FELINE CALICIVIRUS VACCINE

20200338186 ยท 2020-10-29

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides new feline calicivirus vaccines, including multivalent vaccines. The present invention also provides methods of making and using the vaccines.

Claims

1. An immunogenic composition comprising an alphavirus RNA replicon particle that encodes a feline calicivirus (FCV) antigen.

2. The immunogenic composition of claim 1, wherein the FCV antigen is a capsid protein or an antigenic fragment thereof.

3. The immunogenic composition of claim 1, wherein the alphavirus RNA replicon particle is a Venezuelan Equine Encephalitis (VEE) alphavirus RNA replicon particle.

4. The immunogenic composition of claim 2, wherein the capsid protein is selected from the group consisting of an FCV F9-Like capsid protein, an antigenic fragment of the FCV F9-Like capsid protein, a virulent systemic FCV (VS-FCV) capsid protein, and an antigenic fragment of the VS-FCV capsid protein.

5. The immunogenic composition of claim 4, wherein the capsid protein is a VS-FCV capsid protein or an antigenic fragment thereof.

6. The immunogenic composition of claim 4, wherein the capsid protein is a FCV F9-Like capsid protein or an antigenic fragment thereof.

7. The immunogenic composition of claim 1, that comprises an additional alphavirus RNA replicon particle that encodes a second FCV antigen, wherein the second FCV antigen originates from a different strain of FCV than the one from which the FCV antigen originates from.

8. The immunogenic composition of claim 5, that comprises an additional alphavirus RNA replicon particle that encodes an FCV F9-Like capsid protein or an antigenic fragment thereof.

9. The immunogenic composition of claim 7, wherein the additional alphavirus RNA replicon particle is an VEE alphavirus RNA replicon particle.

10. The immunogenic composition of claim 5, wherein the alphavirus RNA replicon particle also encodes an FCV F9-Like capsid protein, or an antigenic fragment of the FCV F9-Like capsid protein.

11. The immunogenic composition of claim 5, wherein the VS-FCV capsid protein comprises an amino acid sequence comprising at least 95% identity with the amino acid sequence of SEQ ID NO: 2.

12. The immunogenic composition of claim 6, wherein the FCV F9-Like capsid protein comprises an amino acid sequence comprising at least 95% identity with the amino acid sequence of SEQ ID NO: 4.

13. A vaccine to aid in the prevention of disease due to FCV comprising the immunogenic composition of claim 4, and a pharmaceutically acceptable carrier.

14. The vaccine composition of claim 13, that further comprises at least one non-FCV antigen for eliciting protective immunity to a non-FCV feline pathogen.

15. The vaccine of claim 14, wherein the non-FCV feline pathogen is selected from the group consisting of feline herpesvirus (FHV), feline leukemia virus (FeLV), feline pneumovirus (FPN), feline parvovirus (FPV), feline infectious peritonitis virus (FIPV), feline immunodeficiency virus, borna disease virus (BDV), feline influenza virus, feline panleukopenia virus (FPLV), feline coronavirus (FCoV), feline rhinotracheitis virus (FVR), Chlamydophila felis, and any combination thereof.

16. The vaccine of claim 14, wherein the non-FCV antigen is a killed or attenuated non-FCV antigen selected from the group of killed or attenuated non-FCV antigens consisting of feline herpesvirus (FHV), feline leukemia virus (FeLV), feline pneumovirus (FPN), feline parvovirus (FPV), feline infectious peritonitis virus (FIPV), feline immunodeficiency virus, borna disease virus (BDV), feline influenza virus, feline panleukopenia virus (FPLV), feline coronavirus (FCoV), feline rhinotracheitis virus (FVR), Chlamydophila felis, and any combination thereof.

17. The vaccine of claim 16, wherein the attenuated non-FCV antigen is a modified live feline pathogen selected from the group consisting of a modified live Chlamydophila felis, a modified live feline rhinotracheitis Virus (FVR), a modified live feline leukemia virus (FeLV), a modified live feline panleukopenia virus (FPL), a modified live feline herpesvirus (FHV), a modified live feline pneumovirus (FPN), a modified live feline parvovirus (FPV), a modified live feline infectious peritonitis virus (FIPV), a modified live feline immunodeficiency virus, a modified live borna disease virus (BDV), a modified live feline coronavirus (FCoV), and a modified live feline influenza virus.

18. The vaccine composition of claim 13, that further comprises an alphavirus RNA replicon particle comprising a nucleotide sequence encoding at least one protein antigen or an antigenic fragment thereof that originates from a non-FCV antigen; wherein the protein antigen or an antigenic fragment thereof that originates from a non-FCV feline pathogen selected from the group consisting of feline herpesvirus (FHV), feline leukemia virus (FeLV), feline pneumovirus (FPN), feline parvovirus (FPV), feline infectious peritonitis virus (FIPV), feline immunodeficiency virus, borna disease virus (BDV), feline influenza virus, feline panleukopenia virus (FPLV), feline coronavirus (FCoV), feline rhinotracheitis virus (FVR), Chlamydophila felis, and any combination thereof.

19. (canceled)

20. The vaccine composition of claim 13, that is a nonadjuvanted vaccine.

21. A method of immunizing a feline against a pathogenic FCV comprising administering to the feline an immunologically effective amount of the vaccine of claim 20.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0039] The present invention provides efficacious, safe FCV vaccines. In particular embodiments the vaccine is nonadjuvanted. In one aspect, the vaccines of the present invention do not induce feline injection-site sarcomas, yet still aid in the protection of the vaccinates from the upper respiratory disease and/or limping syndrome caused by FCV infection. In a particular embodiment, the FCV capsid protein originates from a virulent systemic FCV (VS-FCV). In related embodiments, the FCV capsid protein originates from an older strain, such as an FCV F9 strain (F9-Like FCV).

[0040] Accordingly, the vaccine compositions of the present invention include an immunologically effective amount of a vector encoding an antigen from one or more strains of feline calicivirus that aids in eliciting protective immunity in the recipient vaccinated animal. Furthermore, the present invention provides new immunogenic compositions to improve the reliability of the vaccination to aid in the reduction of upper respiratory disease in cats in a feline infected by FCV and to thereby yield more transient or mild disease and/or lead to the reduction of the infection. In a particular aspect of the present invention, the vaccines comprise an alphavirus RNA replicon particle (RP) encoding an FCV capsid, e.g., originating from a VS-FCV or alternatively, a classical strain, such as an FCV F9-Like strain.

[0041] In more specific embodiments, the vaccines comprise alphavirus RNA replicon particles (RPs) that comprise the capsid protein and glycoproteins of Venezuelan Equine Encephalitis Virus (VEE) and encode the FCV capsid protein and/or an antigenic fragment thereof. In even more specific embodiments, the vaccines comprise alphavirus RNA replicon particles (RPs) that comprise the capsid protein and glycoproteins of the avirulent TC-83 strain of VEE and encode one or more FCV capsid proteins and/or one or more antigenic fragments thereof.

[0042] In another aspect of the present invention, the vaccines comprise naked DNA vectors that encode one or more FCV capsid proteins and/or one or more antigenic fragments thereof. The vaccines of the present invention can be administered to a feline in the absence of an adjuvant and still effectively aid in the protection of the vaccinated feline against FCV.

[0043] In order to more fully appreciate the invention, the following definitions are provided.

[0044] The use of singular terms for convenience in description is in no way intended to be so limiting. Thus, for example, reference to a composition comprising a polypeptide includes reference to one or more of such polypeptides. In addition, reference to an alphavirus RNA replicon particle includes reference to a plurality of such alphavirus RNA replicon particles, unless otherwise indicated.

[0045] As used herein the term approximately is used interchangeably with the term about and signifies that a value is within fifty percent of the indicated value i.e., a composition containing approximately 110.sup.8 alphavirus RNA replicon particles per milliliter contains from 0.510.sup.8 to 1.510.sup.8 alphavirus RNA replicon particles per milliliter.

[0046] As used herein, the term feline refers to any member of the Felidae family. Domestic cats, pure-bred and/or mongrel companion cats, and wild or feral cats are all felines.

[0047] As used herein, the term replicon refers to a modified RNA viral genome that lacks one or more elements (e.g., coding sequences for structural proteins) that if they were present, would enable the successful propagation of the parental virus in cell cultures or animal hosts. In suitable cellular contexts, the replicon will amplify itself and may produce one or more sub-genomic RNA species.

[0048] As used herein, the term alphavirus RNA replicon particle, abbreviated RP, is an alphavirus-derived RNA replicon packaged in structural proteins, e.g., the capsid and glycoproteins, which also are derived from an alphavirus, e.g., as described by Pushko et al., [Virology 239(2):389-401 (1997)]. An RP cannot propagate in cell cultures or animal hosts (without a helper plasmid or analogous component), because the replicon does not encode the alphavirus structural components (e.g., capsid and glycoproteins).

[0049] The terms FCV F9-Like and F9-Like FCV are used interchangeably with each other and with the term classical FCV and as used herein is an FCV that can be characterized as an older and formerly, universal vaccine strain of FCV, for which the FCV F9 strain is considered a typical representative. In direct contrast, the FCV termed virulent systemic VS-FCV or as used herein interchangeably (VS) FCV, is a newer class of FCV, which is unusually virulent, and cannot be neutralized by antibodies raised against the FCV F9-Like strains [see, U.S. Pat. No. 7,449,323; Radford et al., 38(2) Vet res. 319-335 (2007)].

[0050] The term non-FCV, is used to modify terms such as pathogen, and/or antigen (or immunogen) to signify that the respective pathogen, and/or antigen (or immunogen) is neither an FCV pathogen nor an FCV antigen (or immunogen) and that a non-FCV protein antigen (or immunogen) does not originate from an FCV.

[0051] The terms originate from, originates from and originating from are used interchangeably with respect to a given protein antigen and the pathogen or strain of that pathogen that naturally encodes it, and as used herein signify that the unmodified and/or truncated amino acid sequence of that given protein antigen is encoded by that pathogen or strain of that pathogen. The coding sequence, within a nucleic acid construct of the present invention for a protein antigen originating from a pathogen may have been genetically manipulated so as to result in a modification and/or truncation of the amino acid sequence of the expressed protein antigen relative to the corresponding sequence of that protein antigen in the pathogen or strain of pathogen (including naturally attenuated strains) it originates from.

[0052] As used herein, the terms protecting, or providing protection to, or eliciting protective immunity to, aids in prevention of disease, and aids in the protection do not require complete protection from any indication of infection. For example, aids in the protection can mean that the protection is sufficient such that, after challenge, symptoms of the underlying infection are at least reduced, and/or that one or more of the underlying cellular, physiological, or biochemical causes or mechanisms causing the symptoms are reduced and/or eliminated. It is understood that reduced, as used in this context, means relative to the state of the infection, including the molecular state of the infection, not just the physiological state of the infection.

[0053] As used herein, a vaccine is a composition that is suitable for application to an animal, e.g., feline (including, in certain embodiments, humans, while in other embodiments being specifically not for humans) comprising one or more antigens typically combined with a pharmaceutically acceptable carrier such as a liquid containing water, which upon administration to the animal induces an immune response strong enough to minimally aid in the protection from a disease arising from an infection with a wild-type micro-organism, i.e., strong enough for aiding in the prevention of the disease, and/or preventing, ameliorating or curing the disease.

[0054] As used herein, a multivalent vaccine is a vaccine that comprises two or more different antigens. In a particular embodiment of this type, the multivalent vaccine stimulates the immune system of the recipient against two or more different pathogens.

[0055] The terms adjuvant and immune stimulant are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune system. In this context, an adjuvant is used to enhance an immune response to one or more vaccine antigens/isolates. Accordingly, adjuvants are agents that nonspecifically increase an immune response to a particular antigen, thus reducing the quantity of antigen necessary in any given vaccine, and/or the frequency of injection necessary in order to generate an adequate immune response to the antigen of interest. In this context, an adjuvant is used to enhance an immune response to one or more vaccine antigens/isolates. The American Association of Feline Practitioners Feline Vaccination Guidelines, for example, suggest the use of nonadjuvanted FeLV vaccines [AAFP Feline Advisory Panel, 15: 785-808 (2013)].

[0056] As used herein, a nonadjuvanted vaccine is a vaccine or a multivalent vaccine that does not contain an adjuvant.

[0057] As used herein, the term pharmaceutically acceptable is used adjectivally to mean that the modified noun is appropriate for use in a pharmaceutical product. When it is used, for example, to describe an excipient in a pharmaceutical vaccine, it characterizes the excipient as being compatible with the other ingredients of the composition and not disadvantageously deleterious to the intended recipient animal, e.g., feline.

[0058] Parenteral administration includes subcutaneous injections, submucosal injections, intravenous injections, intramuscular injections, intradermal injections, and infusion.

[0059] As used herein the term antigenic fragment in regard to a particular protein (e.g., a protein antigen) is a fragment of that protein that is antigenic, i.e., capable of specifically interacting with an antigen recognition molecule of the immune system, such as an immunoglobulin (antibody) or T cell antigen receptor. For example, an antigenic fragment of an FCV capsid protein is a fragment of the capsid protein that is antigenic. In specific embodiments, the antigenic fragment of an FCV capsid protein comprises region E of the ORF2, which contains the major B-cell epitopes. Preferably, an antigenic fragment of the present invention is immunodominant for antibody and/or T cell receptor recognition. In particular embodiments, an antigenic fragment with respect to a given protein antigen is a fragment of that protein that retains at least 25% of the antigenicity of the full length protein. In preferred embodiments an antigenic fragment retains at least 50% of the antigenicity of the full length protein. In more preferred embodiments, an antigenic fragment retains at least 75% of the antigenicity of the full length protein. Antigenic fragments can be as small as 20 amino acids or at the other extreme, be large fragments that are missing as little as a single amino acid from the full-length protein. In particular embodiments the antigenic fragment comprises 25 to 150 amino acid residues. In other embodiments, the antigenic fragment comprises 50 to 250 amino acid residues. For FeLV, for example, the FeLV gp45 glycoprotein and the FeLV gp70 glycoprotein are antigenic fragments of the FeLV gp85 glycoprotein.

[0060] As used herein one amino acid sequence is 100% identical or has 100% identity to a second amino acid sequence when the amino acid residues of both sequences are identical. Accordingly, an amino acid sequence is 50% identical to a second amino acid sequence when 50% of the amino acid residues of the two amino acid sequences are identical. The sequence comparison is performed over a contiguous block of amino acid residues comprised by a given protein, e.g., a protein, or a portion of the polypeptide being compared. In a particular embodiment, selected deletions or insertions that could otherwise alter the correspondence between the two amino acid sequences are taken into account.

[0061] As used herein, nucleotide and amino acid sequence percent identity can be determined using C, MacVector (MacVector, Inc. Cary, N.C. 27519), Vector NTI (Informax, Inc. MD), Oxford Molecular Group PLC (1996) and the Clustal W algorithm with the alignment default parameters, and default parameters for identity. These commercially available programs can also be used to determine sequence similarity using the same or analogous default parameters. Alternatively, an Advanced Blast search under the default filter conditions can be used, e.g., using the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.) pileup program using the default parameters.

[0062] As used herein, the term inactivated microorganism is used interchangeably with the term killed microorganism. For the purposes of this invention, an inactivated microorganism is an organism which is capable of eliciting an immune response in an animal, but is not capable of infecting the animal. An antigen of the present invention (e.g., an inactivated feline calicivirus) may be inactivated by an agent selected from the group consisting of binary ethyleneimine, formalin, beta-propiolactone, thimerosal, or heat. In a particular embodiment, inactivated feline calicivirus isolates combined with an RP of the present invention are inactivated by binary ethyleneimine.

[0063] The alphavirus RNA replicon particles of the present invention may be lyophilized and rehydrated with a sterile water diluent. On the other hand, when the alphavirus RNA replicon particles are stored separately, but intended to be mixed with other vaccine components prior to administration, the alphavirus RNA replicon particles can be stored in the stabilizing solution of those components, e.g., a high sucrose solution.

[0064] A vaccine of the present invention can be readily administered by any standard route including intravenous, intramuscular, subcutaneous, oral, intranasal, intradermal, and/or intraperitoneal vaccination. The skilled artisan will appreciate that the vaccine composition is preferably formulated appropriately for each type of recipient animal and route of administration.

[0065] Thus, the present invention also provides methods of immunizing a feline against FCV and/or other feline pathogens. One such method comprises injecting a feline with an immunologically effective amount of a vaccine of the present invention, so that the feline produces appropriate FCV antibodies.

Multivalent Vaccines:

[0066] The present invention also provides multivalent vaccines. For example, the coding sequence of a protein antigen or antigenic fragment thereof, or combination of such coding sequences of protein antigens useful in a feline vaccine can be added to an alphavirus RNA replicon particle (RP) or combined in the same RP as one that encodes a feline antigen of the FCV [e.g., the FCV capsid protein] in the vaccine. In specific embodiments, the alphavirus RNA replicon particle encodes both the FCV F9-Like capsid protein or an antigenic fragment thereof and the VS-FCV capsid protein or an antigenic fragment thereof and encodes a non-FCV antigen. Accordingly, such multivalent vaccines are included in the present invention.

[0067] Examples of pathogens that one or more of such protein antigens can originate from include feline rhinotracheitis Virus (FVR), feline leukemia virus (FeLV), feline panleukopenia Virus (FPL) feline herpesvirus (FHV), other FCV strains, feline parvovirus (FPV), feline infectious peritonitis virus (FIPV), feline immunodeficiency virus, borna disease virus (BDV), rabies virus, feline influenza virus, canine influenza virus, avian influenza, canine pneumovirus, feline pneumovirus, Chlamydophila felis (FKA Chlamydia psittaci), Bordetella bronchiseptica, and Bartonella spp. (e.g., B. henselae). In particular embodiments, a coding sequence for a capsid protein or analogous protein from one or more of these feline or canine pathogens can be inserted into the same RP as the FCV antigen. Alternatively, or in combination therewith, a coding sequence for a capsid protein or analogous protein from one or more of these feline or canine pathogens can be inserted into one or more other RPs, which can be combined in a vaccine with an RP that encodes the FCV F9-Like capsid protein or an antigenic fragment thereof and/or the VS-FCV capsid protein or an antigenic fragment thereof.

[0068] In addition, an alphavirus RNA replicon particle (RP) that encodes one or more antigens of the FCV [e.g., the FCV F9-Like capsid protein or an antigenic fragment thereof and/or the VS-FCV capsid protein or an antigenic fragment thereof] can be added together with one or more other live, attenuated virus isolates, e.g., a live attenuated FCV F9-Like virus (e.g., modified live FCV F9) and/or a live attenuated feline herpesvirus and/or a live attenuated feline parvovirus and/or a live, attenuated feline leukemia virus, and/or a live, attenuated feline infectious peritonitis virus and/or a live, attenuated feline immunodeficiency virus and/or a live, attenuated borna disease virus and/or a live, attenuated rabies virus, and/or a live, attenuated feline influenza virus and/or a live, attenuated canine influenza virus, and/or a live, attenuated avian influenza, and/or a live, attenuated canine pneumovirus, and/or a live, attenuated feline pneumovirus. In addition, a live, attenuated Chlamydophila felis, and/or a live, attenuated Bordetella bronchiseptica and/or a live, attenuated Bartonella spp. (e.g., B. henselae) can also be included in such multivalent vaccines.

[0069] Furthermore, an alphavirus RNA replicon particle (RP) that encodes one or more antigens of the FCV [e.g., the FCV F9-Like capsid protein or an antigenic fragment thereof and/or the VS-FCV capsid protein or an antigenic fragment thereof] can be added together with one or more other killed virus isolates such as a killed FCV strain, and/or a killed feline herpesvirus and/or a killed feline parvovirus and/or a killed feline leukemia virus, and/or a killed feline infectious peritonitis virus and/or a killed feline immunodeficiency virus and/or a killed borna disease virus and/or a killed rabies virus, and/or a killed feline influenza virus and/or a killed canine influenza virus, and/or a killed avian influenza virus, and/or a killed canine pneumovirus, and/or a killed feline pneumovirus. In addition, bacterins (or subfractions of the bacterins, e.g., the pilus subfraction) of Chlamydophila felis, and/or Bordetella bronchiseptica and/or Bartonella spp. (e.g., B. henselae) can also be included in such multivalent vaccines.

[0070] It also is to be understood that this invention is not limited to the particular configurations, process steps, and materials disclosed herein as such configurations, process steps, and materials may vary somewhat. It further is to be understood that the terminology employed herein is used for the purpose of describing particular embodiments only and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims and equivalents thereof.

TABLE-US-00001 SEQUENCETABLE SEQID NO: Description Type 1 FelineCalicivirus(VS-FCV) nucleicacid DNA 2 FelineCalicivirus(VS-FCV) aminoacid 3 FelineCalicivirus(F9-like) nucleicacid DNA 4 FelineCalicivirus(F9-like) aminoacid 5 FeLVviralglycoprotein nucleicacid (gp85) DNA 6 FeLVviralglycoprotein aminoacid (gp85) 7 FeLVviralglycoprotein nucleicacid (gp70) DNA 8 FeLVviralglycoprotein aminoacid (gp70) 9 RabiesvirusGlycoprotein nucleicacid DNA 10 RabiesvirusGlycoprotein aminoacid 11 GGCGCGCCGCACC nucleicacid 12 FelineCalicivirus(VS-FCV) nucleicacid RNA 13 FelineCalicivirus(F9-like) nucleicacid RNA 14 FeLVviralglycoprotein nucleicacid (gp85) RNA 15 FeLVviralglycoprotein nucleicacid (gp70) RNA 16 RabiesvirusGlycoprotein nucleicacid RNA TTAATTAA nucleicacid

TABLE-US-00002 SEQUENCES FelineCaliciviruscapsid(VS-FCV) SEQIDNO:1 atggctgacgacggatctgtgaccaccccagaacaaggaacaatggtcggaggagtgatt gccgaacccagcgctcagatgtcaactgcggcggacatggcctccggaaagtcggtggac tccgagtgggaagccttcttctcgttccacacgtccgtgaactggagcacctccgaaacc caaggaaagatcctcttcaagcagtccctgggtcccctgctgaacccgtacctggagcac atcagcaagctgtacgtcgcttggagcgggtcgatcgaagtgcgattttccatctcggga agcggcgtgttcggtggtaaactggccgccatcgtcgtgccgcctggtgtcgaccctgtc cagtcaacctccatgctgcagtacccgcacgtcctgttcgacgcaagacaagtggagcca gtgatcttctccatcccggacctccgcaacagcctgtatcacttgatgtccgataccgat accacttccctcgtgatcatggtgtacaacgatctgatcaacccgtacgccaatgactcc aacagctcgggttgcatcgtgaccgtcgaaacgaagcctggcatcgatttcaagtttcat ctgctgaaaccgcccggatccatgcttactcacgggtccatcccttccgatctgatcccc aagagctcctccctgtggattgggaaccgccactggaccgatattaccgatttcgtgatt cggcctttcgtgttccaagccaaccggcacttcgacttcaaccaggagactgccggctgg tcaactccacggttccgcccattggccgtgactgtgtcgcagtcaaagggagccaagctc gggaacggcatcgccaccgactacattgtgcctggaatccccgacggatggcctgatact accatccccaccaagctgacccctaccggagattacgccatcacctcctccgacggcaat gatattgaaaccaagctggaatacgagaacgcggacgtgattaagaacaacaccaacttc cgctccatgtatatctgcggaagcctccagagggcttggggcgacaagaagatcagcaac accgggttcatcactaccggagtgatttctgacaactccatcagcccttcgaacacaatt gaccagtccaagatcgtggtgtaccaggacaaccatgtcaattcggaggtccagactagc gacatcactcttgccatcctgggctacaccggaattggagaagaggccataggcgccaac cgggactccgtcgtgagaatttccgtgcttccggaaactggagcaaggggcggaaatcac cccatcttctacaaaaattccatgaagctgggctacgtgatctcctccattgacgtgttc aactcccaaatcctccacacctcgcgccagctgtcactgaacaactacttgttgccccct gactccttcgcggtgtaccggattattgacagcaacggatcatggttcgacattgggatt gacagcgatgggttttcattcgtgggcgtgtcgtcatttccaaagctggagtttccgctg tccgcctcatacatgggcatccagctcgcaaagatccggctggcgtccaacatccggtca tccatgactaagctgtga FelineCaliciviruscapsid(VS-FCV) SEQIDNO:2 MADDGSVTTPEQGTMVGGVIAEPSAQMSTAADMASGKSVDSEWEAFFSFHTSVNWSTSET QGKILFKQSLGPLLNPYLEHISKLYVAWSGSIEVRFSISGSGVFGGKLAAIWPPGVDPV QSTSMLQYPHVLFDARQVEPVIFSIPDLRNSLYHLMSDTDTTSLVIMVYNDLINPYANDS NSSGCIVTVETKPGIDFKFHLLKPPGSMLTHGSIPSDLIPKSSSLWIGNRHWTDITDFVI RPFVFQANRHFDFNQETAGWSTPRFRPLAVTVSQSKGAKLGNGIATDYIVPGIPDGWPDT TIPTKLTPTGDYAITSSDGNDIETKLEYENADVIKNNTNFRSMYICGSLQRAWGDKKISN TGFITTGVISDNSISPSNTIDQSKIWYQDNHVNSEVQTSDITLAILGYTGIGEEAIGAN RDSWRISVLPETGARGGNHPIFYKNSMKLGYVISSIDVFNSQILHTSRQLSLNNYLLPP DSFAVYRIIDSNGSWFDIGIDSDGFSFVGVSSFPKLEFPLSASYMGIQLAKIRLASNIRS SMTKL FelineCalicivirus(VS-FCV)capsid (SEQIDNO:12) auggcugacgacggaucugugaccaccccagaacaaggaacaauggucggaggagugauu gccgaacccagcgcucagaugucaacugcggcggacauggccuccggaaagucgguggac uccgagugggaagccuucuucucguuccacacguccgugaacuggagcaccuccgaaacc caaggaaagauccucuucaagcagucccuggguccccugcugaacccguaccuggagcac aucagcaagcuguacgucgcuuggagcgggucgaucgaagugcgauuuuccaucucggga agcggcguguucggugguaaacuggccgccaucgucgugccgccuggugucgacccuguc cagucaaccuccaugcugcaguacccgcacguccuguucgacgcaagacaaguggagcca gugaucuucuccaucccggaccuccgcaacagccuguaucacuugauguccgauaccgau accacuucccucgugaucaugguguacaacgaucugaucaacccguacgccaaugacucc aacagcucggguugcaucgugaccgucgaaacgaagccuggcaucgauuucaaguuucau cugcugaaaccgcccggauccaugcuuacucacggguccaucccuuccgaucugaucccc aagagcuccucccuguggauugggaaccgccacuggaccgauauuaccgauuucgugauu cggccuuucguguuccaagccaaccggcacuucgacuucaaccaggagacugccggcugg ucaacuccacgguuccgcccauuggccgugacugugucgcagucaaagggagccaagcuc gggaacggcaucgccaccgacuacauugugccuggaauccccgacggauggccugauacu accauccccaccaagcugaccccuaccggagauuacgccaucaccuccuccgacggcaau gauauugaaaccaagcuggaauacgagaacgcggacgugauuaagaacaacaccaacuuc cgcuccauguauaucugcggaagccuccagagggcuuggggcgacaagaagaucagcaac accggguucaucacuaccggagugauuucugacaacuccaucagcccuucgaacacaauu gaccaguccaagaucgugguguaccaggacaaccaugucaauucggagguccagacuagc gacaucacucuugccauccugggcuacaccggaauuggagaagaggccauaggcgccaac cgggacuccgucgugagaauuuccgugcuuccggaaacuggagcaaggggcggaaaucac cccaucuucuacaaaaauuccaugaagcugggcuacgugaucuccuccauugacguguuc aacucccaaauccuccacaccucgcgccagcugucacugaacaacuacuuguugcccccu gacuccuucgcgguguaccggauuauugacagcaacggaucaugguucgacauugggauu gacagcgauggguuuucauucgugggcgugucgucauuuccaaagcuggaguuuccgcug uccgccucauacaugggcauccagcucgcaaagauccggcuggcguccaacauccgguca uccaugacuaagcuguga FelineCalicivirus(F9-like)capsid (SEQIDNO:3) atgactgccccggaacaaggaacgatggtcggaggagtgattgcagaaccgtcagcacag atgtccaccgctgccgacatggccactggaaagagcgtggactccgaatgggaagccttc ttctccttccacacttcggtcaactggtcgactagcgaaacccaggggaagattttgttc aagcaatccctcggccctctgctgaacccctacctggagcatctggccaagctgtacgtg gcatggtcgggcagcatcgaagtgcgctttagcatttccggctccggagtgttcggggga aagcttgctgccattgtcgtgccgccaggagtggacccggtgcagtccacttctatgctc caatacccgcatgtcctgttcgacgccagacaggtggagcctgtgatcttttgcctgccg gatctcaggtccaccctgtatcacctcatgtccgacaccgacaccacctcgctcgtgatc atggtgtacaacgacctgatcaacccctacgctaacgacgccaacagctcaggttgcatt gtgactgtcgaaaccaagccaggccctgacttcaagtttcatttgctgaagccgcccggt tccatgctgacccacggctcgatcccatccgacctgatccccaagacgagctccctgtgg atcggaaaccgctactggtccgatattaccgacttcgtgatcagaccattcgtgttccaa gccaaccgccatttcgacttcaaccaggaaaccgcaggatggtcgacccctcgattccgc ccgatttcagtgaccatcaccgaacagaacggcgcgaagctgggaattggcgtggcgacc gactacatcgtgccgggaatcccggatggatggcctgatacgaccattcccggggagctg atccctgccggggactacgccatcaccaacggtactggaaacgacatcaccactgccacc ggttacgacaccgccgacatcataaagaacaacaccaacttcagaggaatgtacatttgc ggctccctgcaacgcgcttggggtgacaaaaagatctcgaacactgccttcatcacaaca gcgactctggacggcgataacaacaacaagatcaatccttgtaataccatcgaccagtcc aaaatcgtggtgttccaggataaccacgtgggaaagaaggcgcagacctccgacgacact ctggcgctgcttggctacaccgggatcggcgagcaggccattggaagcgatcgggatcgg gtcgtgcggatctccaccctccccgagactggagcaaggggaggcaaccaccccatcttt tacaaaaacagcattaagctcggatacgtcatccgctccatcgatgtgttcaactctcaa atcctgcacacttcgcggcagctgtccctgaaccactacctcttgccgcccgactccttc gccgtctaccggatcattgattcgaacgggagctggttcgacatcggcattgatagcgat ggcttctcgtttgtgggcgtgtcgggcttcgggaagctggagttcccactgagcgcctca tacatgggtatccagctggccaagatcaggctggcctccaacatccgctcacctatgact aagctgtga FelineCalicivirus(F9-like)capsid (SEQIDNO:4) MTAPEQGTMVGGVIAEPSAQMSTAADMATGKSVDSEWEAFFSFHTSVNWSTSETQGKILF KQSLGPLLNPYLEHLAKLYVAWSGSIEVRFSISGSGVFGGKLAAIWPPGVDPVQSTSML QYPHVLFDAPQVEPVIFCLPDLRSTLYHLMSDTDTTSLVIMVYNDLINPYANDANSSGCI VTVETKPGPDFKFHLLKPPGSMLTHGSIPSDLIPKTSSLWIGNRYWSDITDFVIRPFVFQ ANRHFDFNQETAGWSTPRFRPISVTITEQNGAKLGIGVATDYIVPGIPDGWPDTTIPGEL IPAGDYAITNGTGNDITTATGYDTADIIKNNTNFRGMYICGSLQRAWGDKKISNTAFITT ATLDGDNNNKINPCNTIDQSKIWFQDNHVGKKAQTSDDTLALLGYTGIGEQAIGSDRDR WRISTLPETGARGGNHPIFYKNSIKLGYVIRSIDVFNSQILHTSRQLSLNHYLLPPDSF AVYRIIDSNGSWFDIGIDSDGFSFVGVSGFGKLEFPLSASYMGIQLAKIRLASNIRSPMT KL FelineCalicivirus(F9-like)capsid (SEQIDNO:13) augacugccccggaacaaggaacgauggucggaggagugauugcagaaccgucagcacag auguccaccgcugccgacauggccacuggaaagagcguggacuccgaaugggaagccuuc uucuccuuccacacuucggucaacuggucgacuagcgaaacccaggggaagauuuuguuc aagcaaucccucggcccucugcugaaccccuaccuggagcaucuggccaagcuguacgug gcauggucgggcagcaucgaagugcgcuuuagcauuuccggcuccggaguguucggggga aagcuugcugccauugucgugccgccaggaguggacccggugcaguccacuucuaugcuc caauacccgcauguccuguucgacgccagacagguggagccugugaucuuuugccugccg gaucucagguccacccuguaucaccucauguccgacaccgacaccaccucgcucgugauc augguguacaacgaccugaucaaccccuacgcuaacgacgccaacagcucagguugcauu gugacugucgaaaccaagccaggcccugacuucaaguuucauuugcugaagccgcccggu uccaugcugacccacggcucgaucccauccgaccugauccccaagacgagcucccugugg aucggaaaccgcuacugguccgauauuaccgacuucgugaucagaccauucguguuccaa gccaaccgccauuucgacuucaaccaggaaaccgcaggauggucgaccccucgauuccgc ccgauuucagugaccaucaccgaacagaacggcgcgaagcugggaauuggcguggcgacc gacuacaucgugccgggaaucccggauggauggccugauacgaccauucccggggagcug aucccugccggggacuacgccaucaccaacgguacuggaaacgacaucaccacugccacc gguuacgacaccgccgacaucauaaagaacaacaccaacuucagaggaauguacauuugc ggcucccugcaacgcgcuuggggugacaaaaagaucucgaacacugccuucaucacaaca gcgacucuggacggcgauaacaacaacaagaucaauccuuguaauaccaucgaccagucc aaaaucgugguguuccaggauaaccacgugggaaagaaggcgcagaccuccgacgacacu cuggcgcugcuuggcuacaccgggaucggcgagcaggccauuggaagcgaucgggaucgg gucgugcggaucuccacccuccccgagacuggagcaaggggaggcaaccaccccaucuuu uacaaaaacagcauuaagcucggauacgucauccgcuccaucgauguguucaacucucaa auccugcacacuucgcggcagcugucccugaaccacuaccucuugccgcccgacuccuuc gccgucuaccggaucauugauucgaacgggagcugguucgacaucggcauugauagcgau ggcuucucguuugugggcgugucgggcuucgggaagcuggaguucccacugagcgccuca uacauggguauccagcuggccaagaucaggcuggccuccaacauccgcucaccuaugacu aagcuguga FelineLeukemiaVirusenvelopeglycoprotein(gp85) SEQIDNO:5 atggagtcaccaacacaccctaaaccttctaaagacaaaaccctctcgtggaatctcgccttccttgt gggcatcctgttcacaatcgacatcggcatggccaacccttcgccgcatcagatctacaatgtgacat gggtcattactaatgtgcagacaaacacccaggcaaatgctacttctatgcttggtactctgactgat gcttatccaaccctgcacgtcgacctttgcgatctcgtcggtgacacatgggagcccatcgtgctgaa tccaactaatgtcaaacatggtgccaggtattcttctagcaaatacgggtgtaagaccactgatcgga agaaacagcaacaaacctacccattctacgtgtgcccgggtcacgcaccgtccctgggtccgaaggga acacattgtgggggagcccaagacggtttttgcgctgcttggggttgtgaaacaaccggagaagcctg gtggaagcctacctcatcttgggactacattactgtgaaaagaggctctagccaggataacagctgcg aaggaaagtgtaatcccctggtgcttcaattcacccagaaaggccggcaggcatcatgggatggaccg aaaatgtggggacttagactctatcgcaccggatacgaccccatcgctctgtttactgtgtcacgcca agtctccaccattactccgccacaggccatggggccgaatctggtcctccccgatcagaagccaccct cacggcaaagtcaaaccggctcaaaagtggccacccaacggccccagacaaatgagtccgcacctagg tcagtggcacctacaacaatgggtccaaagcggatcggaaccggagacaggctcattaacctcgtgca agggacttatctggcccttaacgctactgaccccaacaagaccaaggattgctggctctgccttgtga gcagacctccttactatgaggggatcgccattctcggaaactactcaaatcagaccaacccccctccg tcgtgtctgagcaccccccagcacaagcttactatttcagaagtcagtggacagggaatgtgcatcgg aaccgtgccaaagactcatcaagccctttgcaacaaaactcaacaagggcacactggagctcattatc tcgccgcacctaacgggacctactgggcttgcaatactggattgaccccgtgtatctctatggccgtg ctgaattggacttccgacttctgcgtgcttattgagctttggcctagagtgacataccatcagcctga gtacgtctatacccatttcgccaaggcagtcagattccggcgggagcctatctccctgactgtggcct tgatgctcggtggactgacagtgggaggaattgcagctggagtcggaactggaaccaaggccctgctc gaaactgctcagttccggcagctgcagatggccatgcacactgacatccaggctctggaggaatcaat ttcagcccttgagaaaagcttgacctcgctgtctgaagtggtcctccaaaacaggcgcggtttggaca tcctgttccttcaagagggtggtctgtgcgccgctctcaaggaggaatgctgtttctacgctgaccat accgggctggtgcgcgataacatggcaaagctgcgggaacgcttgaaacagaggcagcaactgttcga ctctcagcagggatggttcgagggctggtttaacaagagcccatggtttaccactctgatctcttcaa tcatgggtccactgctcatcctgcttctgattcttctcttcggaccgtgtattctcaacaggctggtg cagtttgtcaaggacagaatctcggtggtccaggccctgattcttactcagcagtatcagcagattaa gcagtacgaccccgatcggccttga FelineLeukemiaVirusenvelopeglycoprotein(gp85) SEQIDNO:6 MESPTHPKPSKDKTLSWNLAFLVGILFTIDIGMANPSPHQIYNVTWVITNVQTNTQANAT SMLGTLTDAYPTLHVDLCDLVGDTWEPIVLNPTNVKHGARYSSSKYGCKTTDRKKQQQTY PFYVCPGHAPSLGPKGTHCGGAQCGFCAAWGCETTGEAWWKPTSSWDYITVKRGSSQDNS CEGKCNPLVLQFTQKGRQASWDGPKMWGLRLYRTGYDPIALFTVSRQVSTITPPQAMGPN LVLPDQKPPSRQSQTGSKVATQRPQTNESAPRSVAPTTMGPKRIGTGDRLINLVQGTYLA LNATDPNKTKDCWLCLVSRPPYYEGIAILGNYSNQTNPPPSCLSTPQHKLTISEVSGQGM CIGTVPKTHQALCNKTQQGHTGAHYLAAPNGTYWACNTGLTPCISMAVLNWTSDFCVLIE LWPRVTYHQPEYVYTHFAKAVRFRREPISLTVALMLGGLTVGGIAAGVGTGTKALLETAQ FRQLQMAMHTDIQALEESISALEKSLTSLSEWLQNRRGLDILFLQEGGLCAALKEECCF YADHTGLVRDNMAKLRERLKQRQQLFDSQQGWFEGWFNKSPWFTTLISSIMGPLLILLLI LLFGPCILNRLVQFVKDRISWQALILTQQYQQIKQYDPDRP* FelineLeukemiaVirusenvelopeglycoprotein(gp85) SEQIDNO:14 auggagucaccaacacacccuaaaccuucuaaagacaaaacccucucguggaaucucgccuuccuugu gggcauccuguucacaaucgacaucggcauggccaacccuucgccgcaucagaucuacaaugugacau gggucauuacuaaugugcagacaaacacccaggcaaaugcuacuucuaugcuugguacucugacugau gcuuauccaacccugcacgucgaccuuugcgaucucgucggugacacaugggagcccaucgugcugaa uccaacuaaugucaaacauggugccagguauucuucuagcaaauacggguguaagaccacugaucgga agaaacagcaacaaaccuacccauucuacgugugcccgggucacgcaccgucccuggguccgaaggga acacauugugggggagcccaagacgguuuuugcgcugcuugggguugugaaacaaccggagaagccug guggaagccuaccucaucuugggacuacauuacugugaaaagaggcucuagccaggauaacagcugcg aaggaaaguguaauccccuggugcuucaauucacccagaaaggccggcaggcaucaugggauggaccg aaaauguggggacuuagacucuaucgcaccggauacgaccccaucgcucuguuuacugugucacgcca agucuccaccauuacuccgccacaggccauggggccgaaucugguccuccccgaucagaagccacccu cacggcaaagucaaaccggcucaaaaguggccacccaacggccccagacaaaugaguccgcaccuagg ucaguggcaccuacaacaauggguccaaagcggaucggaaccggagacaggcucauuaaccucgugca agggacuuaucuggcccuuaacgcuacugaccccaacaagaccaaggauugcuggcucugccuuguga gcagaccuccuuacuaugaggggaucgccauucucggaaacuacucaaaucagaccaaccccccuccg ucgugucugagcaccccccagcacaagcuuacuauuucagaagucaguggacagggaaugugcaucgg aaccgugccaaagacucaucaagcccuuugcaacaaaacucaacaagggcacacuggagcucauuauc ucgccgcaccuaacgggaccuacugggcuugcaauacuggauugaccccguguaucucuauggccgug cugaauuggacuuccgacuucugcgugcuuauugagcuuuggccuagagugacauaccaucagccuga guacgucuauacccauuucgccaaggcagucagauuccggcgggagccuaucucccugacuguggccu ugaugcucgguggacugacagugggaggaauugcagcuggagucggaacuggaaccaaggcccugcuc gaaacugcucaguuccggcagcugcagauggccaugcacacugacauccaggcucuggaggaaucaau uucagcccuugagaaaagcuugaccucgcugucugaagugguccuccaaaacaggcgcgguuuggaca uccuguuccuucaagaggguggucugugcgccgcucucaaggaggaaugcuguuucuacgcugaccau accgggcuggugcgcgauaacauggcaaagcugcgggaacgcuugaaacagaggcagcaacuguucga cucucagcagggaugguucgagggcugguuuaacaagagcccaugguuuaccacucugaucucuucaa ucauggguccacugcucauccugcuucugauucuucucuucggaccguguauucucaacaggcuggug caguuugucaaggacagaaucucggugguccaggcccugauucuuacucagcaguaucagcagauuaa gcaguacgaccccgaucggccuuga FelineLeukemiaVirusenvelopeglycoprotein(gp70) SEQIDNO:7 aatcctagtccacaccaaatatataatgtaacttgggtaataaccaatgtacaaactaacacc caagctaacgccacctctatgttaggaaccttaaccgatgcctaccctaccctacatgttgac ttatgtgacctagtgggagacacctgggaacctatagtcctaaacccaaccaatgtaaaacac ggggcacgttactcctcctcaaaatatggatgtaaaactacagatagaaaaaaacagcaacag acataccccttttacgtctgccccggacatgccccctcgttggggccaaagggaacacattgt ggaggggcacaagatgggttttgtgccgcatggggatgtgagaccaccggagaagcttggtgg aagcccacctcctcatgggactatatcacagtaaaaagagggagtagtcaggacaatagctgt gagggaaaatgcaaccccctggttttgcagttcacccagaagggaagacaagcctcttgggac ggacctaagatgtggggattgcgactataccgtacaggatatgaccctatcgctttattcacg gtgtcccggcaggtatcaaccattacgccgcctcaggcaatgggaccaaacctagtcttacct gatcaaaaacccccatcccgacaatctcaaacagggtccaaagtggcgacccagaggccccaa acgaatgaaagcgccccaaggtctgttgcccccaccaccatgggtcccaaacggattgggacc ggagataggttaataaatttagtacaagggacatacctagccttaaatgccaccgaccccaac aaaactaaagactgttggctctgcctggtttctcgaccaccctattacgaagggattgcaatc ttaggtaactacagcaaccaaacaaacccccccccatcctgcctatctactccgcaacacaaa ctaactatatctgaagtatcagggcaaggaatgtgcatagggactgttcctaaaacccaccag gctttgtgcaataagacacaacagggacatacaggggcgcactatctagccgcccccaacggc acctattgggcctgtaacactggactcaccccatgcatttccatggcggtgctcaattggacc tctgatttttgtgtcttaatcgaattatggcccagagtgacttaccatcaacccgaatatgtg tacacacattttgccaaagctgtcaggttccgaaga FelineLeukemiaVirusenvelopeglycoprotein(gp70) SEQIDNO:8 NPSPHQIYNVTWVITNVQTNTQANATSMLGTLTDAYPTLHVDLCDLVGDTWEPIVLNPTNVKH16850866 KYGCKTTDRKKQQQTYPFYVCPGHAPSLGPKGTHCGGAQDGFCAAWGCETTGEAWWKPTSSWDYITVKRG SSQDNSCEGKCNPLVLQFTQKGRQASWDGPKMWGLRLYRTGYDPIALFTVSRQVSTITPPQAMGPNLVLP DQKPPSRQSQTGSKVATQRPQTNESAPRSVAPTTMGPKRIGTGDRLINLVQGTYLALNATDPNKTKDCWL CLVSRPPYYEGIAILGNYSNQTNPPPSCLSTPQHKLTISEVSGQGMCIGTVPKTHQALCNKTQQGHTGAH YLAAPNGTYWACNTGLTPCISMAVLNWTSDFCVLIELWPRVTYHQPEYVYTHFAKAVRFRR FelineLeukemiaVirusenvelopeglycoprotein(gp70) SEQIDNO:15 aauccuaguccacaccaaauauauaauguaacuuggguaauaaccaauguacaaacuaacacc caagcuaacgccaccucuauguuaggaaccuuaaccgaugccuacccuacccuacauguugac uuaugugaccuagugggagacaccugggaaccuauaguccuaaacccaaccaauguaaaacac ggggcacguuacuccuccucaaaauauggauguaaaacuacagauagaaaaaaacagcaacag acauaccccuuuuacgucugccccggacaugcccccucguuggggccaaagggaacacauugu ggaggggcacaagauggguuuugugccgcauggggaugugagaccaccggagaagcuuggugg aagcccaccuccucaugggacuauaucacaguaaaaagagggaguagucaggacaauagcugu gagggaaaaugcaacccccugguuuugcaguucacccagaagggaagacaagccucuugggac ggaccuaagauguggggauugcgacuauaccguacaggauaugacccuaucgcuuuauucacg gugucccggcagguaucaaccauuacgccgccucaggcaaugggaccaaaccuagucuuaccu gaucaaaaacccccaucccgacaaucucaaacaggguccaaaguggcgacccagaggccccaa acgaaugaaagcgccccaaggucuguugcccccaccaccaugggucccaaacggauugggacc ggagauagguuaauaaauuuaguacaagggacauaccuagccuuaaaugccaccgaccccaac aaaacuaaagacuguuggcucugccugguuucucgaccacccuauuacgaagggauugcaauc uuagguaacuacagcaaccaaacaaacccccccccauccugccuaucuacuccgcaacacaaa cuaacuauaucugaaguaucagggcaaggaaugugcauagggacuguuccuaaaacccaccag gcuuugugcaauaagacacaacagggacauacaggggcgcacuaucuagccgcccccaacggc accuauugggccuguaacacuggacucaccccaugcauuuccauggcggugcucaauuggacc ucugauuuuugugucuuaaucgaauuauggcccagagugacuuaccaucaacccgaauaugug uacacacauuuugccaaagcugucagguuccgaaga RABIESVIRUSG (SEQIDNO:9) atggtgccgcaggctctcctgtttgtcccccttctggtctttccattgtgttttgggaaattccctat ctacacaattccggacaagttgggaccctggagcccaattgacattcatcatctcagctgcccgaaca atttggtcgtggaggacgaaggatgcaccaacctgtcggggttctcctacatggaattgaaagtcgga tacatcagtgccattaagatgaacgggttcacttgcacaggcgtcgtgactgaagctgagacatacac taacttcgtgggatatgtcactaccactttcaaaagaaagcatttccgccctactcctgatgcttgta gggccgcatacaactggaagatggccggtgaccccagatatgaggaatcacttcacaatccgtaccct gactaccactggcttcggactgtcaaaaccaccaaggagtcactcgtgatcattagtccaagtgtggc tgatcttgacccatacgaccggtcacttcactcacgggtgttcccgggggggaattgctctggtgtcg cagtgtcgtcaacctactgctccacaaaccacgattacaccatttggatgccagaaaatcctcggctt ggtatgtcatgtgacattttcaccaattctcgggggaagagggcttccaaagggtctgaaacttgcgg ctttgtcgatgagcggggcttgtataagtcacttaaaggtgcttgcaaactcaagctttgtggtgtct tgggattgagattgatggatggaacttgggtcgcaatgcagacttctaacgaaaccaaatggtgccct cccggacagcttgtgaatttgcatgactttcgctctgacgaaattgagcatcttgtcgtcgaggagtt ggtcaagaagcgggaagagtgtctggatgctttggaatcaatcatgaccaccaagtcagtgtctttca gacggctctcacatcttaggaaattggtgccaggttttggaaaagcatataccattttcaacaagacc cttatggaagccgatgctcactacaagtctgtcaggacttggaatgagatcatcccgtctaaagggtg tcttagggtcggagggagatgtcatcctcatgtcaacggagtctttttcaatggtatcattcttggac ctgacggaaatgtccttatccctgagatgcaatcttccctcctccagcaacacatggaacttcttgtc tcatcggtcatcccccttatgcaccccctggctgacccatcaaccgtgttcaagaacggtgacgaggc agaggattttgtcgaggtccaccttcccgatgtgcatgaacggatctctggtgtcgaccttggactcc ctaactggggaaagtatgtccttctgtcggcaggagccctgactgccttgatgttgattatcttcct gatgacttgttggaggagagtcaatcggtcggagccaacacaacataatctcagaggaacaggaaggg aggtgtcagtcacaccccaaagcgggaagatcatttcgtcttgggagtcatacaagagcggaggtgaa accggactgtga RABIESVIRUSG (SEQIDNO:10) MVPQALLFVPLLVFPLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLWEDEGCTNLSGF SYMELKVGYISAIKMNGFTCTGWTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWK MAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPGGNCSG VAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKG ACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPGQLVNLHDFRSDEIEHLWEELVKKRE ECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPS KGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLVSSVIPLMHPLAD PSTVFKNGDEAEDFVEVHLPDVHERISGVDLGLPNWGKYVLLSAGALTALMLIIFLMTCW RRVNRSEPTQHNLRGTGREVSVTPQSGKIISSWESYKSGGETGL* RABIESVIRUSG (SEQIDNO:16) auggugccgcaggcucuccuguuugucccccuucuggucuuuccauuguguuuugggaaauucccuauc uacacaauuccggacaaguugggacccuggagcccaauugacauucaucaucucagcugcccgaacaau uuggucguggaggacgaaggaugcaccaaccugucgggguucuccuacauggaauugaaagucggauac aucagugccauuaagaugaacggguucacuugcacaggcgucgugacugaagcugagacauacacuaac uucgugggauaugucacuaccacuuucaaaagaaagcauuuccgcccuacuccugaugcuuguagggcc gcauacaacuggaagauggccggugaccccagauaugaggaaucacuucacaauccguacccugacuac cacuggcuucggacugucaaaaccaccaaggagucacucgugaucauuaguccaaguguggcugaucuu gacccauacgaccggucacuucacucacggguguucccgggggggaauugcucuggugucgcagugucg ucaaccuacugcuccacaaaccacgauuacaccauuuggaugccagaaaauccucggcuugguauguca ugugacauuuucaccaauucucgggggaagagggcuuccaaagggucugaaacuugcggcuuugucgau gagcggggcuuguauaagucacuuaaaggugcuugcaaacucaagcuuuguggugucuugggauugaga uugauggauggaacuugggucgcaaugcagacuucuaacgaaaccaaauggugcccucccggacagcuu gugaauuugcaugacuuucgcucugacgaaauugagcaucuugucgucgaggaguuggucaagaagcgg gaagagugucuggaugcuuuggaaucaaucaugaccaccaagucagugucuuucagacggcucucacau cuuaggaaauuggugccagguuuuggaaaagcauauaccauuuucaacaagacccuuauggaagccgau gcucacuacaagucugucaggacuuggaaugagaucaucccgucuaaagggugucuuagggucggaggg agaugucauccucaugucaacggagucuuuuucaaugguaucauucuuggaccugacggaaauguccuu aucccugagaugcaaucuucccuccuccagcaacacauggaacuucuugucucaucggucaucccccuu augcacccccuggcugacccaucaaccguguucaagaacggugacgaggcagaggauuuugucgagguc caccuucccgaugugcaugaacggaucucuggugucgaccuuggacucccuaacuggggaaaguauguc cuucugucggcaggagcccugacugccuugauguugauuaucuuccugaugacuuguuggaggagaguc aaucggucggagccaacacaacauaaucucagaggaacaggaagggaggugucagucacaccccaaag cgggaagaucauuucgucuugggagucauacaagagcggaggugaaaccggacuguga

[0071] The following examples serve to provide further appreciation of the invention but are not meant in any way to restrict the effective scope of the invention.

EXAMPLES

Example 1

Incorporation of the Coding Sequences for FCV Capsid Proteins into the Alphavirus RNA Replicon Particles

Introduction

[0072] RNA viruses have been used as vector-vehicles for introducing vaccine antigens, which have been genetically engineered into their genomes. However, their use to date has been limited primarily to incorporating viral antigens into the RNA virus and then introducing the virus into a recipient host. The result is the induction of protective antibodies against the incorporated viral antigens. Alphavirus RNA replicon particles have been used to encode pathogenic antigens. Such alphavirus replicon platforms have been developed from several different alphaviruses, including Venezuelan equine encephalitis virus (VEE) [Pushko et al., Virology 239:389-401 (1997)], Sindbis (SIN) [Bredenbeek et al., Journal of Virology 67:6439-6446 (1993) the contents of which are hereby incorporated herein in their entireties], and Semliki Forest virus (SFV) [Liljestrom and Garoff, Biotechnology (NY) 9:1356-1361 (1991), the contents of which are hereby incorporated herein in their entireties]. Moreover, alphavirus RNA replicon particles are the basis for several USDA-licensed vaccines for swine and poultry. These include: Porcine Epidemic Diarrhea Vaccine, RNA Particle (Product Code 19U5.P1), Swine Influenza Vaccine, RNA (Product Code 19A5.D0), Avian Influenza Vaccine, RNA (Product Code 1905.D0), and Prescription Product, RNA Particle (Product Code 9PP0.00).

Alphavirus RNA Replicon Particle Construction

[0073] Amino acid sequences for FCV capsid proteins were used to generate codon-optimized (feline codon usage) nucleotide sequences in silico. Optimized sequences were prepared as synthetic DNA by a commercial vendor (ATUM, Newark, Calif.). Accordingly, synthetic genes were designed based on the amino acid sequences of a VS-FCV capsid protein and an FCV F9-like capsid protein, respectively. The constructs that encode the amino acid sequence for the VS-FCV capsid protein [SEQ ID NO: 2], or for the FCV F9-like capsid protein [SEQ ID NO: 4], were codon-optimized for feline, with flanking sequence appropriate for cloning into the alphavirus replicon plasmid.

[0074] The VEE replicon vectors designed to express FCV capsid proteins were constructed as previously described [see, U.S. Pat. No. 9,441,247 B2; the contents of which are hereby incorporated herein by reference], with the following modifications. The TC-83-derived replicon vector pVEK [disclosed and described in U.S. Pat. No. 9,441,247 B2] was digested with restriction enzymes AscI and PacI. A DNA plasmid containing the codon-optimized open reading frame nucleotide sequence of one of the FCV capsid protein genes (either FCV F9-Like or VS-FCV), with 5 flanking sequence (5-GGCGCGCCGCACC-3) [SEQ ID NO: 11] and 3 flanking sequence (5-TTAATTAA-3), were similarly digested with restriction enzymes AscI and PacI. The synthetic gene cassette was then ligated into the similarly digested pVEK vector, and the resulting clones were re-named pVHV-F9 and pVHV-Kalem, encoding the FCV F9-Like and the VS-FCV capsid proteins respectively. The pVHV vector nomenclature was chosen to refer to pVEK-derived replicon vectors containing transgene cassettes cloned via the AscI and PacI sites in the multiple cloning site of pVEK.

[0075] To create the dual construct, the pVHV vector region encoding the VEE subgenomic promoter and FCV Kalem (VS-FCV) capsid sequences was removed by PCR and ligated into the pVHV-F9 vector between the 3 end of the F9 FCV capsid sequence and the VEE 3 UTR sequence. The duplication of the subgenomic promoter sequence and confirmation of the FCV Kalem capsid sequence were achieved by sequencing of the final vector clone, termed pVHV-F9-Kalem.

[0076] Production of TC-83 RNA replicon particles (RP) was conducted according to methods previously described [U.S. Pat. No. 9,441,247 B2 and U.S. Pat. No. 8,460,913 B2; the contents of which are hereby incorporated herein by reference in their entireties]. Briefly, pVHV replicon vector DNA and helper DNA plasmids were linearized with NotI restriction enzyme prior to in vitro transcription using MegaScript T7 RNA polymerase and cap analog (Promega, Madison, Wis.). Importantly, the helper RNAs used in the production lack the VEE subgenomic promoter sequence, as previously described [Kamrud et al., J Gen Virol. 91(Pt 7):1723-1727 (2010)]. Purified RNA for the replicon and helper components were combined and mixed with a suspension of Vero cells, electroporated in 4 mm cuvettes, and returned to OptiPro SFM cell culture media (Thermo Fisher, Waltham Mass.). Following overnight incubation, alphavirus RNA replicon particles were purified from the cells and media by passing the suspension through a ZetaPlus BioCap depth filter (3M, Maplewood, Minn.), washing with phosphate buffered saline containing 5% sucrose (w/v), and finally eluting the retained RP with 400 mM NaCl buffer. Eluted RP were formulated to a final 5% sucrose (w/v), passed through a 0.22 micron membrane filter, and dispensed into aliquots for storage. Titer of functional RP was determined by immunofluorescence assay on infected Vero cell monolayers.

Example 2

Evaluation of Efficacy and Safety of a Dual Construct FCV Vaccine in Cats

[0077] A dual-construct vaccine comprising a propagation defective RNA particle (RP) encoding the capsid proteins from two different strains of FCV, a virulent systemic strain (VS-FCV) and a classical vaccine strain (FCV F9-Like) along with the capsid protein and glycoproteins of the avirulent TC-83 strain of Venezuelan Equine Encephalitis Virus (VEE) was formulated in 5% sucrose and stored frozen. This dual-construct vaccine was used to evaluate the effectiveness against challenge by two FCV strains, as shown in Table 1 below. Two groups of 10 cats each were vaccinated with the dual-construct FCV vaccine in a prime/boost regimen at 13-14 weeks of age and then 21 days later. Two groups of control cats were vaccinated by the same regimen with a placebo vaccine consisting of cell culture media (Minimal Essential Media with Earle's salts, EMEM).

TABLE-US-00003 TABLE 1 VACCINATION PROTOCOL Treatment No. of Test Vaccine Challenge Group Animals Product Dose Strain 1 9 Dual-construct 6.1 10.sup.7 Classical FCV RP-FCV (Strain 255) 2 7 Placebo NA Classical FCV (Strain 255) 3 9 Dual-construct 6.1 10.sup.7 Virulent RP-FCV Systemic FCV (Kalem.sup.# strain) 4 7 Placebo NA Virulent Systemic FCV (Kalem strain) .sup.#Internal reference

[0078] Following the vaccinations the cats were observed for adverse reactions to the vaccines by observing the cats for any local or systemic reactions to the vaccines as well as clinical signs of FCV infection. No adverse reactions were observed for any of the vaccinated cats.

[0079] Three weeks following the booster vaccination, cats in Groups 1 and 2 were challenged intranasally with a virulent culture of FCV strain 255 (classical FCV challenge strain). Three weeks after booster vaccination cats in Groups 3 and 4 were challenged intranasally with a virulent culture of virulent systemic FCV challenge strain (FCV strain Kalem).

[0080] Cats were observed for clinical signs of FCV infection for 14 days following challenge as follows: cats were observed and scored daily for clinical signs including: death, depression/lethargy, body temperature, nasal and oral ulcers, nasal and ocular discharge, lameness, dehydration and sneezing. Body weight was measured on four days spaced throughout the 14 day post-challenge period. Each of the clinical signs observed was given a weighted numerical score based on severity and the number of days it was observed. Each cat was then given a total, weighted score based on the sum of the daily weighted scores. A mean and median weighted score was then calculated for each treatment group. For the challenge to be considered valid, 80% of the control cats must show clinical signs of FCV infection (other than fever). The results of the challenge are summarized in Table 2 below:

TABLE-US-00004 TABLE 2 CHALLENGE RESULTS Median Mean Weighted Weighted Treatment Test Challenge Clinical Clinical Group Product Strain Score Score 1 Dual-construct Classical FCV 5 6.3 RP-FCV (Strain 255) 2 Placebo Classical FCV 16 14.3 (Strain 255) 3 Dual-construct Virulent 10 8.8 RP-FCV Systemic FCV (Kalem strain) 4 Placebo Virulent 38 36.9 Systemic FCV (Kalem strain)

[0081] The challenges for both strains were considered valid as 100% of placebo-vaccinated control cats exhibited clinical signs of FCV infection (other than fever). The dual-construct RP-FCV vaccine encoding a virulent systemic and classical vaccine strain of FCV protected cats against two distinct strains of FCV: a classical FCV strain as well as a virulent systemic FCV strain. The experimental vaccine was found safe in cats.

Example 3

Evaluation of Interference with Administration of Two Different RNA Particle Vaccines

[0082] The study was conducted to evaluate multiple aspects of the alphavirus RNA replicon particle FCV vaccine including serological response, efficacy against challenge, and interference. A RP-FCV construct vaccine encoding the capsid protein of a classical FCV vaccine strain (F9) was formulated in stabilizer consisting of gelatin, NZ-amine, and sucrose and lyophilized. Two groups of five cats were vaccinated with the RP-FCV vaccine at 17 weeks of age. Twenty-one days later, cats in Group 1 were administered a booster dose of the RP-FCV vaccine only, cats in Group 2 were administered a booster dose of the RP-FCV vaccine and administered a dose of an RP-Rabies vaccine at the same time as shown in Table 3 below. The RP-Rabies virus vaccine is a construct encoding the rabies virus glycoprotein (G) in the same TC-83 VEE alphavirus platform.

TABLE-US-00005 TABLE 3 VACCINATION PROTOCOL Treatment Test Product -Initial Test Product(s)-Booster Group Vaccination (Day 0) Vaccination (Day 21) 1 RP-FCV (F9) RP-FCV (F9) 2 RP-FCV (F9) RP-FCV (F9) RP-Rabies virus

[0083] Following each vaccination the cats were observed for adverse reactions to the vaccines by observing the cats for any local or systemic reactions to the vaccines. No adverse reactions were observed for any of the vaccinated cats.

[0084] Cats were bled for serum collection on the day of initial vaccination (Study Day 0), the day of booster vaccination (Study Day 21) and six weeks after the initial vaccination (Study Day 42). The serum was tested for antibody titer to FCV F9 by a serum neutralization assay. Serum was also tested for antibody titer to rabies virus by the Rapid Fluorescent Focus Inhibition Test (RFFIT). RIFFT results are reported as International Units per milliliter (IU/mL). Serology results are summarized in Tables 4 and 5 below.

TABLE-US-00006 TABLE 4 FCV F9 SEROLOGY RESULTS Vaccination FCV (F9) Antibody Titer Treatment Regimen (Geometric Mean) Group (Day 0/Day 21) Day 0 Day 21 Day 42 1 RP-FCV (F9)/ <2 3 34 RP-FCV (F9) 2 RP-FCV (F9)/ <2 3 38 RP-FCV (F9) + RP-Rabies virus

[0085] Based on comparison of FCV (F9) antibody titers (on serum samples collected post-booster) concurrent vaccination with an RP-Rabies virus vaccine does not interfere with the antibody response to an RP-FCV (F9) vaccine.

TABLE-US-00007 TABLE 5 RABIES VIRUS SEROLOGY RESULTS Vaccination Rabies Antibody Titer Treatment Regimen (Geometric Mean IU/mL) Group (Day 0/Day 21) Day 0 Day 21 Day 42 1 RP-FCV (F9)/ 2 1 Not Tested RP-FCV (F9) 2 RP-FCV (F9)/ 1 <1 39 RP-FCV (F9) + RP-Rabies virus

[0086] Although this study did not include a control group, which was vaccinated with only an RP-Rabies virus vaccine, for the purpose of comparing the post-booster rabies titer of Group 2, historical data from other studies is presented below in Table 6.

TABLE-US-00008 TABLE 6 RABIES VIRUS SEROLOGY RESULTS, MULTIPLE STUDIES Rabies Antibody Titer (Geometric Mean IU/mL) RP-Rabies Approximately Treatment Vaccination virus Pre- 1 month post- Group Regimen Potency vaccination vaccination* 2 RP-FCV (F9)/ 1.3 10.sup.7 1 39 RP-FCV (F9) + RP-Rabies virus Study RP-Rabies virus 2.7 10.sup.7 <0.1 42.7 RUS-006 alone Single Vaccination Study RP-Rabies virus 2.6 10.sup.6 <0.1 17.6 RUS-006 alone Single Vaccination *Study RUS-006 cats were bled for serum 30 days after vaccination

[0087] Based on the potency of the RP-Rabies virus vaccines and the post-vaccination rabies antibody titers, a prior vaccination with an RP-FCV vaccine does not interfere with the antibody response to an RP-Rabies virus vaccine. Vector immunity is a concern with platform-based vaccines however, the results of this study suggest that multiple RP-based vaccines can be used in an animal without compromising efficacy.

[0088] In order to confirm the lack of interference by concurrent vaccination with RP-Rabies virus on RP-FCV (F9) efficacy the study was amended and continued. A group of five age-matched cats were added to the study to serve as non-vaccinated controls. All cats were challenged intranasally with a virulent, classical strain of FCV (FCV 255) 79 days after the initial vaccination of Groups 1 and 2.

[0089] For 14 days following challenge cats were observed and scored daily for the following clinical signs of FCV infection: death, depression/lethargy, body temperature, nasal and oral ulcers, nasal and ocular discharge, lameness, dehydration, and sneezing. Body weight was measured on four days spaced throughout the 14-day post-challenge period. Each of the clinical signs observed was given a weighted numerical score based on severity and the number of days it was observed. Each cat was then given a total, weighted score based on the sum of the daily weighted scores. A mean and median weighted score was then calculated for each treatment group. For the challenge to be considered valid, 80% of the control cats must show clinical signs of FCV infection (other than fever). The results of the challenge are summarized in the table below:

TABLE-US-00009 TABLE 7 INTERFERENCE STUDY CHALLENGE RESULTS Vaccination Mean Median Treatment Regimen Weighted Weighted Group (Day 0/Day 21) Clinical Score Clinical Score 1 RP-FCV (F9)/ 3 4.0 RP-FCV (F9) 2 RP-FCV (F9)/ 2 4.4 RP-FCV (F9) + RP-Rabies virus 3 Non-Vaccinated 20 19.6

[0090] The challenge was considered valid as 100% of non-vaccinated control cats exhibited clinical signs of FCV infection (other than fever). Both vaccinate groups (Groups 1 and 2) were significantly protected from virulent FCV challenge (p values 0.012 for both groups).

[0091] Based on comparison of clinical scores, concurrent vaccination with an RP-Rabies virus vaccine does not interfere with the efficacy of an RP-FCV (F9) vaccine. The experimental vaccine was found safe in cats.

Example 4

Evaluation of Vaccine Efficacy in Cats of a RP Construct Encoding a Single FCV F9-Like Capsid Protein

[0092] This study was conducted to further evaluate the efficacy of a feline vaccine comprising an alphavirus RNA replicon particle that encoded a single FCV F9-Like capsid protein (RP-FCV F9). The vaccine was compared to a placebo control group against a classical FCV challenge. Cats were inoculated with either this monovalent vaccine or a placebo and subsequently challenged with a classical FCV. The clinical scores are based on the typical signs of FCV infection, mainly oral and external ulcers and rhinitis, scored over a period of 14 days following the FCV challenge. The scoring system is the same as that described in Examples 2 and 3 above. Whereas, the mean clinical score for the placebo controls was 92, the mean clinical score for the RP-FCV F9 vaccine was only 2. Surprisingly the score for the RP-FCV F9 vaccine also was significantly lower than that obtained with two vaccines that individually comprised a single attenuated-live FCV F9-Like virus. This experiment further demonstrates that an RP-FCV vaccine encoding a classical vaccine strain of FCV protects cats against an FCV F9-Like virus.

[0093] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.

[0094] It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description.