Modulators of Chromosome 9 Open Reading Frame 72 Gene Expression and Uses Thereof
20200339638 ยท 2020-10-29
Assignee
Inventors
- Joseph F. Nabhan (Arlington, MA, US)
- Amrutha Pattamatta (Watertown, MA, US)
- Mohammad Samie (Richmond, CA, US)
Cpc classification
A61K31/7088
HUMAN NECESSITIES
C07K2319/81
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
C12N2750/14132
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
A01K2267/0356
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
A01K2217/072
HUMAN NECESSITIES
International classification
A61P25/28
HUMAN NECESSITIES
Abstract
The present disclosure provides compositions and methods for modulating transcription of mutant C9orf72 gene alleles in patients in need thereof, including patients having a C9orf72-related disease such as amyotrophic lateral sclerosis (ALS) or frontotemporal dementia (FTD).
Claims
1. A fusion protein comprising a zinc finger protein (ZFP) domain and a transcription repressor domain, wherein the ZFP domain binds to a target region in an intronic segment between exons 1a and 1b on a mutant allele of a human C9orf72 gene, wherein the target region comprises more than 30 tandem repeats of G.sub.4C.sub.2 (SEQ ID NO:1).
2. The fusion protein of claim 1, wherein the fusion protein represses transcription of repeat-containing mRNA from the mutant allele and does not repress transcription of wildtype mRNA from the gene.
3. The fusion protein of claim 1, wherein the ZFP domain binds to a sense sequence in the target region, wherein the sense sequence comprises one to three tandem repeats of hexanucleotide GGGGCC (SEQ ID NO:1), GGGCCG (SEQ ID NO:2), GGCCGG (SEQ ID NO:3), GCCGGG (SEQ ID NO:4), CCGGGG (SEQ ID NO:5), or CGGGGC (SEQ ID NO:6).
4. The fusion protein of claim 1, wherein the fusion protein represses sense transcription from the mutant C9orf72 allele in a human cell.
5. The fusion protein of claim 4, wherein the fusion protein represses sense transcription from the C9orf72 1a promoter and does not repress sense transcription from the C9orf72 1b promoter.
6. The fusion protein of claim 1, wherein the ZFP domain binds to an antisense sequence in the target region, wherein the antisense sequence comprises one to three tandem repeats of hexanucleotide GGCCCC (SEQ ID NO:7), GCCCCG (SEQ ID NO:8), CCCCGG (SEQ ID NO:9), CCCGGC (SEQ ID NO:10), CCGGCC (SEQ ID NO:11), or CGGCCC (SEQ ID NO:12).
7. The fusion protein of claim 1, wherein the fusion protein represses antisense transcription from the mutant C9orf72 allele in a human cell.
8. The fusion protein of claim 1, wherein the fusion protein represses both sense transcription and antisense transcription from the mutant C9orf72 allele in a human cell.
9. The fusion protein of claim 1, wherein the fusion protein represses sense and/or antisense transcription from the mutant C9orf72 allele by at least about 30%, 40%, 75%, 90%, or 95%, optionally wherein the fusion protein does not repress sense transcription from the C9orf72 1b promoter.
10. The fusion protein of claim 1, wherein the ZFP domain comprises six zinc fingers; binds to a target sequence shown in Table 1; and/or comprises the six zinc finger sequences of a ZFP transcription factor shown in Table 1, optionally comprising one or more mutations to residues outside the recognition helix regions as indicated in Table 1.
11. The fusion protein of claim 1, wherein the transcription repressor domain comprises a KRAB domain amino acid sequence from human KOX1.
12. The fusion protein of claim 1, wherein the ZFP domain is linked to the transcription repressor domain through a peptide linker.
13. A nucleic acid construct comprising a coding sequence for the fusion protein of claim 1, wherein the coding sequence is linked operably to a transcription regulatory element.
14-15. (canceled)
16. A host cell comprising the nucleic acid construct of claim 13.
17-18. (canceled)
19. A recombinant virus comprising the nucleic acid construct of claim 13, optionally wherein the recombinant virus is a recombinant adeno-associated virus (rAAV).
20. A pharmaceutical composition comprising the nucleic acid construct of the recombinant virus of claim 19, and a pharmaceutically acceptable carrier.
21. A method of inhibiting transcription of a mutant allele of a C9orf72 gene in a human cell, wherein the mutant allele comprises an expanded G.sub.4C.sub.2 (SEQ ID NO:1) repeat region in an intronic segment between exons 1a and 1b, the method comprising introducing to the cell a fusion protein of claim 1.
22-23. (canceled)
24. A method of treating a patient suffering from a C9orf72-related disorder optionally selected from amyotrophic lateral sclerosis (ALS) and C9 familial frontotemporal dementia (C9FTD), the method comprising introducing to the patient a fusion protein of claim 1.
25. The method of claim 24, wherein the fusion protein is introduced through a recombinant virus that expresses the fusion protein.
26. The method of claim 25, wherein the recombinant virus is an adeno-associated virus (AAV), optionally of serotype 9 or pseudotype AAV2/9 or AAV2/6/9.
27-30. (canceled)
Description
BRIEF DESCRIPTION OF THE FIGURES
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
DETAILED DESCRIPTION OF THE INVENTION
[0040] The present disclosure provides zinc finger protein-based transcription factors (ZFP-TFs) that preferentially target human C9orf72 gene alleles having an expanded G.sub.4C.sub.2 repeat region and repress the transcription of these mutant alleles into RNA. Such an expanded region may have more than 30 G.sub.4C.sub.2 repeats. The present ZFP-TFs are fusion proteins containing (i) at least one zinc finger protein (ZFP) domain that binds specifically to DNA motifs within the repeats on either the sense or antisense strand of a mutant allele, and (ii) at least one transcription repressor domain that reduces transcription of the allele in either or both of the sense and antisense directions. Reducing the level of mutant C9orf72 transcripts in neurons by introducing the ZFP-TFs into the nervous system (e.g., brain and spinal cord) of a patient is expected to inhibit (e.g., reduce or stop) the formation of disease-causing cytotoxic materials within the cells. The present ZFP-TFs can be used for treatment, including prevention and alleviation, of C9orf72-related disorders such as ALS and C9FTD.
[0041] Disclosed herein are methods and compositions for diagnosing, preventing and/or treating ALS and FTD. In particular, provided herein are methods and compositions for modifying (e.g., modulating expression of) specific genes so as to treat these diseases including the use of engineered transcription factor repressors and nucleases. In some embodiments, modulation of expression comprises modulating both sense and/or antisense expression.
[0042] Thus, described herein are methods (in vivo, ex vivo and/or in vitro) of repressing sense and/or anti-sense transcription of the repeat expanded mutant alleles of the C9orf72 gene in a cell (e.g., a neuron). The methods comprise treating the cells with one or more repressors of the mutant C9orf72 gene alleles, the one or more repressors comprising a transcriptional repression domain and a DNA-binding domain that binds to a target site in the mutant C9orf72 gene alleles. The repressor(s) can comprise one or more zinc finger protein transcription factors (ZFP-TF comprising a ZFP DNA-binding domain), one or more TAL-effector domain transcription factors (TALE-TF comprising a TAL-effector domain DNA-binding domain) and/or one or more CRISPR/Cas transcription factor systems (comprising a single guide RNA DNA-binding domain). In certain embodiments, two or more different repressors (e.g., one or more pharmaceutical compositions comprising the two or more different repressors) are used. In certain embodiments, the C9orf72 gene comprises a mutant allele comprising one or more (G.sub.4C.sub.2) repeats, optionally wherein the target site bound by the DNA-binding domain of the repressor is within the one or more (G.sub.4C.sub.2) repeats. Therefore, the invention provides use of one or more ZFP-TF, TALE-TF or CRISPR/Cas TF repressors (e.g., formulated into one or more pharmaceutical compositions comprising the one or more repressors) that bind to a mutant C9orf72 expanded allele comprising one or more (G.sub.4C.sub.2) repeats for repressor of sense and/or antisense transcription (e.g., by 50%, 70% or more as compared to an untreated cell/subject) in a subject in need thereof (e.g., a subject with ALS and/or FTD where the disease is treated and/or the symptoms ameliorated). In certain embodiments, sense and/or antisense transcription is not repressed to more than 90% of normal (control) levels. In certain embodiments, both antisense and sense transcription are repressed at the same or different levels (e.g., antisense and sense transcription are similarly repressed); antisense transcription is repressed more than sense transcription or sense transcription is repressed more than antisense transcription. In certain embodiments, specific sense transcripts are repressed while others are not. In some embodiments, transcription from the promoter in the 1b intron segment is not repressed while transcription from the promoter in the 1a intron and antisense transcripts are repressed. In certain embodiments, transcripts comprising the expanded repeat are selectively repressed (e.g., antisense transcription is repressed, sense transcription from the 1a promoter is repressed and/or sense transcription from the 1b promoter is not repressed). In certain embodiments, one or more ZFP-TF repressors comprising the recognition helix regions as shown in Table 1 are used in the methods and uses described herein, optionally in combination with one or more different repressors (e.g., additional different ZFP-TFs, for example, one or more additional ZFP-TFs comprising a ZFP as shown in Table 1). In certain embodiments, one or more of the repressors are administered to the cell using one or more non-viral vectors (e.g., as mRNA) and/or viral vectors (e.g., AAV such as AAV2/9). Multiple copies of the one or more modulators (e.g., repressors) may be administered using the same or different modalities (e.g., mRNA and/or AAV). In certain embodiments, the same or different modalities may be used to deliver one or more different modulators (e.g., repressors). In vivo methods and uses in live subjects (e.g., humans) can involve administration (e.g., of one or more pharmaceutical compositions comprising the repressors and/or polynucleotides encoding the repressor) by any suitable means, including but not limited to, intracerebroventricular, intrathecal, intracranial, retro-orbital (RO), intravenous, intranasal and/or intracisternal intravenously. Brain administration may be unilateral or bilateral (e.g., to the hippocampus). Any amount (dosage) may be administered, for example 1E10 to 1E13 (e.g., 6E11) vg/hemisphere. In any of the methods and uses described herein, ALS and/or FTD is treated (and/or one or more symptoms of these diseases are treated) in the subject.
[0043] Provided herein is a genetic modulator of a C9orf72 gene, the modulator comprising a DNA-binding domain (e.g., zinc finger protein (ZFP), a TAL-effector domain protein (TALE) or single guide RNA) that binds to a target site of at least 12 nucleotides in the C9orf72 gene; and a transcriptional regulatory domain (e.g., repression domain). One or more polynucleotides (e.g., viral or nonviral gene delivery vehicle, for example, an AAV vector) encoding one or more of the genetic modulators described herein are also provided. In other aspects, described herein are pharmaceutical compositions comprising one or more polynucleotides and/or one or more gene delivery vehicles as provided herein. In some embodiments, the genetic modulator comprises a regulator domain, the genetic modulator (and pharmaceutical composition comprising the one or more genetic modulators or polynucleotides encoding the one or more genetic modulators) modulates (e.g., represses or activates) the expression of the C9orf72 gene. Sense and/or antisense strands of the gene may be bound and/or modulated. Also provided herein are isolated cells (including cell populations) comprising one or more genetic modulators; one or more polynucleotides; one or more gene delivery vehicles; and/or one or more pharmaceutical compositions as described herein. Methods and uses for modulating expressing (e.g., repressing) a C9orf72 gene in a cell (in vitro, in vivo or ex vivo) are also provided, the methods comprising administering (via any method including but not limited to intracerebroventricular, intrathecal, intracranial, retro-orbital (RO), intravenous or intracisternal) one or more genetic modulators; one or more polynucleotides; one or more gene delivery vehicles; and/or one or more pharmaceutical compositions as described herein to the cells. The methods can be used for the treatment and/or prevention of amyotrophic lateral sclerosis (ALS) or frontotemporal dementia (FTD) in a subject. Uses of one or more one or more genetic modulators; one or more polynucleotides; one or more gene delivery vehicles; and/or one or more pharmaceutical compositions for the treatment and/or prevention of ALS or FTD in a subject are also provided. Also provided is a kit comprising one or more genetic modulators; one or more polynucleotides; one or more gene delivery vehicles; and/or one or more pharmaceutical compositions as described herein and, optionally, instructions for use.
[0044] Thus, in one aspect, engineered (non-naturally occurring) genetic modulators (e.g., repressors) of one or more genes are provided. These genetic modulators may comprise systems (e.g., zinc finger proteins, TAL effector (TALE) proteins or CRISPR/dCas-TF) that modulate (e.g., repress) expression of an allele. Expression of wild-type and/or mutant alleles may be modulated together or separately. In certain embodiments, the modulation of the mutant allele is at a greater level than the wild-type allele (e.g., wild-type allele is repressed no more than 50% of normal but a mutant allele is repressed by at least 70% as compared to untreated control). In some embodiments, modulation of expression may comprise modulating both sense and antisense transcripts of the C9orf72 gene. In some embodiments, modulation of expression may predominantly modulate sense transcripts, while in other embodiments, modulation of expression may predominantly modulate antisense transcripts.
[0045] An expansion mutation in a C9orf72 allele leads to expression of both a sense and anti-sense RNA product associated with ALS and FTD, so in one embodiment, provided are engineered transcription factors designed to repress expression of these mutant C9orf72 alleles for the treatment of ALS or FTD. Engineered zinc finger proteins or TALEs are non-naturally occurring zinc finger or TALE proteins whose DNA binding domains (e.g., recognition helices or RVDs) have been altered (e.g., by selection and/or rational design) to bind to a pre-selected target site. Any of the zinc finger proteins described herein may include 1, 2, 3, 4, 5, 6 or more zinc fingers, each zinc finger having a recognition helix that binds to a target subsite in the selected sequence(s) (e.g., gene(s)). In certain embodiments, the ZFP-TFs comprise a ZFP having the recognition helix regions as shown in a single row of Table 1. Similarly, any of the TALE proteins described herein may include any number of TALE RVDs. In some embodiments, at least one RVD has non-specific DNA binding. In some embodiments, at least one recognition helix (or RVD) is non-naturally occurring. In certain embodiments, the TALE-TF comprises a TALE that binds to at least 12 base pairs of a target site as shown in Table 1. A CRISPR/Cas-TF includes a single guide RNA that binds to a target sequence. In certain embodiments, the engineered transcription factor binds to (e.g., via a ZFP, TALE or sgRNA DNA binding domain) an at least 9-12 base pair target site in a disease associated gene, for example a target site comprising at least 9-20 base pairs (e.g., 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more), including contiguous or non-contiguous sequences within these target sites (e.g., a target site as shown in Table 1). In certain embodiments, the genetic modulator comprises a DNA-binding molecule (ZFP, TALE, single guide RNA) as described herein operably linked to a transcriptional repression domain (to form a genetic repressor).
[0046] Thus, the zinc finger proteins (ZFPs), Cas protein of a CRISPR/Cas system or TALE proteins as described herein can be placed in operative linkage with a regulatory domain (or functional domain) as part of a fusion molecule. The functional domain can be, for example, a transcriptional activation domain, a transcriptional repression domain and/or a nuclease (cleavage) domain. By selecting either an activation domain or repression domain for use with the DNA-binding molecule, such molecules can be used either to activate or to repress gene expression. In certain embodiments, the functional or regulatory domains can play a role in histone post-translational modifications. In some instances, the domain is a histone acetyltransferase (HAT), a histone deacetylase (HDAC), a histone methylase, or an enzyme that sumolyates or biotinylates a histone or other enzyme domain that allows post-translation histone modification regulated gene repression (Kousarides, (2007) Cell 128:693-705). In some embodiments, a molecule comprising a ZFP, dCas or TALE targeted to a gene (e.g., C9orf72) as described herein fused to a transcriptional repression domain that can be used to down-regulate gene expression is provided. In some embodiments, the methods and compositions of the invention are useful for treating eukaryotes. In certain embodiments, the activity of the regulatory domain is regulated by an exogenous small molecule or ligand such that interaction with the cell's transcription machinery will not take place in the absence of the exogenous ligand. Such external ligands control the degree of interaction of the ZFP-TF, CRISPR/Cas-TF or TALE-TF with the transcription machinery. The regulatory domain(s) may be operatively linked to any portion(s) of one or more of the ZFPs, dCas or TALEs, including between one or more ZFPs, dCas or TALEs, exterior to one or more ZFPs, dCas or TALEs and any combination thereof. In preferred embodiments, the regulatory domain results in a repression of gene expression of the targeted gene (e.g., C9orf72). Any of the fusion proteins described herein may be formulated into a pharmaceutical composition.
[0047] In some embodiments, the artificial regulator binds to a promoter region upstream (e.g., 5 of) of the transcriptional start site (TSS) of the gene. In some embodiments, the artificial regulator binds to a region downstream of the TSS. In preferred embodiments, the artificial regulator preferentially binds to an expanded repeat region in a C9orf72 gene. In some embodiments, binding of the artificial regulator to the C9orf72 gene represses expression of the promoter in the 1a intron. In some embodiments, binding of the artificial regulator to the C9orf72 gene represses expression of the promoter in the 1b intron. In some embodiments, binding of the artificial regulator represses expression from the 1a promoter and an antisense promoter, but does not repress the 1b promoter. See also
[0048] In some embodiments, the methods and compositions of the invention include use of two or more fusion molecules as described herein, for instance two or more C9orf72 modulators (artificial transcription factors). The two or more fusion molecules may bind to different target sites and comprise the same or different functional domains. Alternatively, the two or more fusion molecules as described herein may bind to the same target site but include different functional domains. In some instances, three or more fusion molecules are used, in others, four or more fusion molecules are used, while in others, 5 or more fusion molecules are used. In some embodiments, the two or more, three or more, four or more, or five or more fusion molecules (or components thereof) are delivered to the cell as nucleic acids. In preferred embodiments, the fusion molecules cause a repression of the expression of the targeted gene. In some embodiments, two fusion molecules are given at doses where each molecule is active on its own but in combination the repression activity is additive. In some embodiments, two fusion molecules are given at doses where neither is active on its own, but in combination, the repression activity is synergistic.
[0049] In yet another aspect, a polynucleotide encoding any of the DNA binding domains described herein is provided.
[0050] In some embodiments, the polynucleotide encoding the DNA binding protein is an mRNA. In some aspects, the mRNA may be chemically modified (e.g., Kormann et al., (2011) Nature Biotechnology 29(2):154-7). In other aspects, the mRNA may comprise an ARCA cap (see U.S. Pat. Nos. 7,074,596 and 8,153,773). In further embodiments, the mRNA may comprise a mixture of unmodified and modified nucleotides (see U.S. Patent Publication No. 2012/0195936).
[0051] In yet another aspect, a gene delivery vector comprising any of the polynucleotides (e.g., repressors) as described herein is provided. In certain embodiments, the vector is an adenovirus vector (e.g., an Ad5/F35 vector), a lentiviral vector (LV) including integration competent or integration-defective lentiviral vectors, or an adenovirus associated viral vector (AAV). In certain embodiments, the AAV vector is an AAV2, AAV6, AAV8 or AAV9 vector or pseudotyped AAV vector such as AAV2/8, AAV2/5, AAV2/9 and AAV2/6. In some embodiments, the AAV vector is an AAV vector capable of crossing the blood-brain barrier (e.g. U.S. Patent Publication No. 2015/0079038). In other embodiments, the AAV is a self-complementary AAV (sc-AAV) or single stranded (ss-AAV) molecule. Also provided herein are adenovirus (Ad) vectors, LV or adenovirus associate viral vectors (AAV) comprising a sequence encoding at least one nuclease (ZFN or TALEN) and/or a donor sequence for targeted integration into a target gene. In certain embodiments, the Ad vector is a chimeric Ad vector, for example an Ad5/F35 vector. In certain embodiments, the lentiviral vector is an integrase-defective lentiviral vector (IDLV) or an integration competent lentiviral vector. In certain embodiments, the vector is pseudo-typed with a VSV-G envelope, or with other envelopes.
[0052] Additionally, pharmaceutical compositions comprising the nucleic acids, and/or fusions such as artificial transcription factors (e.g., ZFPs, Cas or TALEs or fusion molecules comprising the ZFPs, Cas or TALEs) are also provided. For example, certain compositions include a nucleic acid comprising a sequence that encodes one of the ZFPs, Cas or TALEs described herein operably linked to a regulatory sequence, combined with a pharmaceutically acceptable carrier or diluent, wherein the regulatory sequence allows for expression of the nucleic acid in a cell. In certain embodiments, the ZFPs, Cas, CRISPR/Cas or TALEs encoded modulate a wild-type and/or mutant allele. In some embodiments, the mutant allele is preferentially modulated, e.g., is repressed, more than the wild-type allele. In some embodiments, pharmaceutical compositions comprise ZFPs, CRISPR/Cas or TALEs that preferentially modulate a mutant allele and ZFPs, CRISPR/Cas or TALEs that modulate a neurotrophic factor. Protein based compositions include one of more ZFPs, CRISPR/Cas or TALEs as disclosed herein and a pharmaceutically acceptable carrier or diluent.
[0053] In yet another aspect also provided is an isolated cell comprising any of the proteins, fusion molecules, polynucleotides and/or compositions as described herein. The isolated cell may be used for non-therapeutic uses such as the provision of cell or animal models for diagnostic and/or screening methods and/or for therapeutic uses such as ex vivo cell therapy.
[0054] In yet another aspect, also provided are pharmaceutical compositions comprising one or more genetic modulators, one or more polynucleotides (e.g., gene delivery vehicles) and/or one or more (e.g., a population of) isolated cells as described herein. In certain embodiments, the pharmaceutical composition comprises two or more genetic modulators. For example, certain compositions include a nucleic acid comprising a sequence that encodes one or more genetic modulators of one of the genes associated with the rare disease (e.g., C9orf72) as described herein. In certain embodiments, the genetic modulator(s) (e.g., comprising ZFPs, Cas or TALEs described herein) are operably linked to a regulatory sequence, combined with a pharmaceutically acceptable carrier or diluent, where the regulatory sequence allows for expression of the nucleic acid in a cell. In certain embodiments, the ZFPs, CRISPR/Cas or TALEs encoded are specific for a mutant or wildtype allele (e.g., C9orf72). In some embodiments, pharmaceutical compositions comprise ZFP-TFs, CRISPR/Cas-TFs or TALE-TFs that modulate a mutant and/or wildtype allele (e.g., C9orf72), including TFs that preferentially modulate (e.g., repress at greater levels) the mutant allele as compared to the wild-type allele. Protein-based compositions include one of more genetic modulators as disclosed herein and a pharmaceutically acceptable carrier or diluent. In certain embodiments, the compositions comprising two or more genetic modulators (carried on the same or different type of vector, for example on AAV vectors) are used, optionally wherein one of the genetic modulators comprises a ZFP-TF repressor comprising a ZFP designated 74949, 74978, 75027 or 75109.
[0055] The invention also provides methods and uses for repressing gene expression in a subject in need thereof (e.g., a subject with a rare disease as described herein), including by providing to the subject one or more polynucleotides, one or more gene delivery vehicles, and/or a pharmaceutical composition as described herein. In certain embodiments, the compositions described herein are used to repress mutant C9orf72 expression in the subject, including for treatment and/or prevention of ALS or FTD. The compositions described herein repress gene expression for sustained periods of time (4 weeks, 3 months, 6 months to year or more) in the brain (including but not limited to the frontal cortical lobe including but not limited to the prefrontal cortex, parietal cortical lobe, occipital cortical lobe, temporal cortical lobe including but not limited to the entorhinal cortex, hippocampus, brain stem, striatum, thalamus, midbrain, cerebellum) and spinal cord (including but not limited to lumbar, thoracic and cervical regions). The compositions described herein may be provided to the subject by any administration means, including but not limited to, intracerebroventricular, intrathecal, intracranial, intravenous, orbital (retro-orbital (RO)), intranasal and/or intracisternal administration. Kits comprising one or more of the compositions (e.g., genetic modulators, polynucleotides, pharmaceutical compositions and/or cells) as described herein as well as instructions for use of these compositions are also provided.
[0056] In another aspect, provided herein are methods for treating and/or preventing a CNS (e.g., ALS and/or FTD) using the methods and compositions described herein. In some embodiments, the methods involve compositions where the polynucleotides and/or proteins may be delivered using a viral vector, a non-viral vector (e.g., plasmid) and/or combinations thereof. In some embodiments, the methods involve compositions comprising stem cell populations comprising an artificial transcription factor (e.g., ZFP-TF, TALE-TF, or dCas-TF). Administration of compositions as described herein (proteins, polynucleotides, cells and/or pharmaceutical compositions comprising these proteins, polynucleotides and/or cells) result in a therapeutic (clinical) effect, including, but not limited to, amelioration or elimination of any the clinical symptoms associate with ALS and/or FTD as well as an increase in function and/or number of CNS cells (e.g., neurons, astrocytes, myelin, etc.). In certain embodiments, the compositions and methods described herein reduce expression of sense and/or antisense transcripts for a target gene (e.g., C9orf72), as compared to controls not receiving the artificial repressors as described herein, by at least 30% or 40%, e.g., by at least 50%, at least 70%, at least 80%, at least 90%, at least 95%, or greater that 95%. In some embodiments, at least 50% reduction is achieved. In certain embodiments, the artificial repressor preferentially represses a mutant allele (for example, an expanded allele) as compared to a wild-type allele, for example by at least 20% (e.g., represses the wild-type allele no more than 50% and the mutant allele by at least 70%). In some embodiments, the repressor preferentially represses a sense transcript on a mutant allele, while in other embodiments, the repressor preferentially represses an antisense transcript on a mutant allele. In some embodiments, the repressor represses the sense and antisense transcripts on a mutant allele.
[0057] In a still further aspect, described here is a method of delivering a gene repressor to the brain of the subject using a viral or non-viral vector. In certain embodiments, the viral vector is an AAV9 vector. Delivery may be to any brain region, for example, the hippocampus or entorhinal cortex by any suitable means including via the use of a cannula. Any AAV vector that provides widespread delivery of the genetic modulator (e.g., repressor) to brain of the subject, including via anterograde and retrograde axonal transport to brain regions not directly administered the vector (e.g., delivery to the putamen results in delivery to other structures such as the cortex, substantia nigra, thalamus, etc.). In certain embodiments, the subject is a human and in other embodiments, the subject is a non-human primate. The administration may be in a single dose, or in a series of doses given at the same time, or in multiple administrations (at any timing between administrations).
[0058] Thus, in other aspects, described herein is a method of preventing and/or treating a disease (e.g., ALS and/or FTD) in a subject, the method comprising administering a repressor of a gene to the subject using AAV. In certain embodiments, the repressor is administered to the CNS (e.g., hippocampus and/or entorhinal cortex) or PNS (e.g., spinal cord/fluid) of the subject. In other embodiments, the repressor is administered intravenously. In certain embodiments, described herein is a method of preventing and/or treating ALS or FTD in a subject, the method comprising administering a repressor of a C9orf72 allele (wild-type and/or mutant) to the subject using one or more AAV vectors. In certain embodiments, the AAV encoding the genetic modulator is administered to the CNS (brain and/or CSF) via any delivery method including but not limited to, intracerebroventricular, intrathecal, intracranial, intravenous, intranasal, retro-orbital, or intracisternal delivery. In other embodiments, the AAV encoding the repressor is administered directly into the parenchyma (e.g., hippocampus and/or entorhinal cortex) of the subject. In other embodiments, the AAV encoding the repressor is administered intravenously (IV). In any of the methods described herein, the administering may be done once (single administration) or may be done multiple times (with any time between administrations) at the same or different doses per administration. When administered multiple times, the same or different dosages and/or delivery vehicles of modes of administration may be used (e.g., different AAV vectors administered IV and/or ICV). The methods include methods of reducing the loss of muscle function, the loss of physical coordination, stiffening of muscles, muscle spasms, loss of speech functions, difficulty of swallowing, cognitive impairment, method of reducing loss of motor function, and/or methods of reducing loss of one or more cognitive functions in ALS subjects, all in comparison with a subject not receiving the method, or in comparison to the subject themselves prior to receiving the methods. Thus, the methods described herein result in reduction in biomarkers and/or symptoms of rare diseases such as ALS or FTD, including one or more the following: the loss of muscle function, the loss of physical coordination, stiffening of muscles, muscle spasms, loss of speech functions, difficulty of swallowing, cognitive impairment, changes in blood and/or cerebral spinal fluid chemistries associated with ALS, including G-CSF, IL-2, IL-15, IL-17, MCP-1, MIP-1, TNF-, and VEGF levels (see Chen et al., Front Immunol. (2018) 9:2122), and/or other biomarkers known in the art. In certain embodiments, the methods may further comprise administering one or more genetic repressors of tau (MAPT), for example in subjects with FTD. See, e.g., U.S. Patent Publication No. 2018/0153921.
[0059] In any of the methods described herein, the repressor of the targeted allele may be a ZFP-TF, for example a fusion protein comprising a ZFP that binds specifically to an allele and a transcriptional repression domain (e.g., KOX, KRAB, etc.). In other embodiments, the repressor of the targeted allele may be a TALE-TF, for example a fusion protein comprising a TALE polypeptide that binds specifically to a gene allele and a transcriptional repression domain (e.g., KOX, KRAB, etc.). In some embodiments, the targeted allele repressor is a CRISPR/Cas-TF where the nuclease domains in the Cas protein have been inactivated such that the protein no longer cleaves DNA. The resultant Cas RNA-guided DNA binding domain is fused to a transcription repressor (e.g., KOX, KRAB, etc.) to repress the targeted allele. In some embodiments, the engineered transcription factor is able to repress expression of a mutated allele but not the wildtype allele. In further embodiments, the DNA binding molecule preferentially recognizes a hexameric GGGGCC (SEQ ID NO:1) expansion.
[0060] In some embodiments, the sequence encoding a genetic repressor as described herein (e.g., ZFP-TF, TALE-TF or CRISPR/Cas-TF) is inserted (integrated) into the genome while in other embodiments the sequence encoding the repressor is maintained episomally. In some instances, the nucleic acid encoding the TF fusion is inserted (e.g., via nuclease-mediated integration) at a safe harbor site comprising a promoter such that the endogenous promoter drives expression. In other embodiments, the repressor (TF) donor sequence is inserted (via nuclease-mediated integration) into a safe harbor site and the donor sequence comprises a promoter that drives expression of the repressor. In some embodiments, the promoter sequence is broadly expressed while in other embodiments, the promoter is tissue or cell/type specific. In preferred embodiments, the promoter sequence is specific for neuronal cells. In other embodiments, the promoter sequence is specific for muscle cells. In some embodiments, the promoter chosen is characterized in that it has low expression. Non-limiting examples of useful promoters include the neural specific promoters NSE, synapsin, CAMKiia and MECPs. Non-limiting examples of ubiquitous promoters include CMV, CAG and Ubc. Further embodiments include the use of self-regulating promoters as described in U.S. Patent Publication No. 2015/0267205. Further embodiments include the use of self-regulating promoters as described in U.S. Patent Publication No. 2015/0267205.
[0061] In any of the methods described herein, the method can yield about 50% or greater, 55% or greater, 60% or greater, 65% or greater, about 70% or greater, about 75% or greater, about 85% or greater, about 90% or greater, about 92% or greater, or about 95% or greater repression, 98% or greater, or 99% or greater of the target alleles (e.g., mutant or wild-type C9orf72) in one or more neurons of a subject (e.g., a subject with ALS). In certain embodiments, expression of the wild-type allele is repressed no more than 50% in the subject (as compared to untreated subjects) while the mutant allele is repressed at least 70% (70% or any value thereabove) in the subject (as compared to untreated subjects). In some embodiments, the expression of an antisense promoter is repressed at least 70%. In certain embodiments, the expression of the antisense promoters found in the region of the C9orf72 intron 1a, 1b and/or 1c is repressed at least 70% while the expression of the sense promoter in the region of the C9orf72 intron 1b is repressed no more than 50%.
[0062] In any of the methods described herein, the regulator (e.g., repressor or activator) may be delivered to the subject as a protein, polynucleotide or any combination of protein and polynucleotide. In certain embodiments, the one or more repressor are delivered using an AAV vector. In other embodiments, at least one component of the regulator (e.g., sgRNA of a CRISPR/Cas system) is delivered as an RNA form. In other embodiments, the regulator(s) is(are) delivered using a combination of any of the expression constructs described herein, for example one repressor (or portion thereof) on one expression construct (AAV9) and one repressor (or portion thereof) on a separate expression construct (AAV or other viral or non-viral construct).
[0063] Furthermore, in any of the methods described herein, the regulator (e.g., repressor) can be delivered to a cell (ex vivo or in vivo) at any concentration (dose) that provides the desired effect. In some embodiments, the regulator is delivered using an adeno-associated virus (AAV) vector at 10,000-500,000 vector genome/cell (or any value therebetween). In certain embodiments, the regulator is delivered using a lentiviral vector at MOI between 250 and 1,000 (or any value therebetween). In other embodiments, the regulator is delivered using a plasmid vector at 0.01-1,000 ng/100,000 cells (or any value therebetween). In other embodiments, the repressor is delivered as mRNA at 150-1,500 ng/100,000 cells (or any value therebetween). Furthermore, for in vivo uses, in any of the methods described herein, the genetic modulator(s) (e.g., repressors) can be delivered at any concentration (dose) that provides the desired effect in a subject in need thereof. In some embodiments, the repressor is delivered using an adeno-associated virus (AAV) vector at 10,000-500,000 vector genome/cell (or any value therebetween). In certain embodiments, the repressor is delivered using a lentiviral vector at MOI between 250 and 1,000 (or any value therebetween). In other embodiments, the repressor is delivered using a plasmid vector at 0.01-1,000 ng/100,000 cells (or any value therebetween). In other embodiments, the repressor is delivered as mRNA at 0.01-3000 ng/number of cells (e.g., 50,000-200,000 (e.g., 100,000) cells (or any value therebetween). In other embodiments, the repressor is delivered using an adeno-associated virus (AAV) vector at a fixed volume of 1-300 L to the brain parenchyma at 1E11-1E14 Vg/mL. In other embodiments, the repressor is delivered using an adeno-associated virus (AAV) vector at a fixed volume of 0.5-10 mL to the CSF at 1E11-1E14 Vg/mL.
[0064] In any of the methods described herein, the method can yield about 50% or greater, 55% or greater, 60% or greater, 65% or greater, about 70% or greater, about 75% or greater, about 85% or greater, about 90% or greater, about 92% or greater, or about 95% or greater modulation (e.g., repression) of the targeted allele(s) in one or more cells of the subject. In some embodiments, wild-type and mutant alleles are modulated differently, for example the mutant allele is preferentially modified as compared to the wild-type allele (e.g., mutant allele repressed by at least 70% and the wild-type allele is repressed by no more than 50%).
[0065] In any of the methods described herein, the method can yield about 50% or greater, 55% or greater, 60% or greater, 65% or greater, about 70% or greater, about 75% or greater, about 85% or greater, about 90% or greater, about 92% or greater, or about 95% or greater modulation (e.g., repression) of the antisense expression of the targeted allele(s) in one or more cells of the subject. In some embodiments, sense expression and antisense expression in the mutant alleles are modulated differently, for example expression of the antisense transcripts are preferentially modulated as compared to expression of the sense transcripts in the mutant allele (e.g., antisense expression is repressed by at least 70% and sense expression is repressed by no more than 50%).
[0066] In further aspects, the transcription factors as described herein, such as transcription factors comprising one or more of a zinc finger protein (ZFP-TFs), a TALEs (TALE-TF), and a CRISPR/Cas-TFs for example, ZFP-TFs, TALE-TFs or CRISPR/Cas-TFs, are used to repress expression of a mutant and/or wildtype allele (e.g., C9orf72) in of the brain (e.g., neuron), of a subject. The repression can be about 50% or greater, 55% or greater, 60% or greater, 65% or greater, 70% or greater, about 75% or greater, about 85% or greater, about 90% or greater, about 92% or greater, or about 95% or greater repression of the targeted alleles in the one or more cells of the subject as compared to untreated (wild-type) cells of the subject. In certain embodiments, repression of the wild-type allele is not more than 50% (as compared to untreated cells or subjects) and repression of the mutant (diseased or isoform variant) is at least 70% (as compared to untreated cells or subjects). In certain embodiments, antisense transcription is completely (fully) repressed. In certain embodiments, repression of a sense transcript is not more than 50% (as compared to untreated cells or subjects) and repression of the antisense transcript is at least 70% (as compared to untreated cells or subjects). In certain embodiments, the targeted-modulating transcription factor can be used to achieve one or more of the methods described herein.
[0067] Thus, described herein are methods and compositions for modulating expression of genes associated with the rare disorders disclosed herein, including repression with or without expression of an exogenous sequence (such as an artificial TF). The compositions and methods can be for use in vitro (e.g., for the provision of cells for the study of the target gene via its modulation; for drug discovery; and/or to make transgenic animals and animal models), in vivo or ex vivo, and comprise administering an artificial transcription factor or nuclease that includes a DNA-binding molecule targeted to the gene associated with the rare disease, optionally in the case of a nuclease with a donor that is integrated into the gene following cleavage by the nuclease. In some embodiments, the donor gene (transgene) is maintained extrachromosomally in a cell. In certain embodiments, the cell is in a patient with the disease. In other embodiments, the cell is modified by any of the methods described herein, and the modified cell is administered to a subject in need thereof (e.g., a subject with the rare disease). Genetically modified cells (e.g., stem cells, precursor cells, T cells, muscle cells, etc.) comprising a genetically modified gene (e.g., an exogenous sequence) are also provided, including cells made by the methods described herein. These cells can be used to provide therapeutic protein(s) to a subject with the rare disease, for example, by administering the cell(s) to a subject in need thereof or, alternatively, by isolating the protein produced by the cell and administering the protein to the subject in need thereof (enzyme replacement therapy).
[0068] Also provided is a kit comprising one or more of the genetic modulators (e.g., repressors) and/or polynucleotides comprising components of and/or encoding the target-modulators (or components thereof) as described herein. The kits may further comprise cells (e.g., neurons or muscle cells), reagents (e.g., for detecting and/or quantifying a protein, for example in CSF) and/or instructions for use, including the methods as described herein.
[0069] The present methods and compositions are further described in detail below.
I. Zinc-Finger Protein Transcription Factors
[0070] The present ZFP-TFs are fusion proteins containing a DNA-binding zinc finger protein (ZFP) domain and a transcription repressor domain, wherein the two domains may be associated with each other by a direct peptidyl linkage or a peptide linker, or by dimerization (e.g., through a leucine zipper, a STAT protein N-terminal domain, or an FK506 binding protein). As used herein, a fusion protein refers to a polypeptide with covalently linked domains as well as a complex of polypeptides associated with each other through non-covalent bonds. The transcription repressor domain can be associated with the ZFP domain at any suitable position, including the C- or N-terminus of the ZFP domain.
[0071] In some embodiments, the present ZFP-TFs repress transcription of a human mutant C9orf72 gene by 45% or more (e.g., by 50%, 60%, 70%, 80%, 90%, or 95% or more). In some embodiments, two or more of the present ZFP-TFs are used concurrently in a patient, where the ZFP-TFs bind to different DNA motifs in the sense and/or antisense strands of the expanded C9orf72 region, so as to achieve optimal repression of mutant C9orf72 transcription.
[0072] A. Targets of the ZFP Domains
[0073] The ZFP domains of the present fusion proteins bind preferentially to the expanded region in a mutant human C9orf72 gene allele. The human C9orf72 gene is located at the short (p) arm of chromosome 9 at position 21.2 (9p21.2). It spans base pairs 27,546,546 to 27,573,866 on the chromosome. The genomic structure of human C9orf72 is shown in
[0074] In some embodiments, the target sequence in the expanded region is at least 8 bps in length. For example, the target sequence may be 8 bps to 40 bps in length, such as 12, 15, 16, 17, 18, 19, 20, 21, 24, 27, 30, 33, or 36 bps in length. In certain embodiments, the target sequence of the present ZFP-TFs is 12-20 (e.g., 12-18, 15-19, 15, 18, or 19) bps in length. In some embodiments, the target sequence comprises subsequences that are not contiguous.
[0075] The G.sub.4C.sub.2 repeats give rise to the following hexanucleotide DNA motifs in the sense and antisense strands of the gene:
[0076] Motifs in the sense C9orf72 strand:
TABLE-US-00001 (i) (SEQIDNO:1) GGGGCC (ii) (SEQIDNO:2) GGGCCG (iii) (SEQIDNO:3) GGCCGG (iv) (SEQIDNO:4) GCCGGG (v) (SEQIDNO:5) CCGGGG (vi) (SEQIDNO:6) CGGGGC
[0077] Motifs in the antisense C9orf72 strand:
TABLE-US-00002 (vii) (SEQIDNO:7) GGCCCC (viii) (SEQIDNO:8) GCCCCG (ix) (SEQIDNO:9) CCCCGG (x) (SEQIDNO:10) CCCGGC (xi) (SEQIDNO:11) CCGGCC (xii) (SEQIDNO:12) CGGCCC
In some embodiments, the target sequence of the present ZFP-TF comprises one or more (e.g., 2, 3, or 4) tandem repeats of these DNA motifs. In some embodiments, the target sequence consists of three tandem repeats of one of the motifs. In some embodiments, the target sequence comprises one or more (e.g., 2 or 3) tandem repeats of a motif plus a few (e.g., 1, 2, 3, 4, or 5) nucleotides from an upstream and/or downstream adjacent sequence (e.g., CC(G.sub.4C.sub.2).sub.2GG) (SEQ ID NO:75).
[0078] The target sequence may be on the sense strand of the gene, or the antisense strand of the gene. In certain embodiments, ZFP-TFs used in a patient bind both the sense and antisense strands of the mutant allele. To ensure targeting accuracy and to reduce off-target binding by the ZFP-TFs, the sequence of the selected C9orf72 target region preferably has less than 75% homology (e.g., less than 70%, less than 65%, less than 60%, or less than 50% homology) to sequences in other genes in the genome.
[0079] Other criteria for further evaluating target segments include the prior availability of ZFPs binding to such segments or related segments, ease of designing new ZFPs to bind a given target segment, and off-target binding risk.
[0080] B. Zinc Finger Protein Domains
[0081] A zinc finger protein or ZFP refers to a protein having DNA-binding domains that are stabilized by zinc. ZFPs bind to DNA in a sequence-specific manner. The individual DNA-binding domains are referred to as fingers. A ZFP has at least one finger, each finger binds from two to four base pairs of DNA, typically three or four base pairs of DNA. Each zinc finger typically comprises approximately 30 amino acids and chelates zinc. An engineered ZFP can have a novel binding specificity, compared to a naturally-occurring zinc finger protein. Engineering methods include, but are not limited to, rational design and various types of selection. Rational design includes, for example, using databases comprising triplet (or quadruplet) nucleotide sequences and individual zinc finger amino acid sequences, in which each triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers that bind the particular triplet or quadruplet sequence. See, e.g., ZFP design methods described in detail in U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,140,081; 6,200,759; 6,453,242; 6,534,261; 6,979,539; 8,586,526; 8,841,260; 8,956,828; and 9,234,016; and International Patent Publications WO 95/19431; WO 96/06166; WO 98/53057; WO 98/53058; WO 98/53059; WO 98/53060; WO 98/54311; WO 00/27878; WO 01/60970; WO 01/88197; WO 02/016536; WO 02/099084; and WO 03/016496.
[0082] The ZFP domain of the present ZFP-TFs may include at least three (e.g., four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, or more) zinc fingers. A ZFP domain having three fingers typically recognizes a target site that includes 9 to 12 nucleotides. A ZFP domain having four fingers typically recognizes a target site that includes 12 to 15 nucleotides. A ZFP domain having five fingers typically recognizes a target site that includes 15 to 18 nucleotides. A ZFP domain having six fingers can recognize target sites that include 18 to 21 nucleotides.
[0083] The target specificity of the ZFP domain may be improved by mutations to the ZFP backbone as described in, e.g., U.S. Pat. Pub. 2018/0087072. The mutations include those made to residues in the ZFP backbone that can interact non-specifically with phosphates on the DNA backbone but are not involved in nucleotide target specificity. In some embodiments, these mutations comprise mutating a cationic amino acid residue to a neutral or anionic amino acid residue. In some embodiments, these mutations comprise mutating a polar amino acid residue to a neutral or non-polar amino acid residue. In further embodiments, mutations are made at positions (5), (9) and/or (14) relative to the DNA-binding helix. In some embodiments, a zinc finger may comprise one or more mutations at positions (5), (9) and/or (14). In further embodiments, one or more zinc fingers in a multi-finger ZFP domain may comprise mutations at positions (5), (9) and/or (14). In some embodiments, the amino acids at positions (5), (9) and/or (14) (e.g., an arginine (R) or lysine (K)) are mutated to an alanine (A), leucine (L), Ser (S), Asp (N), Glu (E), Tyr (Y), and/or glutamine (Q). In some embodiments, the R residue at position (5) is mutated to Q.
[0084] Alternatively, the DNA-binding domain may be derived from a nuclease. For example, the recognition sequences of homing endonucleases and meganucleases such as I-SceI, I-CeuI, PI-PspI, PI-Sce, I-SceIV, I-CsmI, I-PanI, I-SceII, I-PpoI, I-SceIII, I-CreI, I-TevI, I-TevII and I-TevIII are known. See also U.S. Pat. Nos. 5,420,032 and 6,833,252; Belfort et al., Nucleic Acids Res. (1997) 25:3379-88; Dujon et al., Gene (1989) 82:115-8; Perler et al., Nucleic Acids Res. (1994) 22:1125-7; Jasin, Trends Genet. (1996) 12:224-8; Gimble et al., J Mol Biol. (1996) 263:163-80; Argast et al., J Mol Biol. (1998) 280:345-53; and the New England Biolabs catalogue.
[0085] In some embodiments, the present ZFP-TFs comprise one or more zinc finger domains. The domains may be linked together via an extendable flexible linker such that, for example, one domain comprises one or more (e.g., 4, 5, or 6) zinc fingers and another domain comprises additional one or more (e.g., 4, 5, or 6) zinc fingers. In some embodiments, the linker is a standard inter-finger linker such that the finger array comprises one DNA-binding domain comprising 8, 9, 10, 11 or 12 or more fingers. In other embodiments, the linker is an atypical linker such as a flexible linker. For example, two ZFP domains may be linked to a transcription repressor TF in the configuration (from N terminus to C terminus) ZFP-ZFP-TF, TF-ZFP-ZFP, ZFP-TF-ZFP, or ZFP-TF-ZFP-TF (two ZFP-TF fusion proteins are fused together via a linker).
[0086] In some embodiments, the ZFP-TFs are two-handed, i.e., they contain two zinc finger clusters (two ZFP domains) separated by intervening amino acids so that the two ZFP domains bind to two discontinuous target sites. An example of a two-handed type of zinc finger binding protein is SIP1, where a cluster of four zinc fingers is located at the amino terminus of the protein and a cluster of three fingers is located at the carboxyl terminus (see Remacle et al., EMBO J. (1999) 18(18):5073-84). Each cluster of zinc fingers in these proteins is able to bind to a unique target sequence and the spacing between the two target sequences can comprise many nucleotides.
[0087] In alternative embodiments, the proteins that are similar to ZFP-TFs in function may be used in lieu of ZFP-TFs. For example, instead of ZFP domains, the transcription repressor fusion proteins may include a DNA-binding domain derived from a transcription activator like effectors (TALE) DNA-binding domain. See, e.g., U.S. Pat. Nos. 8,586,526 and 9,458,205; U.S. Patent Pubs. 2013/0196373 and 2013/0253040; WO 2010/079430; Schornack et al., J Plant Physiol (2006) 163(3):256-72); Kay et al., Science (2007) 318:648-51; Moscou and Bogdanove, Science (2009) 326:1501; and Boch et al., Science (2009) 326:1509-12. In yet another example, the transcription repressor fusion proteins may include a DNA-binding domain that is a single-guide RNA of a CRISPR/Cas system. See, e.g., U.S. Patent Pub. 2015/0056705; Jinek et al., Science (2012) 337:816; Ramalingam et al., Genome Biol. (2013) 14:107; Hwang et al., (2013) Nature Biotechnology 31(3):227.
[0088] C. Transcription Repressor Domains
[0089] The present ZFP-TFs comprise one or more transcription repressor domains that dampen the transcription activity of the mutant C9orf72 allele. Non-limiting examples of transcription repressor domains are the KRAB domain of KOX1, KAP-1, MAD, FKHR, EGR-1, ERD, SID, TGF-beta-inducible early gene (TIEG), v-ERB-A, MBD2, MBD3, members of the DNMT family (e.g., DNMT1, DNMT3A, DNMT3B), Rb, and MeCP2. See, e.g., Bird et al., Cell (1999) 99:451-54; Tyler et al., Cell (1999) 99:443-46; Knoepfler et al., Cell (1999) 99:447-50; and Robertson et al., Nature Genet. (2000) 25:338-42. Additional exemplary repression domains include, but are not limited to, ROM2 and AtHD2A. See, e.g., Chem et al., Plant Cell (1996) 8:305-21; and Wu et al., Plant J. (2000) 22:19-27.
[0090] In some embodiments, the transcription repressor domain comprises a sequence from the Kruppel-associated box (KRAB) domain of the human zinc finger protein 10/KOX1 (ZNF10/KOX1) (e.g., GenBank No. NM_015394.4). An exemplary KRAB domain sequence is:
TABLE-US-00003 (SEQIDNO:13) DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRN VMLENYKNLVSLGYQLTKPDVILRLEKGEEPWLVEREIHQ ETHPDSETAFEIKSSV
[0091] Variants of this KRAB sequence may also be used so long as they have the same or similar transcription repressor function.
[0092] D. Peptide Linkers
[0093] The ZFP domain and the transcription repressor domain of the present ZFP-TFs and/or the zinc fingers within the ZFP domains may be linked through a peptide linker, e.g., a noncleavable peptide linker of about 5 to 200 amino acids (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids). Some preferred linkers are flexible amino acid sequences that are synthesized as a recombinant fusion protein. See, e.g., description above; and U.S. Pat. Nos. 6,479,626; 6,903,185; 7,153,949; 8,772,453; and 9,163,245; and WO 2011/139349. The proteins described herein may include any combination of suitable linkers. Non-limiting examples of linkers are DGGGS (SEQ ID NO:14), TGEKP (SEQ ID NO:15), LRQKDGERP (SEQ ID NO:16), GGRR (SEQ ID NO:17), GGRRGGGS (SEQ ID NO:18), LRQRDGERP (SEQ ID NO:19), LRQKDGGGSERP (SEQ ID NO:20), LRQKD(G.sub.3S).sub.2ERP (SEQ ID NO:21), TGSQKP (SEQ ID NO:22), LRQKDAARGS (SEQ ID NO:26), and LRQKDAARGSGG (SEQ ID NO:76).
[0094] In some embodiments, the peptide linker is 3 to 20 amino acid residues in length and is rich in G and/or S. Non-limiting examples of such linkers are G.sub.4S-type linkers (G.sub.4S disclosed as SEQ ID NO:23), i.e., linkers containing one or more (e.g., 2, 3, or 4) GGGGS (SEQ ID NO:23) motifs, or variations of the motif (such as ones that have one, two, or three amino acid insertions, deletions, and substitutions in the motif).
[0095] In some embodiments, the ZFP-TFs comprise nuclear localization signals (e.g., that from the SV40 medium T-antigen) and/or epitope tags (e.g., FLAG and hemagglutinin).
II. Expression of the ZFP-TFs
[0096] A ZFP-TF of the present disclosure may be introduced to a patient through a nucleic acid molecule encoding it. For example, the nucleic acid molecule is an RNA molecule, and the RNA molecule is introduced into the brain of the patient through injection of a composition comprising a lipid:nucleic acid complex (e.g., a liposome). Alternatively, the ZFP-TF may be introduced to the patient through a nucleic acid expression vector comprising a coding sequence for the ZFP-TF. The expression vectors may include expression control sequences such as promoters, enhancers, transcription signal sequences, and transcription termination sequences that allow expression of the coding sequences for the ZFP-TFs in the cells of the nervous system (e.g., central nervous system). In some embodiments, the expression vector remains present in the cell as a stable episome. In other embodiments, the expression vector is integrated into the genome of the cell.
[0097] In some embodiments, the promoter on the vector for directing the ZFP-TF expression in the brain is a constitutively active promoter or an inducible promoter. Suitable promoters include, without limitation, a Rous sarcoma virus (RSV) long terminal repeat (LTR) promoter (optionally with an RSV enhancer), a cytomegalovirus (CMV) promoter (optionally with a CMV enhancer), a CMV immediate early promoter, a simian virus 40 (SV40) promoter, a dihydrofolate reductase (DHFR) promoter, a -actin promoter, a phosphoglycerate kinase (PGK) promoter, an EF1 promoter, a Moloney murine leukemia virus (MoMLV) LTR, a creatine kinase-based (CK6) promoter, a transthyretin promoter (TTR), a thymidine kinase (TK) promoter, a tetracycline responsive promoter (TRE), a hepatitis B virus (HBV) promoter, a human al-antitrypsin (hAAT) promoter, chimeric liver-specific promoters (LSPs), an E2 factor (E2F) promoter, the human telomerase reverse transcriptase (hTERT) promoter, a CMV enhancer/chicken -actin/rabbit -globin promoter (CAG promoter; Niwa et al., Gene (1991) 108(2):193-9), and an RU-486-responsive promoter. Neuron-specific promoters such as the synapsin I promoter, the calcium/calmodulin-dependent protein kinase II (CamKII) promoter, the methyl CpG-binding protein 2 (MeCP2) promoter, the choline acetyltransferase (ChAT) promoter, and the Calbindin (Calb) promoter may also be used. Astrocyte-specific promoters such as the glial fibrillary acidic protein (GFAP) promoter or the aldehyde dehydrogenase 1 family, member L1 (Aldh1L1) promoter may also be used. Oligodendrocyte-specific promoters such as the Olig2 promoter may also be used. In addition, the promoter may include one or more self-regulating elements whereby the ZFP-TF can bind to and repress its own expression level to a preset threshold. See U.S. Pat. No. 9,624,498.
[0098] Any method of introducing the nucleotide sequence into a cell may be employed, including but not limited to, electroporation, calcium phosphate precipitation, microinjection, cationic or anionic liposomes, liposomes in combination with a nuclear localization signal, naturally occurring liposomes (e.g., exosomes), or viral transduction.
[0099] For in vivo delivery of an expression vector, viral transduction may be used. A variety of viral vectors known in the art may be adapted for use in the present disclosure, for example, vaccinia vectors, adenoviral vectors, lentiviral vectors, poxyviral vectors, herpesviral vectors, adeno-associated viral (AAV) vectors, retroviral vectors, and hybrid viral vectors. In some embodiments, the viral vector used herein is a recombinant AAV (rAAV) vector. AAV vectors are especially suitable for central nervous system (CNS) gene delivery because AAVs infect both dividing and non-dividing cells and have very low immunogenicity, and the viral genomes exist as stable episomal structures for long term expression (Hadaczek et al., Mol Ther. (2010) 18:1458-61; Zaiss, et al., Gene Ther. (2008) 15:808-16). Any suitable AAV serotype may be used. For example, the AAV may be AAV1, AAV2, AAV3, AAV3b, AAV4, AAV5, AAV6, AAV7, AAV8, AAV8.2, AAV9, or AAVrh10, or of a pseudotype (e.g., AAV2/8, AAV2/5, AAV2/6, AAV2/9, or AAV2/6/9). See, e.g., U.S. Pat. Nos. 7,198,951 and 9,585,971.
[0100] In some embodiments, the expression vector is an AAV vector and is introduced to the target human cell by a recombinant AAV virion whose genome comprises the construct, including having the AAV Inverted Terminal Repeat (ITR) sequences on both ends to allow the production of the AAV virion in a production system such as an insect cell/baculovirus production system or a mammalian cell production system. The AAV may be engineered such that its capsid proteins have reduced immunogenicity or enhanced transduction ability in humans. In some embodiments, AAV9 is used. Viral vectors described herein may be produced using methods known in the art. Any suitable permissive or packaging cell type may be employed to produce the viral particles. For example, mammalian (e.g., 293) or insect (e.g., Sf9) cells may be used as the packaging cell line.
[0101] See also U.S. Pat. Nos. 6,309,634; 6,453,242; 6,503,717; 6,534,261; 6,599,692; 6,607,882; 6,689,558; 6,824,978; 6,933,113; 6,953,575; 6,979,539; 7,013,219; 7,163,824; 7,182,944; 8,309,355; 8,337,458; 8,586,526; 9,050,299; and 9,089,667 for methods of expressing therapeutic proteins, including ZFPs, in the nervous system of a patient in need thereof.
III. Pharmaceutical Applications
[0102] The present ZFP-TFs can be used to treat patients in need of downregulation of C9orf72 expression, especially downregulation of expression of mutant C9orf72 alleles. The patients suffer from, or are at risk of developing, C9orf72-related neurodegenerative diseases such as ALS and C9FTD. Patients at risk include those who are genetically predisposed, those who have suffered repeated brain injuries such as concussions, and those who have been exposed to environmental neurotoxins. The present disclosure provides a method of treating a C9orf72-related neurological disease (e.g., ALS and C9FTD) in a subject such as a human patient in need thereof, comprising introducing to the nervous system (e.g., CNS) of the subject a therapeutically effective amount (e.g., an amount that allows sufficient repression of the mutant C9orf72 allele expression) of the ZFP-TF (e.g., an rAAV vector expressing it). The term treating encompasses alleviation of symptoms, prevention of onset of symptoms, slowing of disease progression, improvement of quality of life, and increased survival.
[0103] The present disclosure provides a pharmaceutical composition comprising a viral vector such as an rAAV whose recombinant genome comprises an expression cassette for the ZFP-TFs. The pharmaceutical composition may further comprise a pharmaceutically acceptable carrier such as water, saline (e.g., phosphate-buffered saline), dextrose, glycerol, sucrose, lactose, gelatin, dextran, albumin, or pectin. In addition, the composition may contain auxiliary substances, such as, wetting or emulsifying agents, pH-buffering agents, stabilizing agents, or other reagents that enhance the effectiveness of the pharmaceutical composition. The pharmaceutical composition may contain delivery vehicles such as liposomes, nanocapsules, microparticles, microspheres, lipid particles, and vesicles.
[0104] The cells targeted by the therapeutics of the present disclosure are cells in the brain and/or the spinal cord, including, without limitation, a neuronal cell (e.g., a motor neuron, a sensory neuron, a dopaminergic neuron, a cholinergic neuron, a glutamatergic neuron, a GABAergic neuron, or a serotonergic neuron); a glial cell (e.g., an oligodendrocyte, an astrocyte, a pericyte, a Schwann cell, or a microglial cell); an ependymal cell; or a neuroepithelial cell. The brain regions targeted may be cortical regions, frontotemporal regions, the entorhinal cortex, the hippocampus, the cerebellum, the pons, and the medulla. These regions can be reached directly through intrahippocampal injection, intracerebral injection, intra-cisterna magna (ICM) injection, or more generally through intraparenchymal injection, intracerebroventricular (ICV) injection, intrathecal injection, or intravenous injection. Other routes of administration include, without limitation, intracerebral, intraventricular, intranasal, or intraocular administration. In some embodiments, the viral vector spreads throughout the CNS tissue following direct administration into the cerebrospinal fluid (CSF), e.g., via intrathecal and/or intracerebral injection, or intra-cisterna magna injection or intracerebroventricular injection. In other embodiments, the viral vectors cross the blood-brain barrier and achieve wide-spread distribution throughout the CNS tissue of a subject following intravenous administration. In other embodiments, the viral vectors are delivered directly to the target regions via intraparenchymal injections. In some cases, the viral vectors may undergo retrograde or anterograde transport to other brain regions following intraparenchymal delivery. In some aspects, the viral vectors have distinct CNS tissue targeting capabilities (e.g., CNS tissue tropisms), which achieve stable and nontoxic gene transfer at high efficiencies.
[0105] By way of example, the pharmaceutical composition may be provided to the patient through intraventricular administration, e.g., into a ventricular region of the forebrain of the patient such as the right lateral ventricle, the left lateral ventricle, the third ventricle, or the fourth ventricle. The pharmaceutical composition may be provided to the patient through intracerebral administration, e.g., injection of the composition into or near the cerebrum, medulla, pons, cerebellum, intracranial cavity, meninges, dura mater, arachnoid mater, or pia mater of the brain. Intracerebral administration may include, in some cases, administration of an agent into the cerebrospinal fluid (CSF) of the subarachnoid space surrounding the brain.
[0106] In some cases, intracerebral administration involves injection using stereotaxic procedures. Stereotaxic procedures are well known in the art and typically involve the use of a computer and a three-dimensional scanning device that are used together to guide injection to a particular intracerebral region, e.g., a ventricular region. Micro-injection pumps (e.g., from World Precision Instruments) may also be used. In some cases, a microinjection pump is used to deliver a composition comprising a viral vector. In some cases, the infusion rate of the composition is in a range of 1 l/min to 100 l/min. As will be appreciated by the skilled artisan, infusion rates will depend on a variety of factors, including, for example, age of the subject, weight/size of the subject, serotype of the AAV, dosage required, and intracerebral region targeted. Thus, other infusion rates may be deemed by a skilled artisan to be appropriate in certain circumstances.
[0107] Delivery of rAAVs to a subject may be accomplished, for example, by intravenous administration. In certain instances, it may be desirable to deliver the rAAVs locally to the brain tissue, the spinal cord, cerebrospinal fluid (CSF), neuronal cells, glial cells, meninges, astrocytes, oligodendrocytes, interstitial spaces, and the like. In some cases, recombinant AAVs (e.g., 10.sup.7-10.sup.15 Vg/dose) may be delivered directly to the CNS by injection into the ventricular region, and/or to the hippocampus, cortex, cerebellar lobule, or other brain region. AAVs may be delivered with a needle, a catheter or a related device, using neurosurgical techniques known in the art, such as by stereotactic injection. See, e.g., Stein et al., J Vir. (1999) 73:3424-9; Davidson et al., PNAS. (2000) 97:3428-32; Davidson et al., Nat Genet. (1993) 3:219-223; and Alisky and Davidson, Hum. Gene Ther. (2000) 11:2315-29; U.S. Pat. Nos. 7,837,668 and 8,092,429.
[0108] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure. In case of conflict, the present specification, including definitions, will control. Generally, nomenclature used in connection with, and techniques of neurology, medicine, medicinal and pharmaceutical chemistry, and cell biology described herein are those well-known and commonly used in the art. Enzymatic reactions and purification techniques are performed according to manufacturer's specifications, as commonly accomplished in the art or as described herein. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Throughout this specification and embodiments, the words have and comprise, or variations such as has, having, comprises, or comprising, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers. All publications and other references mentioned herein are incorporated by reference in their entirety. Although a number of documents are cited herein, this citation does not constitute an admission that any of these documents forms part of the common general knowledge in the art. As used herein, the term approximately or about as applied to one or more values of interest refers to a value that is similar to a stated reference value. In certain embodiments, the term refers to a range of values that fall within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context.
[0109] In order that this invention may be better understood, the following embodiments and examples are set forth. These embodiments and examples are for purposes of illustration only and are not to be construed as limiting the scope of the invention in any manner.
IV. Exemplary Embodiments
[0110] Non-limiting exemplary embodiments of the present disclosure are described below.
1. A method of repressing sense and/or anti-sense transcription of a C9orf72 gene in a cell, the method comprising treating the cell with one or more repressors of the C9orf72 gene, the one or more repressors comprising a transcriptional repression domain and a DNA-binding domain that binds to a target site in the C9orf72 gene, optionally wherein the one or more repressors comprise one or more zinc finger protein transcription factors (ZFP-TF), one or more TAL-effector domain transcription factors (TALE-TF), and/or one or more CRISPR/Cas transcription factors.
2. The method of claim 1, wherein the C9orf72 gene comprises a mutant allele comprising one or more expanded (G.sub.4C.sub.2) repeats, optionally wherein the target site is within the one or more (G.sub.4C.sub.2) repeats.
3. Use of one or more ZFP-TF, TALE-TF and/or CRISPR/Cas TF repressors that bind to a mutant C9orf72 expanded allele comprising one or more (G.sub.4C.sub.2) repeats for repression of sense and/or antisense transcription in a subject in need thereof.
4. The method or use of any of the preceding embodiments, wherein antisense transcription is repressed by at least 50% as compared to untreated cells.
5. The method or use of any of the preceding embodiments, wherein antisense transcription is repressed by at least 70% as compared to untreated cells.
6. The method of use of any of the preceding embodiments, wherein transcripts comprising the expanded repeat are selectively repressed, optionally wherein antisense transcription is repressed, sense transcription from the 1a promoter is repressed and/or sense transcription from the 1b promoter is not repressed.
7. The method or use of any of the preceding embodiments, wherein the one or more ZFP-TF repressors comprise a ZFP having the recognition helix regions in the order shown in Table 1.
8. The method or use of any of the preceding embodiments, wherein the one or more ZFP-TF repressors are administered to the cell as mRNA or using a viral vector.
9. The method or use of embodiment 8, wherein the viral vector is an Ad or AAV vector.
10. The method or use of embodiment 9, wherein the AAV vector is an AAV2/9 vector.
11. The method or use of any of the preceding embodiments wherein the cell is in a live subject and the one or more ZFP-TF repressors are administered to the subject.
12. The method or use of embodiment 11, wherein the one or more ZFP-TF repressors are administered intracerebroventricular, intrathecal, intracranial, retro-orbital (RO), intravenous, intranasal and/or intracisternal intravenously to the subject.
13. The method or use of embodiment 12, wherein the ZFP-TF repressor is administered unilaterally or bilaterally to the hippocampus of the subject, optionally using an AAV vector at a dose of 1E10 to 1E13 (e.g., 6E11) vg/hemisphere.
14. The method or use of any of the preceding embodiments wherein the cell is a neuron.
15. The method or use of any of the previous embodiments, wherein two more ZFP-TF repressors are administered.
16. The method or use of embodiment 15, wherein the two or more ZFP-TF repressors are carried on the same or different non-viral or viral vector.
17. The method or use of any of the preceding embodiments, wherein ALS and/or FTD is treated in the subject.
18. The method or use of any of the preceding embodiments, wherein one or more symptoms of ALS and/or FTD are ameliorated in the subject.
19. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 78021.
20. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 75114.
21. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 75115.
22. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 74969.
23. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79895.
24. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79898.
25. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 74986.
26. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79899.
27. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79901.
28. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79902.
29. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79904.
30. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79916.
31. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 75027.
32. A ZFP-TF fusion protein that binds to a target sequence and comprises the zinc fingers corresponding to an SBS ID as shown in Table 1, the zinc fingers comprising the DNA-binding (recognition) helix sequences shown in a single row of Table 1 for the SBS ID, wherein the SBS ID is 79921.
33. The ZFP-TF fusion protein of any one of embodiments 19-32, wherein the ZFP-TF fusion protein comprises a transcription repressor domain comprising SEQ ID NO:13.
34. The ZFP-TF fusion protein of any one of embodiments 19-33, wherein the zinc finger domain and the transcription repressor domain are linked by a peptide linker comprising SEQ ID NO:26.
EXAMPLES
Example 1: Artificial Transcriptional Repressors
[0111] A panel of ZFP-TFs were generated to target expanded human C9orf72 alleles. Exemplary ZFP-TFs are shown in Table 1 below. These ZFP-TFs each contained a ZFP domain having six fingers and a KRAB domain as described above (SEQ ID NO:13). A peptide linker was used to link the ZFP domain to the KRAB domain. The linker had the following amino acid sequence: LRQKDAARGS (SEQ ID NO:26).
[0112] Table 1 shows the DNA sequence of the target site and the amino acid sequence of the DNA-binding helix of each zinc finger (F1 to F6) in each ZFP-TF. SEQ ID NOs are shown in parenthesis. The target sequence bound by the ZFP domain in the target site is shown in upper case, while flanking sequences are shown in lower case. SEQ ID NO:24 is the target site on the sense strand of the gene allele, while SEQ ID NO:25 is the target site on the antisense of the gene allele.
[0113] The DNA-binding helix is the variable part of a zinc finger and typically contains six or seven amino acid residues. The target specificity of the ZFP domain may be improved by mutations to the ZFP backbone as described in, e.g., U.S. Pat. Pub. 2018/0087072. The symbol {circumflex over ()} in the table indicates that arginine (R) residue at the 4th position upstream of the 1st amino acid in the indicated helix is changed to glutamine (Q). In each zinc finger helix sequence, the positions of the seven DNA-binding amino acids are numbered 1, +1, +2, +3, +4, +5, and +6. Thus, the position for the R-to-Q substitution is numbered as (5).
TABLE-US-00004 TABLE1 ExemplaryC9orf72ZFP-TF ZincFingerDNA-BindingHelix Targetsite AminoAcidSequences(SEQIDNO) SBSID (SEQIDNO) F1 F2 F3 F4 F5 F6 74949 taGGGGCCGGGGCCGGG DRSDLSR RSTHLVR DRSDLSR RSTHLVR DRSDLSR RSTHLVR GCCggggcgtg(24) (27) (28) (27) (28) (27) (28) 74951 taGGGGCCGGGGCCGGG DRSDLSR RSAHLSR DRSDLSR RSAHLSR DRSDLSR RSAHLSR GCCggggcgtg(24) (27) (29) (27) (29) (27) (29) 74954 taGGGGCCGGGGCCGGG ERGDLKR RSAHLSR ERGDLKR RSAHLSR ERGDLKR RSAHLSR GCCggggcgtg(24) (30) (29) (30) (29) (30) (29) 74955 taGGGGCCGGGGCCGGG ERGTLAR RSAHLSR ERGTLAR RSAHLSR ERGTLAR RSAHLSR GCCggggcgtg(24) (31) (29) (31) (29) (31) (29) 74964 tagGGGCCGGGGCCGGG RSADLSE RSAHLSR RSADLSE RSAHLSR RSADLSE RSAHLSR GCCGgggcgtg(24) (32) (29) (32) (29) (32) (29) 74969 taggGGCCGGGGCCGGG RSDHLSE DRSHLAR RSDHLSE DRSHLAR RSDHLSE DRSHLAR GCCGGggcgtg(24) (33) (34) (33) (34) (33) (34) 74971 taggGGCCGGGGCCGGG RSDHLSQ DNSHRTR RSDHLSQ DNSHRTR RSDHLSQ DNSHRTR GCCGGggcgtg(24) (35) (36) (35) (36) (35) (36) 74973 taggGGCCGGGGCCGGG RNGHLLD DRSHLAR RNGHLLD DRSHLAR RNGHLLD DRSHLAR GCCGGggcgtg(24) (37) (34) (37) (34) (37) (34) 74978 taggGGCCGGGGCCGGG RNGHLLD DNSHRTR RNGHLLD DNSHRTR RNGHLLD DNSHRTR GCCGGggcgtg(24) (37) (36) (37) (36) (37) (36) 74979 taggGGCCGGGGCCGGG RSAHLSE DNSHRTR RSAHLSE DNSHRTR RSAHLSE DNSHRTR GCCGGggcgtg(24) (38) (36) (38) (36) (38) (36) 74983 tagggGCCGGGGCCGGG RSAHLSR DRSDLSR RSAHLSR DRSDLSR RSAHLSR DRSDLSR GCCGGGgcgtg(24) (29) (27) (29) (27) (29) (27) 74984 tagggGCCGGGGCCGGG RSDHLSR DWTTRRR RSDHLSR DWTTRRR RSDHLSR DWTTRRR GCCGGGgcgtg(24) (39) (40) (39) (40) (39) (40) 74986 tagggGCCGGGGCCGGG RSAHLSR HRKSLSR RSAHLSR HRKSLSR RSAHLSR HRKSLSR GCCGGGgcgtg(24) (29) (41) (29) (41) (29) (41) 74987 tagggGCCGGGGCCGGG RSAHLSR DSSDRKK RSAHLSR DSSDRKK RSAHLSR DSSDRKK GCCGGGgcgtg(24) (29) (42) (29) (42) (29) (42) 74988 tagggGCCGGGGCCGGG RSAHLSR DSSTRRR RSAHLSR DSSTRRR RSAHLSR DSSTRRR GCCGGGgcgtg(24) (29) (43) (29) (43) (29) (43) 74997 taggggCCGGGGCCGGG RSAHLSR RSDDRKT RSAHLSR RSDDRKT RSAHLSR RSDDRKT GCCGGGGcgtg(24) (29) (44) (29) (44) (29) (44) 74998 taggggCCGGGGCCGGG RSAHLSR RSADRKT RSAHLSR RSADRKT RSAHLSR RSADRKT GCCGGGGcgtg(24) (29) (45) (29) (45) (29) (45) 75001 taggggCCGGGGCCGGG RSAHLSR RNADRIT RSAHLSR RNADRIT RSAHLSR RNADRIT GCCGGGGcgtg(24) (29) (46) (29) (46) (29) (46) 75003 taggggCCGGGGCCGGG RSAHLSR RRATLLD RSAHLSR RRATLLD RSAHLSR RRATLLD GCCGGGGcgtg(24) (29) (47) (29) (47) (29) (47) 75023 cacGCCCCGGCCCCGGC RSDTLSV DTSTRTK RSDTLSV DTSTRTK RSDTLSV DTSTRTK CCCGgccccta(25) (48) (49) (48) (49) (48) (49) 75027 cacGCCCCGGCCCCGGC RNADRIT HRKSLSR RNADRIT HRKSLSR RNADRIT RNADRIT CCCGgccccta(25) (46) (41) (46) (41) (46) (46) 75031 cacGCCCCGGCCCCGGC RSADRKT HRKSLSR RSADRKT HRKSLSR RSADRKT HRKSLSR CCCGgccccta(25) (45) (41) (45) (41) (45) (41) 75032 cacGCCCCGGCCCCGGC RSATLSE HRKSLSR RSATLSE HRKSLSR RSATLSE HRKSLSR CCCGgccccta(25) (50) (41) (50) (41) (50) (41) 75055 cacGCCCCGGCCCCGGC RSADRKT DSSTRRR RSADRKT DSSTRRR RSADRKT DSSTRRR CCCGgccccta(25) (45) (43) (45) (43) (45) (43) 75078 cacGCCCCGGCCCCGGC RSADLSE HHRSLHR RSADLSE HHRSLHR RSADLSE HHRSLHR CCCGgccccta(25) (32) (51) (32) (51) (32) (51) 75090 cacgCCCCGGCCCCGGC RSDHLSE TSSDRTK RSDHLSE TSSDRTK RSDHLSE TSSDRTK CCCGGccccta(25) (33) (52) (33) (52) (33) (52) 75105 cacgcCCCGGCCCCGGC DRSHLTR DSSTRKT DRSHLTR DSSTRKT DRSHLTR DSSTRKT CCCGGCcccta(25) (53) (54) (53) (54) (53) (54) 75109 cacgccCCGGCCCCGGC DKRDLAR RSADRKT DKRDLAR RSADRKT DKRDLAR RSADRKT CCCGGCCccta(25) (55) (45) (55) (45) (55) (45) 75114 cacgccCCGGCCCCGGC ERGTLAR RSADRKT ERGTLAR RSADRKT ERGTLAR RSADRKT CCCGGCCccta(25) (31) (45) (31) (45) (31) (45) 75115 cacgccCCGGCCCCGGC ERRDLRR RSADRKT ERRDLRR RSADRKT ERRDLRR RSADRKT CCCGGCCccta(25) (77) (45) (77) (45) (77) (45) 74967 taggGGCCGGGGCCGGG RSDHLSE SSRYRTK RSDHLSE SSRYRTK RSDHLSE SSRYRTK GCCGGggcgtg(24) (33) (56) (33) (56) (33) (56) 78021 cacgcCCCGGCCCCGGC DRSHLTR DSSTRKT DRSHLTR DSSTRKT DRSHLTR DSSTRKT CCCGGCcccta(25) {circumflex over ()}(53) (54) (53) (54) (53) (54) 78025 cacgccCCGGCCCCGGC DKRDLAR RSADRKT DKRDLAR RSADRKT DKRDLAR RSADRKT CCCGGCCccta(25) {circumflex over ()}(55) (45) (55) (45) (55) (45) 78029 cacgccCCGGCCCCGGC ERRDLRR RSADRKT ERRDLRR RSADRKT ERRDLRR RSADRKT CCCGGCCccta(25) {circumflex over ()}(77) (45) (77) (45) (77) (45) 78033 cacgccCCGGCCCCGGC ERRDLRR RSADRKT ERRDLRR RSADRKT ERRDLRR RSADRKT CCCGGCCccta(25) {circumflex over ()}(77) (45) (77) (45) (77) (45) 79895 taggGGCCGGGGCCGGG RSDHLSE DRSHLAR RSDHLSE DRSHLAR RSDHLSE DRSHLAR GCCGGggcgtg(24) (33) {circumflex over ()}(34) {circumflex over ()}(33) (34) {circumflex over ()}(33) (34) 79897 taggGGCCGGGGCCGGG RSDHLSE DRSHLAR RSDHLSE DRSHLAR RSDHLSE DRSHLAR GCCGGggcgtg(24) {circumflex over ()}(33) {circumflex over ()}(34) {circumflex over ()}(33) (34) {circumflex over ()}(33) (34) 79898 taggGGCCGGGGCCGGG RSDHLSE DRSHLAR RSDHLSE DRSHLAR RSDHLSE DRSHLAR GCCGGggcgtg(24) {circumflex over ()}(33) (34) {circumflex over ()}(33) {circumflex over ()}(34) (33) {circumflex over ()}(34) 79899 tagggGCCGGGGCCGGG RSAHLSR HRKSLSR RSAHLSR HRKSLSR RSAHLSR HRKSLSR GCCGGGgcgtg(24) {circumflex over ()}(29) (41) {circumflex over ()}(29) (41) (29) (41) 79901 tagggGCCGGGGCCGGG RSAHLSR HRKSLSR RSAHLSR HRKSLSR RSAHLSR HRKSLSR GCCGGGgcgtg(24) (29) (41) {circumflex over ()}(29) (41) {circumflex over ()}(29) (41) 79902 tagggGCCGGGGCCGGG RSAHLSR HRKSLSR RSAHLSR HRKSLSR RSAHLSR HRKSLSR GCCGGGgcgtg(24) (29) (41) {circumflex over ()}(29) (41) (29) {circumflex over ()}(41) 79903 tagggGCCGGGGCCGGG RSAHLSR HRKSLSR RSAHLSR HRKSLSR RSAHLSR HRKSLSR GCCGGGgcgtg(24) (29) {circumflex over ()}(41) {circumflex over ()}(29) (41) {circumflex over ()}(29) (41) 79904 tagggGCCGGGGCCGGG RSAHLSR HRKSLSR RSAHLSR HRKSLSR RSAHLSR HRKSLSR GCCGGGgcgtg(24) (29) {circumflex over ()}(41) (29) {circumflex over ()}(41) (29) {circumflex over ()}(41) 75025 cacGCCCCGGCCCCGGC REQDLKQ HRKSLSR REQDLKQ HRKSLSR REQDLKQ HRKSLSR CCCGgccccta(25) (57) (41) (57) (41) (57) (41) 79915 cacGCCCCGGCCCCGGC REQDLKQ HRKSLSR REQDLKQ HRKSLSR REQDLKQ HRKSLSR CCCGgccccta(25) {circumflex over ()}(57) {circumflex over ()}(41) {circumflex over ()}(57) {circumflex over ()}(41) (57) (41) 79916 cacGCCCCGGCCCCGGC REQDLKQ HRKSLSR REQDLKQ HRKSLSR REQDLKQ HRKSLSR CCCGgccccta(25) (57) {circumflex over ()}(41) (57) {circumflex over ()}(41) (57) (41) 79921 cacGCCCCGGCCCCGGC RNADRIT HRKSLSR RNADRIT HRKSLSR RNADRIT HRKSLSR CCCGgccccta(25) {circumflex over ()}(46) {circumflex over ()}(41) {circumflex over ()}(46) (41) {circumflex over ()}(46) (41)
[0114] The ZFP-TFs were evaluated by standard SELEX analysis (see, e.g., Miller et al., Nat Biotech. (2010) doi:10.1038/nbt.1755; Wilen et al., PLoS (2011) 7(4):e1002020). All were shown to bind to their target sites.
[0115] Five types of human cell lines and one mouse cell line were used in the study. The C9021 fibroblast cell line was obtained from The ALS Institute at Columbia University and was derived from an ALS-FTD patient. It contains 5 G.sub.4C.sub.2 repeats on its normal allele and approximately 850 repeats on its expanded allele. The wildtype fibroblast cell line (NDS00035), the 353TRAD and 204TDP fibroblast lines were obtained from the National Institute of Neurological Disorders and Stroke. The wildtype line contains two G.sub.4C.sub.2 repeats on each allele. 353TRAD line contains 5 repeats on one allele and 8 repeats on the other allele. 204TDP has 2 repeats on one allele and 20 repeats on the other allele. For all fibroblast experiments, human neurons were obtained from Cell Dynamics International (iCell GABANeurons Kit, 01434; Cat # R1013; Cell Lot #104901). Mouse cortex neurons were obtained from GIBCO (Cat # A15586). ZFP 74960, which binds to its target region but had no observable repression effect, was used as a negative control.
[0116] For all experiments done inpatient derived fibroblast cells, transfection of ZFP-TFs mRNAs into the cells was performed using 96-well Shuttle Nucleofector system from Lonza. 1, 3, 10, 30, 100, and 300 ng of ZFP-TF mRNA per 40,000 cells were transfected using Amaxa P2 Primary Cells Nucleofector kit using the CA-137 program. After overnight incubation, a Cells-to-Ct kit (Thermo Fisher Scientific) was used to generate cDNA from transfected cells followed by gene expression analysis using qRT-PCR.
[0117] For neuronal transduction, ZFPs were made into AAV6 plasmids. Neurons were transduced with AAV6-ZFP. All transductions were performed at 3,000 MOI. Mouse neurons were collected 7 days post transduction while human neurons were collected 19 days post transduction. After collecting the cells, they were processed for microarray analysis.
[0118] Screening analysis was performed in multiple rounds. In each round, ZFPs were tested at multiple concentrations to identify ZFP-TFs with suitable on target (selective repression) pattern. Round 2 of screening was done in C9 (C9021) cells to evaluate the levels of the expanded sense transcript (disease) C9orf72 vs. total C9orf72 (total C9) mature mRNA following ZFP-TF treatment. The RT-PCR assay used a primer/probe set that targets intronic region 1a.
TABLE-US-00005 ExpandedsenseC9orf72transcript: Forward: (SEQIDNO:61) 5CCCTCTCTCCCCACTACTTG3 Reverse: (SEQIDNO:62) 5CTACAGGCTGCGGTTGTTTCC3 Probe: (SEQIDNO:63) 5TCTCACAGTACTCGCTGAGGGTGA3
[0119] The G.sub.4C.sub.2 expansion leads to inefficient splicing and accumulation of the expansion-containing pre-mRNA (
[0120] In order to evaluate repression of total C9orf72 mRNA, a different primer/probe set, denoted as Total C9 (
TABLE-US-00006 TotalC9orf72mRNA: Forward: (SEQIDNO:58) 5CTATGTGTGTGGTGGGATATGG3 Reverse: (SEQIDNO:59) 5CTCCAGGTTATGTGAAGCAGAA3 Probe: (SEQIDNO:60) 5AGGCCTGCTAAAGGATTCAACTGGAA3
[0121] This primer/probe set could detect mRNAs comprising a region spanning exons 8 and 9. This region is present in all of the C9orf72 mRNA isoforms. As shown in
[0122] In Round 3, the total C9orf72 mRNA was evaluated and compared between C9021 cells and wildtype (WT) cells in order to further evaluate the effect of the tested ZFP-TFs on total C9orf72 mRNA levels. The data show that the total C9orf72 mRNA levels in the mutant cells decreased much more dramatically than those in the WT cells (
[0123] The isoform selective repression of the ZFP-TFs 75109, 75114, and 75115 was evaluated in three different patient derived fibroblast cells containing different G.sub.4C.sub.2 expansion repeats on their expanded alleles (600, 800, and 850) (
[0124] The repression of total C9 transcript in two cell lines from healthy individuals with larger than normal G.sub.4C.sub.2 repeat numbers on their alleles was evaluated (
[0125] Without being bound by theory, it is possible that the present ZFP-TFs are able to work in a cooperative manner in order to selectively repress the allele with numerous repeats. That may be mediated by higher-order complexes, e.g., through recruitment of a KAP1 co-repressor that associates with the ZFP-linked KRAB domains. Under this hypothesis, the KAP1/KRAB scaffold across multiple ZFP-TFs increases the stability of the transcription repression machinery and enables the preferential repression of the expanded C9orf72 allele over the wildtype allele.
Example 2: Specificity of C9orf72 Repression
[0126] The global specificity of the ZFP-TFs shown in Table 1 was evaluated by microarray analysis in 3 cell lines: C9021 fibroblast cells, primary mouse cortical neurons and human neurons. For C9021 cells, in brief, 100 ng of ZFP-TF encoding mRNA was transfected into 150,000 C9021 cells in quadruplicates. After 24 hours, total RNA was extracted and processed via the manufacturer's protocol (Affymetrix Genechip MTA1.0). Robust Multi-array Average (RMA) was used to normalize raw signals from each probe set. Analysis was performed using Transcriptome Analysis Console 3.0 (Affymetrix) with the Gene Level Differential Expression Analysis option. ZFP-TF-transfected samples were compared to samples that had been treated with an irrelevant ZFP-TF (one that does not bind to a C9orf72 target site). Change calls were reported for transcripts (probe sets) with a >2 fold difference in mean signal relative to control, and a P-value <0.05 (one-way ANOVA analysis, unpaired T-test for each probe set). Similar procedure was also done for neurons, except they were transduced with AAV6 at MOI of 3000 and cultured for 7 days form mouse neurons and 19 days for human neurons before harvest.
[0127] Exemplary data are shown in
Example 3: Detection of Antisense-Specific Repression
[0128] Because sense and antisense transcripts are encoded by overlapping regions of the DNA, we developed a detection strategy based on the differential processing of the transcripts. For the sense mRNA from an expanded allele, the intron containing an expanded region (intron 1a) is mis-spliced and retained, but all other introns are removed, including intron 1b. In contrast, the intron 1b region is a predicted exon in the antisense mRNA transcript and should be retained. Thus, we designed and tested primers located within intron 1b and demonstrated specific detection of the antisense transcripts as further described below.
[0129] To detect C9orf72 transcripts, we used droplet digital PCR (ddPCR). In brief, to create the sense or antisense cDNA templates, RNA was purified from C9orf72 patient and healthy control cells (C9orf72 lines: C9-3, C9-6, C9-7, C9-5, C9-10, C9-11, C9-2, C9-4; Control lines: KinALS6, Con3, Kin1ALS17, Con8, Con10, Con1; see Lagier-Tourenne et al., PNAS (2013) 110(47):E4530-9) and used to synthesize cDNA using Superscript III (Thermo Fischer Scientific) first strand synthesis system as follows:
[0130] 1) 0.5 g of RNA, 0.5 L of 10 mM strand specific primer and dNTPs mix were mixed and made up to 10 L with water. For generation of the sense template, the primer 5 CTCTAGCGACTGGTGGAATTG 3 (SEQ ID NO:64) was used. To generate the antisense template, the primer 5 GTGCATGGCAACTGTTTGAATA 3 (SEQ ID NO:65) was used.
[0131] 2) This reaction was incubated at 65 C. for 5 minutes for denaturation and placed on ice for at least 1 minute.
[0132] 3) cDNA synthesis mix was prepared using these reagents: 10RT buffer (2 L); 25 mM MgCl2 (4 L); 0.1 M DTT (2 L); RNase OUT (1 L); Superscript III (1 L).
[0133] 4) 10 L of this reaction was added to the RNA mix and incubated at 50 C. for 50 minutes. The reaction was then inactivated by a 5 minute incubation at 85 C.
[0134] The template was then subjected to ddPCR using a labeled probe according to manufacturer's protocols. In brief, PCR reactions were done in an ABI PCR 96-well plate using dUTP-free ddPCR Supermix for Probes (Bio-Rad). The PCR Mastermix was prepared according to manufacturer's directions. The antisense primer-probe set located on the intron 1b region (
TABLE-US-00007 Forward: (SEQIDNO:66) 5CAAAGCCTGGTGGTGTTCAA3 Reverse: (SEQIDNO:67) 5GGACATGACCTGGTTGCTTC3 Probe: (SEQIDNO:68) 5CGCGGCCAGATAGACCCAATGAGCA3.
[0135] The reactions were set up as follows:
[0136] 1) Complete Master mix was distributed evenly among 8 wells of ABI PCR plate.
[0137] 2) 10 L 1:10-diluted RT reactions or water were added to the sample wells.
[0138] 3) 15 L of Master Mix was transferred into RT-containing wells.
[0139] 4) The plate was sealed, vortexed and spun down briefly.
To make the droplets, cartridges were used as follows:
[0140] 1) 70 L of probe oil was placed in the wells labeled oil on the cartridge and 20 L of the ddPCR reactions were place in the wells labeled sample.
[0141] 2) A rubber gasket was placed on top of the cartridge.
[0142] 3) 40 L of the droplets were transferred into a fresh Eppendorf 96 well plate.
The plate was sealed with aluminum foil and PCR was performed according to manufacturer's protocol.
[0143] The data show that in C9orf72 fibroblast lines, these primers amplified an exon in the antisense expanded pre-mRNA (C9-AS) and that the complementary region was absent from the sense region (C9-S) (
Example 4: Expanded Allele Sense and Antisense Pre-mRNA Repression
[0144] To test the activity of the ZFP-TF repressors on the expanded allele, the cells were treated with the ZFP-TFs 74949, 74978, 75003, 75027, 75109, 75114, 75115, 74967 (Table 1), or 74960 (negative control), as described above. Two separate PCR assays were used to assess the ZFP-TF mediated repression by investigators who were blinded to samples order. Each assay uses a different primer/probe (
[0145] For runs #1 and #2, assays to measure sense expanded, antisense expanded, and total C9 were performed as described above except that the amplification was performed with random hexamers according to standard protocols in the art and with the primers shown below:
[0146] Antisense expanded C9orf72 pre-mRNA (
[0147] Sense expanded C9orf72 pre-mRNA (
TABLE-US-00008 Forward: (SEQIDNO:69) 5ACTACTTGCTCTCACAGTACTCG3 Reverse: (SEQIDNO:70) 5TAGCGCGCGACTCCTGAGTTCC3 Probe: (SEQIDNO:71) 5AGGGAAACAACCGCAGCCTGTAGCAAGCTC3.
[0148] Total C9orf72 mRNA (
TABLE-US-00009 Forward: (SEQIDNO:72) 5TGTGACAGTTGGAATGCAGTGA3 Reverse: (SEQIDNO:73) 5GCCACTTAAAGCAATCTCTGTCTTG3 Probe: (SEQIDNO:74) 5TCGACTCTTTGCCCACCGCCA3.
[0149] Run #3 (
TABLE-US-00010 Forward: (SEQIDNO:78) 5CAGCTTCGGTCAGAGAAATGAG3 Reverse: (SEQIDNO:79) 5AAGAGGCGCGGGTAGAA3 Probe: (SEQIDNO:80) 5CTCTCCTCAGAGCTCGACGCATTT3
[0150] Despite the fact that different primer/probe sets, and different PCR assays were used (run #1 and run #2 were conducted by similar assays but different from run #3), data were consistent and the repression levels were comparable.
[0151] Taken together, all runs consistently demonstrated that some of the ZFP-TFs were capable of strongly suppressing all three transcripts (sense, antisense, and total) (e.g., ZFP-TFs 74978, 75003, and 75027), whereas some ZFP-TFs (e.g., ZFP-TFs 75109, 75114, and 75115) were selectively repressing the sense and antisense disease transcripts while preserving the total C9 transcript (selective repression).
Example 5: Modulation of Human C9orf72 in BAC C9orf72 Transgenic Mouse Neurons
[0152] All repressors targeted to BAC mouse C9orf72 are cloned into rAAV6 vectors using a CMV promoter to drive expression. The recombinant AAV is produced in HEK293T cells, purified using a CsCl density-gradient, and titered by real time qPCR according to methods known in the art. The purified virus is used to infect cultured primary mouse cortical neurons at 3E5, 1E5, 3E4, and 1E4 Vg/cell. After 7 days, total RNA is extracted and the expression of C9orf72 sense and antisense transcripts as well as two reference genes (e.g. Atp5b and Eif4a2) are monitored using RT-qPCR.
[0153] All ZFP-TF-encoding AAV vectors will effectively repress their targets in the mouse cells over a broad range of infected doses, with some ZFPs reducing the target by greater than 95% at multiple doses. In contrast, no gene repression is observed for a CMV-GFP rAAV6 virus tested at equivalent doses, or mock-treated neurons.
Example 6: In Vivo Gene Repression Driven by AAV-Delivered ZFP-TFs
[0154] The C9orf72 BAC transgenic mice used for target engagement studies contain 98 kb of human transgene containing a full length C9orf72 gene allele having about 500 G.sub.4C.sub.2 repeats with substantial flanking sequence (Liu et al., Neuron (2016) 90(3):521-34). Two ZFP-TFs, ZFP-TF 75027 or ZFP-TF 75114, with different potencies (ZFP-TF 75027 being more potent;
[0155] To evaluate the effect of ZFP-TF expression on the repression of expansion-containing sense and antisense transcripts in vivo, the ZFP-TF rAAVs were delivered into P0 C9-BAC or WT mice by intracerebroventricular (ICV) injections. Briefly, vehicle (PBS) or ZFP-TF 75027 rAAV or ZFP-TF 75114 rAAV (total dose of 2E10 Vgs per ventricle) was administered bilaterally (2 l per ventricle) into neonatal C9-BAC mice (matched for repeat length) or WT mice (
[0156] Total RNA was extracted from cortex and hippocampus tissues and cDNA was made using iScript cDNA synthesis kit (BioRad). ddPCR was performed to measure the expression of sense and antisense expansion-containing transcripts and total C9 mRNA levels normalized to mouse TBP levels. The primers used for this assay were:
TABLE-US-00011 TotalC9mRNA: Forward: (SEQIDNO:72) 5TGTGACAGTTGGAATGCAGTGA3 Reverse: (SEQIDNO:73) 5GCCACTTAAAGCAATCTCTGTCTTG3 Probe: (SEQIDNO:74) 5TCGACTCTTTGCCCACCGCCA3 Senseexpandedpre-mRNA: Forward: (SEQIDNO:69) 5ACTACTTGCTCTCACAGTACTCG3 Reverse: (SEQIDNO:70) 5TAGCGCGCGACTCCTGAGTTCC3 Probe: (SEQIDNO:71) 5AGGGAAACAACCGCAGCCTGTAGCAAGCTC3. Antisenseexpandedpre-mRNA: Forward: (SEQIDNO:81) 5AGTCGCTAGAGGCGAAAGC3 Reverse: (SEQIDNO:82) 5CGAGTGGGTGAGTGAGGAG3 Probe: (SEQIDNO:83) 5AAGAGGCGCGGGTAGAAGCGGGGGC3
[0157] The data show that ZFP-TF 75027 repressed the levels of total C9 mRNA, sense and antisense expansion-containing transcripts in hippocampus and cortex of C9-BAC animals relative to PBS-injected controls (
[0158] In addition, fluorescent in situ hybridization was used to measure the levels of sense and antisense RNA aggregates (foci) found in the hippocampus after ZFP-TF injections (
[0159] These results show that a ZFP-TF targeting C9orf72 can effectively repress the expression of a disease-causing C9orf72 allele in vivo and that differences in the potencies of ZFP-TFs can be observed.