUENCE LISTING Amino Acid Sequence Description of Peptide/Modified Peptide Sequence (SEQ ID NO: 1) Native Tau 441 amino acid sequence (SEQ ID NO: 2) Native Tau 410 amino acid sequence (SEQ ID NO: 3) Native Tau 412 amino acid sequence (SEQ ID NO: 4) Native Tau 381 amino acid sequence (SEQ ID NO: 5) Native Tau 383 amino acid sequence (SEQ ID NO: 6) Native Tau 352 amino acid sequence (SEQ ID NO: 7) Native Tau amino acids (190-209) (SEQ ID NO: 8) Native Tau amino acids (155-170) (SEQ ID NO: 9) Native Tau amino acids (215-230) (SEQ ID NO: 10) Native Tau amino acids (180-195) (SEQ ID NO: 11) Native Tau amino acids (191-200) (SEQ ID NO: 12) Native Tau amino acids (156-167) (SEQ ID NO: 13) Native Tau amino acids (171-190) (SEQ ID NO: 14) Native Tau amino acids (221-240); amino acid T231 is phosphorylated (SEQ ID NO: 16) Native Tau amino acids (190-209)-generic-native Tau amino acids (215-230) (SEQ ID NO: 17) Native Tau amino acids (155-170)-generic-native Tau amino acids (190-209) (SEQ ID NO: 18) Native Tau amino acids (155-170)-generic-native Tau amino acids (215-230) (SEQ ID NO: 19) Native Tau amino acids (180-195) - (PEG)6-native Tau amino acids (215-230) (SEQ ID NO: 20) Native Tau amino acids (155-170)-(PEG)6-native Tau amino acids (190-209) (SEQ ID NO: 21) Native Tau amino acids (155-170)-GGSGGS-native Tau amino acids (190-209) (SEQ ID NO: 22) Native Tau amino acids (190-209)-(PEG)6-native Tau amino acids (155-170) (SEQ ID NO: 23) Native Tau amino acids (190-209)-GGSGGS-native Tau amino acids (155-170) (SEQ ID NO: 24) Native Tau amino acids (190-209)-(PEG)6-native Tau amino acids (215-230) (SEQ ID NO: 25) Native Tau amino acids (190-209)-GGSGGS-native Tau amino acids (215-230) (SEQ ID NO: 26) Native Tau amino acids (215-230)-(PEG)6-native Tau amino acids (190-209) (SEQ ID NO: 27) Native Tau amino acids (215-230)-GGSGGS-native Tau amino acids (190-209) (SEQ ID NO: 28) Native Tau amino acids (155-170)-GGSGGS-native Tau amino acids (215-230) (SEQ ID NO: 29) Native Tau amino acids (215-230)-(PEG)6-native Tau amino acids (155-170) (SEQ ID NO: 30) Native Tau amino acids (215-230)-GGSGGS-native Tau amino acids (155-170) (SEQ ID NO: 31) Native Tau amino acids (190-209)-generic-native Tau amino acids (155-170) (SEQ ID NO: 32) Native Tau amino acids (215-230)-generic-native Tau amino acids (190-209) (SEQ ID NO: 33) Native Tau amino acids (155-170)-generic-native Tau amino acids (215-230) (SEQ ID NO: 34) Native Tau amino acids (215-230)-generic-native Tau amino acids (155-170) (SEQ ID NO: 35) Native Tau amino acids (156-167)-generic linker-native Tau amino acids (221-240); amino acid T231 is phosphorylated (SEQ ID NO: 36) Native Tau amino acids (156-167)-generic linker-native Tau amino acids (191-200) (SEQ ID NO: 37) Native Tau amino acids (171-190)-generic linker-native Tau amino acids (191-200); amino acid T180 is phosphorylated (SEQ ID NO: 38) Native Tau amino acids (191-200)-generic linker-native Tau amino acids (221-240); amino acid T231 is phosphorylated (SEQ ID NO: 39) A-B)-Generic Linker-(X-Y) Generic A, B, X, Y, Linker to be specified (SEQ ID NO: 40) Peptide Linker (SEQ ID NO: 41) PEG6 Linker
REFERENCES
(81) Avila, J., J. J. Lucas, et al. (2004). Role of Tau protein in both physiological and pathological conditions. Physiol Rev 84(2): 361-384. Barany, G. et al., The Peptides: Analysis, Synthesis, BiologySpecial Methods in Peptide Synthesis Part A, Vol. 2, pp. 3-284. Friedhoff, P., M. von Bergen, et al. (2000). Structure of Tau protein and assembly into paired helical filaments. Biochim Biophys Acta 1502(1): 122-132. Goedert, M., M. G. Spillantini, et al. (1989). Multiple isoforms of human microtubule-associated protein Tau: sequences and localization in neurofibrillary tangles of Alzheimer's disease. Neuron 3(4): 519-526. Gross, E. et al., eds., Academic Press, New York, (1980); 25. Hampel, H., K. Blennow, et al. (2010). Total and phosphorylated Tau protein as biological markers of Alzheimer's disease. Exp Gerontol 45(1): 30-40. Hampel, H., R. Frank, et al. (2010). Biomarkers for Alzheimer's disease: academic, industry and regulatory perspectives. Nat Rev Drug Discov 9(7): 560-574. Hanisch, K., H. Soininen, et al. (2010). Analysis of human Tau in cerebrospinal fluid. J Proteome Res 9(3): 1476-1482. Himmler, A., D. Drechsel, et al. (1989). Tau consists of a set of proteins with repeated C-terminal microtubule-binding domains and variable N-terminal domains. Mol Cell Biol 9(4): 1381-1388. Jeganathan, S., M. von Bergen, et al. (2006). Global hairpin folding of Tau in solution. Biochemistry 45(7): 2283-2293. Johnson, G. V., P. Seubert, et al. (1997). The Tau protein in human cerebrospinal fluid in Alzheimer's disease consists of proteolytically derived fragments. J Neurochem 68(1): 430-433. Kanu et al., Ion mobility-mass spectrometry Journal of Mass Spectrometry, 43(1): 1-22 (2008). Mattsson, N. and H. Zetterberg (2009). Alzheimer's disease and CSF biomarkers: key challenges for broad clinical applications. Biomark Med 3(6): 735-737. Mattsson, N., H. Zetterberg, et al. (2009). CSF biomarkers and incipient Alzheimer disease in patients with mild cognitive impairment. JAMA 302(4): 385-393. Mukrasch, M. D., S. Bibow, et al. (2009). Structural polymorphism of 441-residue Tau at single residue resolution. PLoS Biol 7(2): e34. Portelius, E., S. F. Hansson, et al. (2008). Characterization of Tau in cerebrospinal fluid using mass spectrometry. J Proteome Res 7(5): 2114-2120. Smith, P. K., R. I. Krohn, et al. (1985). Measurement of protein using bicinchoninic acid. Anal Biochem 150(1): 76-85. Stewart, et al., Solid-Phase Peptide Synthesis, 2nd Edition, Pierce Chemical Co., Rockford, Ill. (1984)).