BROADLY NEUTRALIZING ANTI-HUMAN CYTOMEGALOVIRUS (HCMV) ANTIBODIES AND METHODS OF USE THEREOF
20200330588 ยท 2020-10-22
Inventors
- Thomas GARDNER (New York, NY, US)
- Thomas Moran (New York, NY, US)
- Domenico Tortorella (New York, NY, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
C12N15/63
CHEMISTRY; METALLURGY
C07K16/44
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
C12N15/63
CHEMISTRY; METALLURGY
Abstract
The present disclosure relates to anti-human cytomegalovirus (anti-HCMV) antibodies and vaccines as well as diagnostic and therapeutic methods of use.
Claims
1.-41. (canceled)
42. An isolated anti-HCMV antibody, or antigen-binding portion thereof, comprising: (a) a heavy chain CDR1 (CDRH1), a heavy chain CDR2 (CDRH2), a heavy chain CDR3 (CDRH3), a light chain CDR1 (CDRL1), a light chain CDR2 (CDRL2), and a light chain CDR3 (CDRL3), wherein: (i) CDRH1 comprises SEQ ID NO: 15 or a sequence consisting essentially of SEQ ID NO: 15 but having at least one conservative substitution; (ii) CDRH2 comprises SEQ ID NO: 16 or a sequence consisting essentially of SEQ ID NO: 16 but having at least one conservative substitution; (iii) CDRH3 comprises SEQ ID NO: 17 or a sequence consisting essentially of SEQ ID NO: 17 but having at least one conservative substitution; (iv) CDRL1 comprises SEQ ID NO: 18 or a sequence consisting essentially of SEQ ID NO: 18 but having at least one conservative substitution; (v) CDRL2 comprises SEQ ID NO: 19 or a sequence consisting essentially of SEQ ID NO: 19 but having at least one conservative substitution; and (vi) CDRL3 comprises SEQ ID NO: 20 or a sequence consisting essentially of SEQ ID NO: 20 but having at least one conservative substitution; or (b) a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein: (i) CDRH1 comprises SEQ ID NO: 21 or a sequence consisting essentially of SEQ ID NO: 21 but having at least one conservative substitution; (ii) CDRH2 comprises SEQ ID NO: 22 or a sequence consisting essentially of SEQ ID NO: 22 but having at least one conservative substitution; (iii) CDRH3 comprises SEQ ID NO: 23 or a sequence consisting essentially of SEQ ID NO: 23 but having at least one conservative substitution; (iv) CDRL1 comprises SEQ ID NO: 24 or a sequence consisting essentially of SEQ ID NO: 24 but having at least one conservative substitution; (v) CDRL2 comprises SEQ ID NO: 25 or a sequence consisting essentially of SEQ ID NO: 25 but having at least one conservative substitution, and (vi) CDRL3 comprises SEQ ID NO: 26 or a sequence consisting essentially of SEQ ID NO: 26 but having at least one conservative substitution; or (c) a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein: (i) CDRH1 comprising SEQ ID NO: 27 or a sequence consisting essentially of SEQ ID NO: 27 but having at least one conservative substitution; (ii) CDRH2 comprises SEQ ID NO: 28 or a sequence consisting essentially of SEQ ID NO: 28 but having at least one conservative substitution; (iii) CDRH3 comprises SEQ ID NO: 29 or a sequence consisting essentially of SEQ ID NO: 29 but having at least one conservative substitution; (iv) CDRL1 comprises SEQ ID NO: 30 or a sequence consisting essentially of SEQ ID NO: 30 but having at least one conservative substitution; (v) CDRL2 comprises SEQ ID NO: 31 or a sequence consisting essentially of SEQ ID NO: 31 but having at least one conservative substitution; and (vi) a CDRL3 comprises SEQ ID NO: 32 or a sequence consisting essentially of SEQ ID NO: 32 but having conservative substitutions.
43. The isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42 having: a) a heavy chain comprising SEQ ID NO: 9 or a sequence consisting essentially of SEQ ID NO: 9 but having at least one conservative substitution, and a light chain comprising SEQ ID NO: 10 or a sequence consisting essentially of SEQ ID NO: 10 but having at least one conservative substitution; or b) a heavy chain comprising SEQ ID NO: 11 or a sequence consisting essentially of SEQ ID NO: 11 but having at least one conservative substitution, and a light chain comprising SEQ ID NO: 12 or a sequence consisting essentially of SEQ ID NO: 12 but having at least one conservative substitution; or c) a heavy chain comprising SEQ ID NO: 13 or a sequence consisting essentially of SEQ ID NO: 13 but having at least one conservative substitution, and a light chain comprising SEQ ID NO: 14 or a sequence consisting essentially of SEQ ID NO: 14 but having at least one conservative substitution.
44. An isolated anti-HCMV antibody, or antigen-binding portion thereof, that specifically binds to one or more epitopes within SEQ ID NO: 1.
45. The isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42, wherein the antibody is a monoclonal antibody.
46. The isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42, wherein the antibody is a human antibody, a humanized antibody, or a chimeric antibody.
47. A kit for detecting the presence of HCMV, or an antigenic fragment of HCMV thereof, in a sample comprising: (i) the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42, and (ii) a buffer.
48. The kit of claim 47, further comprising a secondary antibody that specifically binds to the anti-HCMV antibody, or antigen-binding portion thereof.
49. A method of detecting the presence of HCMV, or an antigenic fragment thereof, in a sample comprising: (i) obtaining a sample containing, or suspecting of containing, HCMV, or an antigenic fragment thereof; (ii) contacting the sample with the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42; and (iii) detecting the presence of specific binding of the anti-HCMV antibody, or antigen-binding portion thereof, to HCMV, or an antigenic fragment thereof.
50. The method of claim 49, further comprising: (iv) quantifying the amount of HCMV, or antigenic fragments thereof, present in the sample.
51. The method of claim 49, wherein the sample is an environmental or a biological sample.
52. A method of treating an HCMV infection in an individual in need thereof comprising: (i) identifying an individual having, or suspected of having, an HCMV infection; and (ii) administering to the individual a composition comprising the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42 and a pharmaceutically acceptable carrier or excipient.
53. The method of claim 52, further comprising administering to the individual at least one additional anti-HCMV antibody, or antigen-binding portion thereof.
54. A method of treating an HCMV infection in an individual in need thereof comprising: (i) identifying an individual having, or suspected of having, an HCMV infection; and (ii) administering to the individual a composition comprising the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42 and a pharmaceutically acceptable carrier or excipient; and (iii) administering to the individual at least one additional anti-HCMV antibody, or antigen-binding portion thereof, wherein the at least one additional anti-HCMV antibody, or antigen-binding portion thereof, is an anti-HCMV antibody, or antigen-binding portion thereof, of claim 42.
55. The method of claim 52, further comprising administering to the individual at least one antiviral composition.
56. The method of claim 55, wherein the antiviral composition is selected from the group consisting of ganciclovir, valganciclovir, foscarnet, cidofovir, and combinations thereof.
57. A passive vaccine comprising the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42.
58. A method of preventing an HCMV infection in an individual comprising administering to the individual the passive vaccine of claim 57.
59. A method of stimulating a host immune response in an individual comprising administering to the individual a composition comprising a peptide comprising SEQ ID NO: 1 and an adjuvant.
60. The method of claim 59, wherein the peptide consists of SEQ ID NO: 1.
61. A pharmaceutical composition comprising (i) the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42, and (ii) a pharmaceutically acceptable carrier, preservative, or excipient.
62. A nucleic acid sequence encoding the isolated anti-HCMV antibody, or antigen-binding portion thereof, of claim 42.
63. The nucleic acid sequence of claim 62 comprising one of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8, a sequence consisting essentially of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8 but having conservative substitutions, or a codon-optimized sequence encoding the same antibody or antigen-binding portion thereof.
64. A vector or vector system comprising at least one nucleic acid of claim 62.
65. A cell transformed with the vector or vector system of claim 64.
66. The cell of claim 65, wherein the cell is a bacterial cell, a yeast cell, or a mammalian cell.
67. A method of making recombinant anti-HCMV antibody, or antigen-binding fragment thereof, comprising: (i) providing a cell of claim 65; (ii) expressing at least one nucleic acid sequence in the vector or vector system of the cell to create at least one of a heavy chain, a light chain, or combinations thereof; and (iii) collecting a formed anti-HCMV antibody, or antigen-binding fragment, thereof.
Description
V. BRIEF DESCRIPTION OF THE DRAWINGS
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
VI. DETAILED DESCRIPTION
A. Definitions
[0055] Unless otherwise defined, terms and definitions herein shall be accorded their plain meaning as to one of ordinary skill in the art.
[0056] An anti-HCMV antibody may take one of numerous forms in the art, as disclosed herein. Antibodies are in part defined by the antigens to which they bind, thus, an anti-HCMV antibody is any such antibody which specifically binds at least one epitope found on the viral envelope of human cytomegalovirus (HCMV) as described herein. It is understood in the art that an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. A heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH1, CH2 and CH3). A light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The variable regions of both the heavy and light chains comprise framework regions (FWR) and complementarity determining regions (CDR, e.g. CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3). The four FWR regions are relatively conserved while CDR regions (CDR1, CDR2 and CDR3) represent hypervariable regions and are arranged from NH.sub.2 terminus to the COOH terminus as follows: FWR1, CDR1, FWR2, CDR2, FWR3, CDR3, FWR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen while, depending of the isotype, the constant region(s) may mediate the binding of the immunoglobulin to host tissues or factors. It is known in the art that it is possible to manipulate monoclonal and other antibodies and use techniques of recombinant DNA technology to produce other antibodies or chimeric molecules which retain the specificity of the original antibody. Such techniques may evolve introducing DNA encoding the immunoglobulin variable region, or CDRs, of an antibody to the constant regions, or constant regions plus framework regions, of a different immunoglobulin.
[0057] The term antibody (Ab) as used herein is used in the broadest sense and specifically may include any immunoglobulin, whether natural or partly or wholly synthetically produced, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific antibodies and polyreactive antibodies), and antibody fragments. Thus, the term antibody as used in any context within this specification is meant to include, but not be limited to, any specific binding member, immunoglobulin class and/or isotype (e.g., IgG1, IgG2a, IgG2b, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE) and biologically relevant fragment or specific binding member thereof, including but not limited to Fab, F(ab).sub.2, scFv (single chain or related entity), and (scFv).sub.2.
[0058] The term antibody fragments as used herein may include those antibody fragments obtained using techniques readily known and available to those of ordinary skill in the art, as reviewed herein. Therefore, in addition to the definition for antibody presented supra, the term antibody may further encompass any polypeptide or protein comprising a portion of an intact antibody, such as the antigen binding or variable region of the intact antibody. These can be derived from natural sources, or they may be partly or wholly synthetically produced. Examples of antibody fragments include, but are not limited to, Fab, Fab, F(ab)2, and Fv fragments; diabodies, linear antibodies, and single-domain antibodies (sdAb).
[0059] The term monoclonal antibody or mAb as used herein may refer to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
[0060] The term core binding region as used herein refers to the peptide sequence VHTTERREIFIVETG (SEQ ID NO: 1), which is located on the full-length consensus sequence of HCMV glycoprotein gH, reproduced as SEQ ID NO: 2 herein. Several embodiments of the present disclosure are directed to anti-HCMV antibodies that specifically bind to one or more epitopes within SEQ ID NO: 1 and their methods of use thereof, exemplified by, but expressly not limited to, the monoclonal anti-HCMV antibodies 10C10 and 5C3. The anti-HCMV antibodies of the present disclosure may bind to one or more epitopes within the core binding region, and the epitopes need not be the full length of the core binding region, nor do the epitopes need to be fully linear (although they may be); the epitopes, such as is believed to be the case of 10C10 and 5C3, may be conformational and thus non-linear (discontinuous). Furthermore, an anti-HCMV antibody may bind partially within the core binding region and partially outside, especially in the case of a conformational epitope, although in many circumstances it will bind wholly inside the core binding region; in either case, such antibodies are expressly intended to be covered by this invention. Some antibodies, e.g. polyclonal antibodies, in addition to binding within the core binding region, may additionally bind to epitopes entirely outside of the core binding region. So long as they specifically bind within the core binding region, including binding partially within the core binding region and partially outside (again particularly in the case of a conformational epitope), such antibodies are expressly intended to covered by this invention. Furthermore, although the core binding region exhibits a high degree of conservation among different HCMV strains, thus owing partially to its ability to serve as a target for broadly neutralizing antibodies, one of ordinary skill in the art will appreciate that conservative substitutions may be made to SEQ ID NO: 1, and antibodies that bind to one or more epitopes within SEQ ID NO: 1 having conservative substitutions are also expressly intended to be covered by the present disclosure.
[0061] The terms conservative sequence modifications or conservative substitutions as used herein may refer to amino acid modifications to a target epitope of the invention that do not significantly affect or alter the binding characteristics of the anti-HCMV antibodies to the epitope(s). Such conservative modifications include amino acid substitutions, additions and deletions. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within a target epitope that the anti-HCMV antibodies of the invention specifically bind to, e.g. epitopes on the viral envelope of HCMV, can be replaced with other amino acid residues from the same side chain family and the antibodies of the present disclosure can be tested against the target epitope can be tested, for example using functional assays described herein or otherwise known in the art.
[0062] The term biological sample as used herein may refer to a sample obtained from an organism (e.g., patient) or from components (e.g., cells) of an organism. The sample may be of any biological tissue, cell(s) or fluid. The sample may be a clinical sample which is a sample derived from a subject, such as a human patient. Such samples include, but are not limited to, saliva, sputum, blood, blood cells (e.g., white cells), bodily fluids, lavages, pancreatic juices, gastric juices, discharges, CSF, lymph amniotic fluid, plasma, semen, bone marrow, and tissue or fine needle biopsy samples, urine, stool, peritoneal fluid, and pleural fluid, or cells therefrom, and any combinations thereof. Biological samples may also include sections of tissues such as frozen sections taken for histological purposes. A biological sample may also be referred to as a patient sample. A biological sample may also include a substantially purified or isolated protein, membrane preparation, or cell culture.
[0063] The terms effective amount or therapeutically effective amount as used herein may refer to an amount of the compound or agent that is capable of producing a medically desirable result in a treated subject. The treatment method can be performed in vivo or ex vivo, alone or in conjunction with other drugs or therapy. A therapeutically effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
[0064] The terms antigen binding portion, antigen binding fragment or Fab as used herein may refer to a region on an antibody that binds to antigens. One of ordinary skill in the art will understand that Fabs are comprised of one constant one variable domain of each of the heavy and light chain of an antibody.
[0065] The terms specific binding, selective binding, selectively binds, and specifically binds, may refer to antibody binding to an epitope on a predetermined antigen but not to other antigens. Typically, the antibody binds with an equilibrium dissociation constant (K.sub.D) of approximately less than 10.sup.6 M, such as approximately less than 10.sup.7 M, 10.sup.8M, 10.sup.9 M or 10.sup.10 M or even lower when determined by, e.g., equilibrium dialysis or surface plasmon resonance (SPR) technology in, for example, a BIACORE 2000 surface plasmon resonance instrument or similar technology using the predetermined antigen, e.g., an epitope on the viral envelope of HCMV, as the analyte and the antibody as the ligand, or Scatchard analysis of binding of the antibody to antigen positive cells, and (ii) binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
[0066] The term homology as used herein may refer to the existence of shared structure between two compositions. The term homology in the context of proteins may refer to the amount (e.g. expressed in a percentage) of overlap between two or more amino acid and/or peptide sequences. In the context of nucleic acids, the term may refer to the amount (e.g. expressed in a percentage) of overlap between two or more nucleic acid sequences. As used herein, the percent (%) homology between two sequences is equivalent to the percent identity between the two sequences. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions/total # of positions100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. Such homology is well-represented in the art via local alignment tools and/or algorithms, and may include pairwise alignment, multiple sequence alignment methods, structural alignment methods, and/or phylogenetic analysis methods.
[0067] The terms co-administration, co-administered, and in combination with as used herein may refer to the administration of at least two agents or therapies to a subject. In some embodiments, the co-administration of two or more agents/therapies is concurrent. In other embodiments, a first agent/therapy is administered prior to a second agent/therapy. Those of skill in the art understand that the formulations and/or routes of administration of the various agents/therapies used may vary.
[0068] The term carriers as used herein may include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include, but not limited to, buffers such as phosphate, citrate, and other organic acids; antioxidants including, but not limited to, ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as, but not limited to, serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as, but not limited to, polyvinylpyrrolidone (PVP); amino acids such as, but not limited to, glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including, but not limited to, glucose, mannose, or dextrins; chelating agents such as, but not limited to, EDTA; sugar alcohols such as, but not limited to, mannitol or sorbitol; salt-forming counterions such as, but not limited to, sodium; and/or nonionic surfactants such as, but not limited to, TWEEN; polyethylene glycol (PEG), and PLURONICS.
[0069] The term treating or treatment of a disease as used herein may refer to executing a protocol, which may include administering one or more drugs to a patient (human or otherwise), in an effort to alleviate signs or symptoms of the disease. Alleviation can occur prior to signs or symptoms of the disease appearing as well as after their appearance. Thus, treating or treatment includes preventing or prevention of disease. The terms prevent or preventing refer to prophylactic and/or preventative measures, wherein the object is to prevent or slow down the targeted pathologic condition or disorder. For example, in the case of infection human cytomegalovirus (HCMV), preventing or preventing may arise in a situation where a course of treatment is advanced in order to prevent or stall infection by HCMV, such as through vaccination. Such preventing or prevention also arise in the case of latent infection by HCMV, for example in those individuals who are seropositive but are not exhibiting any symptoms, in which the object would be to prevent active infection and/or clear a patient of said latent infection. In addition, treating or treatment does not require complete alleviation of signs or symptoms, does not require a cure, and specifically includes protocols that have only a marginal effect on the patient.
[0070] The term patient as used herein may refer to a biological system to which a treatment can be administered. A biological system can include, for example, an individual cell, a set of cells (e.g., a cell culture), an organ, a tissue, or a multi-cellular organism. A patient can refer to a human patient or a non-human patient.
[0071] The term epitope as used herein may refer to the region of an antigen to which an antibody or T cell binds, e.g. a region of the viral envelope of HCMV, including but not limited to a glycoprotein or a region on a glycoprotein. An antigen refers to a substance that elicits an immunological reaction or binds to the products of that reaction.
[0072] The terms purified or isolated antibody, peptide, polypeptide, or protein refers to a peptide, polypeptide, or protein, as used herein, may refer to a peptide, polypeptide, or protein that has been separated from other proteins, lipids, and nucleic acids with which it is naturally associated. The polypeptide/protein can constitute at least 10% (i.e., any percentage between 10% and 100%, e.g., 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, and 99%) by dry weight of the purified preparation. Purity can be measured by any appropriate standard method, for example, by column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. An isolated polypeptide/protein (e.g., anti-HCMV antibodies) described in the invention can be produced by recombinant DNA techniques.
B. Structure of Human Cytomegalovirus (HCMV)
[0073] Human cytomegalovirus (HCMV) is a prototypical betaherpesvirus, and is a species of the Cytomegalovirus genus of viruses. HCMV is also known as human herpesvirus-5 (HHV-5). Of the herpesviruses, HCMV harbors the most genes dedicated to evading the host immune response, including adaptive immunity, and represents a significant life-long burden of antigenic T-cell surveillance and immune dysfunction. Accordingly, the viral envelope of HCMV contains various protein complexes that enable wide viral tropism, utilizing multiple glycoprotein complexes to attach and fuse with host cell membranes.
[0074] Glycoproteins gB, gH, and gL comprise the core fusion machinery and exist in various protein complexes on the virion surface. Glycoprotein gB catalyzes membrane fusion during viral entry, and gH and gL likely serve as factors which activate gB to permit pH-independent fusion at the cellular membrane. In addition to the gH/gL heterodimer, gH and gL exist in the trimeric gH/gL/gO complex which is essential for viral entry into fibroblasts. The pentameric complex (PC), which consists of gH/gL and three additional proteins UL128, UL130 and UL131a, is required for viral entry into epithelial, endothelial, and myeloid cells where the virion enters through a low pH-dependent endocytosis mechanism. The glycoprotein complex gH/gL/gO (gH trimer) is required for infection of all cell types, while the gH/gL/UL128/130/131a (gH pentamer) complex imparts specificity in infecting epithelial, endothethial, and myeloid cells. Given that the amount of gH/gL/gO trimer on the viral surface correlates with levels of CMV entry in both epithelial and fibroblast cells, gH may contribute to viral entry primarily through activation of the fusion event, rather than serving a receptor-binding role. Without wishing to be bound by theory, anti-gH antibodies may function by interrupting a fusion-triggering signal to gB. Thus, anti-HCMV antibodies which specifically target gH may possess particular therapeutic applicability as shown in Examples 3 through 6 infra.
C. Anti-HCMV Antibodies and Antigen-Binding Portions Thereof
[0075] The antibodies or antigen-binding portions thereof of the present disclosure specifically bind to one or more epitopes found on the viral envelope of human cytomegalovirus (HCMV), e.g. to one or more epitopes on a glycoprotein. While the anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure are capable of binding to multiple glycoproteins, e.g. glycoproteins gB and gH, those that bind to one or more epitopes within SEQ ID NO: 1, found on glycoprotein gH are of particular therapeutic utility as they have been shown, e.g. in Examples 3 through 6 infra, to broadly neutralize HCMV infection. Thus, those anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure which specifically bind to one or more epitopes SEQ ID NO: 1 are suitable for use in vaccines and pharmaceutical compositions/methods of use. Furthermore, anti-HCMV antibodies or antigen-binding portions thereof which specifically bind to one or more epitopes within SEQ ID NO: 1 may be combined with other anti-HCMV antibodies, including (but not limited to) other anti-HCMV antibodies of the present disclosure, and/or in combination with antiviral treatments, discussed herein. While anti-HCMV antibodies or antigen-binding portions thereof that specifically bind to one or more epitopes within SEQ ID NO: 1 may have particular therapeutic use, any anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure that specifically bind to HCMV may be of use, e.g. in an immunoassay, to detect the presence of HCMV or an antigenic fragment thereof in a sample, e.g. a biological sample. Such immunoassays are described infra and may or may not be suitable for diagnostic purposes, e.g. sufficient to diagnose an individual as having an active or latent infection of HCMV.
[0076] The anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure are capable of binding to a number of different structures on the surface of HCMV, including glycoprotein gH and glycoprotein gB. As discussed herein, while the anti-HCMV antibodies or antigen-binding portions thereof which target the glycoprotein gB may not be capable of broadly neutralizing HCMV, they are capable of specifically binding to HCMV or an antigenic fragment thereof (e.g., glycoprotein gB). Thus, while not necessarily capable of broadly neutralizing HCMV, they may be able to neutralize at least some strains of HCMV, e.g. as shown in Example 3 infra, exemplary anti-gB antibodies of the present disclosure are capable of neutralizing infection by strain AD169. Those anti-gB antibodies of the present disclosure include, but are expressly not limited to, monoclonal antibody and the antigen binding portions thereof of 8H12 as well as recombinant antibodies (e.g. chimeric and/or humanized antibodies) produced from the variable light (SEQ ID NO: 12) and heavy (SEQ ID NO: 11) chains of 8H12 and/or antibodies and antigen-binding portions thereof containing one or more CDRs within the variable light and/or heavy chains of 8H12, including isotype-switched antibodies and artificial constructs, e.g. scFv constructs. In contrast, those anti-HCMV antibodies or antigen-binding portions thereof which bind to glycoprotein gH, especially those that bind to one or more epitopes within SEQ ID NO: 1, may possess particular therapeutic utility as shown in Example 3 infra, as they are capable of broadly neutralizing HCMV. Without wishing to be bound by theory, antibodies that specifically bind to glycoprotein gH may be capable of broadly neutralizing HCMV because of the role glycoprotein gH plays in viral entry. Glycoprotein gH is part of a heterodimer, as well as a trimeric complex and a pentameric complex, and is required for viral entry, serving as a factor to permit cell surface fusion. Thus, while not wishing to be bound by theory, these anti-HCMV antibodies or antigen-binding portions thereof which target glycoprotein gH are capable of broadly inhibiting HCMV infection because they blocking and/or disrupting viral entry pathways. These anti-HCMV antibodies or antigen-binding portions thereof which target gH include, but are expressly not limited to, monoclonal antibodies and the antigen-binding portions thereof of 10C10 and 5C3, as well as recombinant antibodies (e.g. chimeric and/or humanized antibodies) produced from the variable light (SEQ ID NO: 10 for 5C3 and SEQ ID NO: 14 for 10C10) and heavy (SEQ ID NO: 9 for 5C3 and SEQ ID NO: 13 for 10C10) and/or antibodies and antigen-binding portions thereof containing one or more CDRs within the variable light and/or heavy chains of either 10C10 and 5C3, including but not limited to antibodies generated with CDRs from one or both of 5C3 and 10C10, e.g. isotype-switched antibodies or scFv constructs. 10C10 and 5C3 were generated by injecting mice with the lab strain HCMV AD169 which lacks the pentamer complex due to deletion of UL131a and subsequently generating hybridoma clones, as described in Example 1 infra. This was chosen so as to generate antibodies that specifically bind to glycoprotein gB or gH without targeting the additional proteins in the pentameric complex. 10C10 and 5C3 specifically bind to one or more epitopes within the core binding region (SEQ ID NO: 1), which is found within glycoprotein gH. The full length of glycoprotein gH, generated by consensus sequence, is reproduced below:
TABLE-US-00001 (SEQIDNO:2) MRPGLPFYLTVFAVYLLSHLPSQRYGADAASEALDPHAFHLLLN TYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQY YVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKD LASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPH DWKGSHTTSGLHRPHFNQTCILFDGHDLLFSTVTPCLHQGFYLM DELRYVKITLTEDFFVVTVSIDDDTPMLLIFGHLPRVLFKAPYQ RDNFILRQTEKHELLVLVKKTQLNRHSYLKDSDFLDAALDFNYL DLSALLRNSFHRYAVDVLKSGRCQMLDRRTVEMAFAYALALFAA ARQEEAGTEISIPRALDRQAALLQIQEFMITCLSQTPPRTTLLL YPTAVDLAKRALWTPDQITDITSLVRLVYILSKQNQQHLIPQWA LRQIADFALQLHKTHLASFLSAFARQELYLMGSLVHSMLVHTTE RREIFIVETGLCSLAELSHFTQLLAHPHHEYLSDLYTPCSSSGR RDHSLERLTRLFPDATVPATVPAALSILSTMQPSTLETFPDLFC LPLGESFSALTVSEHVSYVVTNQYLIKGISYPVSTTVVGQSLII TQTDSQSKCELTRNMHTTHSITAALNISLENCAFCQSALLEYDD TQGVINIMYMHDSDDVLFALDPYNEVVVSSPRTHYLMLLKNGTV LEVTDVVVDATDSRLLMMSVYALSAIIGIYLLYRMLKTC.
[0077] The core binding region recognized by 10C10 and 5C3 (SEQ ID NO: 1) is underlined within SEQ ID NO: 2 above, and is heavily conserved across HCMV strains; analysis of 10 geographically distinct HCMV strains demonstrated identical sequence homology of SEQ ID NO: 1. This is in direct contrast to virion surface glycoproteins, e.g. gO and UL128, which can range considerably in homology. The conservation in SEQ ID NO: 1 across HCMV strains is specifically relevant to the underlying ability of several of the anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure, including but not limited to 10C10 and 5C3, to broadly neutralize HCMV infection. This is because SEQ ID NO: 1 is highly conserved across HCMV species. Thus, antibodies or antigen-binding portions thereof which specifically bind to one or more epitopes within SEQ ID NO: 1 (found on glycoprotein gH) will be able to bind to a broad range of HCMV strains, and because glycoprotein gH is involved in viral entry, antibodies which target gH may prevent viral entry, thus, neutralizing HCMV infection.
[0078] While both 10C10 and 5C3 appear to specifically bind to one or more epitopes within SEQ ID NO: 1, the specific epitopes which 10C10 and 5C3 bind to within SEQ ID NO: 1 are distinct, but proximal; see Example 9 infra. Furthermore, while not wishing to be bound by theory, the epitopes for either of 10C10 and 5C3 may be conformational epitopes (e.g. a discontinuous epitope within SEQ ID NO: 1) as suggested by cyclic peptide arrays, and further by how binding of 5C3 to gH was enhanced by co-expression of gL (as part of a heterodimer). The nucleotide sequences for the variable regions (heavy and light) of 10C10 and 5C3 (anti-gH) and 8H12 (anti-gB) is reproduced below in Table 1; corresponding amino acid sequences are reproduced below in Table 2. Example 11 infra discusses the genomic analysis of the anti-HCMV antibodies.
TABLE-US-00002 TABLE1 Nucleotidesequencesofselect anti-HCMVantibodies Anti- body Gene NucleotideSequence 5C3 Heavy CAGGTCCAACTGCAGCAGCCTGGGGCTGA chain GCTGGTGAGGCCTGGGGCTTCAGTGAAGC TGTCCTGCAAGGCTTCTGGCTACACCTTC ACCACTTACTGGATGAACTGGGTGAAGCA GAGGCCTGGACAAGGCCTTGAATGGATTG GTATGATTGATCCTTCAGACAGTGAAACT CACTACAATCAAATGTTCAAGGACAAGGC CACATTGACTGTGGACACATCCTCCAGCA CAGCCTACATGCAACTCAGCAGTCTGACA TCTGAGGATTCTGCGGTCTATTACTGTGC AAGAGGCCGGTCCTGGTTTGTTTATTGGG GCCAAGGGACTCTGGTCACTGTCTCTAGC (SEQIDNO:3) Light GACATTGTGCTGACACAGTCTCCTGCTTC chain CTTAGCTGTTTCTCTGGGGCAGAGGGCCA (kappa) CCATCTCATGCAGGGCCAGCAAAAGTGTC AGTTCATCTGGCTATAGTTATGTGCACTG GTACCAGCAGAAACCAGGGCAACCACCCA AACTCCTCATCTATCTTGCATCCAACCTA GAATCTGGGGTCCCTGCCAGGTTCAGTGG CAGTGGGTCTGGGACAGACTTCACCCTCA ACATCCATTCTGTGGAGGAGGAGGATGCT GCAACCTATTACTGTCAGCACAATAGGGA GCTTCCGTACACTTTCGGAGGGGGGACCA AGCTGGAAATAAAACGG (SEQIDNO:4) 8H12 Heavy GATGTGCAGCTTCAGGAGTCGGGACCTGG chain CCTGGTGAAACCTTCTCAGTCTCTGTCCC TCACCTGCACTGTCACTGGCTACTCAATC ACCAGTGATTATGCCTGGAACTGGATCCG GCAGTTTCCAGGAAACAAACTGGAGTGGA TGGGCTACATAAGCTACAGTGGTAGCACT AGCTACAACCCATCTCTCAAAAGTCGAAT CTCTATCACTCGAGACACATCCAAGAACC AGTTCTTCCTGCAGTTGAATTCTGTGACT ACTGAGGACACAGCCACATATTACTGTGC AAGACGGAGGGATTACGGAGAGGACTACT TTGACTACTGGGGCCAAGGCACCACTCTC ACAGTCTCCAGC(SEQIDNO:5) Light GACATTGTGATGACACAGTCTCCATCCTC chain CCTGAGTGTGTCAGCAGGAGAGAAGGTCA (kappa) CTATGAGCTGCAAGTCCAGTCAGAGTCTG TTAAACAGTGGAAATCAAAGGAACTACTT GGCCTGGTACCAGCAGAAACCAGGGCAGC CTCCTAAACTGTTAATCTACGGGGCATCC ACTAGGGAATCTGGGGTCCCTGATCGCTT CACAGGCAGTGGATCTGGAACCGATTTCA CTCTTACCATCAGCAGTGTGCAGGCTGAA GACCTGGCAGTTTATTATTGTCAGAATGA TTATAGTTATCCATTCACGTTCGGCTCGG GGACAAAGTTGGAAATAAAACGG (SEQIDNO:6) 10C10 Heavy GAGGTCCAGCTTCAGCAGTCAGGACCTGA chain GCTGGTGAAGCCTGGAGTTTCAATGAGGA TATCCTGCAAGGCTTCTGGTTTCTCATTC ACTGACTACACCATGAACTGGGTGAAACA GAGCCATAGAAAGAACCTTGAGTGGATTG GACTTGTTAATCCTTACAATGGTGGTACT AGCCACAACCCGAACTTCAAGGGCAAGGC CACATTAACTGTAGACAAGTCATCCAGCA CAGCCTACATGGAACTCCTCAGTCTGACA TCTGAGGACTCTGCAGTCTATTACTGTGC AAGAAGGGGGCGACGCGACTATGCTTTGG ACTACTGGGGTCAGGGAACCTCAGTCACC GTCTCCAGC(SEQIDNO:7) Light GATATTGTGCTAACTCAGTCTCCAGTCAC chain CCTGTCTGTGACTCCAGGAGATAGCGTCA (kappa) GTCTTTCCTGCAGGGCCAGCCAAAGTGTT AGTAACAACCTACACTGGTATCAACAAAA ATCACATGAGTCTCCAAGGCTTCTCATAA AGTATGCTTCCCAGTCCATCTCTGGGATC CCCTCCAGGTTCAGAGGCAGTGGATCAGG GACAGATTTCACTCTCAGTATCATCAGTG TGGAGACTGAAGATTTTGGAATGTATTTC TGTCAACAGAGTAACATCTGGCCTCACAC GTTCGGTGCTGGGACCAAGCTGGAGCTGA AACGG(SEQIDNO:8)
TABLE-US-00003 TABLE2 Variableheavy/light(kappa)sequences ofselectanti-HCMVantibodies. CDRsareunderlined. Anti- body Chain PeptideSequence 5C3 Heavy QVQLQQPGAELVRPGASVKLSCKASGYTF chain TTYWMNWVKQRPGQGLEWIGMIDPSDSET HYNQMFKDKATLTVDTSSSTAYMQLSSLT SEDSAVYYCARGRSWFVYWGQGTLVTVSS (SEQIDNO:9) Light DIVLTQSPASLAVSLGQRATISCRASKSV chain SSSGYSYVHWYQQKPGQPPKLLIYLASNL (kappa) ESGVPARFSGSGSGTDFTLNIHSVEEEDA ATYYCQHNRELPYTFGGGTKLEIKR (SEQIDNO:10) 8H12 Heavy DVQLQESGPGLVKPSQSLSLTCTVTGYSI chain TSDYAWNWIRQFPGNKLEWMGYISYSGST SYNPSLKSRISITRDTSKNQFFLQLNSVT TEDTATYYCARRRDYGEDYFDYWGQGTTL TVSS(SEQIDNO:11) Light DIVMTQSPSSLSVSAGEKVTMSCKSSQSL chain LNSGNQRNYLAWYQQKPGQPPKLLIYGAS (kappa) TRESGVPDRFTGSGSGTDFTLTISSVQAE DLAVYYCQNDYSYPFTFGSGTKLEIKR (SEQIDNO:12) 10C10 Heavy EVQLQQSGPELVKPGVSMRISCKASGFSF chain TDYTMNWVKQSHRKNLEWIGLVNPYNGGT SHNPNFKGKATLTVDKSSSTAYMELLSLT SEDSAVYYCARRGRRDYALDYWGQGTSVT VSS(SEQIDNO:13) Light DIVLTQSPVTLSVTPGDSVSLSCRASQSV chain SNNLHWYQQKSHESPRLLIKYASQSISGI (kappa) PSRFRGSGSGTDFTLSIISVETEDFGMYF CQQSNIWPHTFGAGTKLELKR (SEQIDNO:14)
TABLE-US-00004 TABLE3 ComplementarityDeterminingRegions (CDRs)ofselectanti-HCMVantibodies Antibody Chain CDR1 CDR2 CDR3 5C3 Heavy GYTFTTYW IDPSDSET ARGRS chain (SEQID (SEQID WFVY NO:15) NO:16) (SEQID NO:17) Light KSVSSSGYSY LAS QHNRE chain (SEQID (SEQID LPYT (kappa) NO:18) NO:19) (SEQID NO:20) 8H12 Heavy GYSITSDYA ISYSGST ARRRDY chain (SEQID (SEQID GEDYFDY NO:21) NO:22) (SEQID NO:23) Light QSLLNSGN GAS QNDYS chain QRNY (SEQID YPFT (kappa) (SEQID NO:25) (SEQID NO:24) NO:26) 10C10 Heavy GFSFTDYT VNPYNGGT ARRGRRD chain (SEQID (SEQID YALDY NO:27) NO:28) (SEQID NO:29) Light QSVSNN YAS QQSNIW chain (SEQID (SEQID PHT (kappa) NO:30) NO:31) (SEQID NO:32)
[0079] One of ordinary skill in the art will appreciate that the complementarity determining regions (CDRs) of most antibodies, e.g., 10C10, 5C3, and 8H12 largely determine the biological activity of the antibodies by forming the paratope on the antibody. For example, 10C10 and 5C3 recognize one or more epitopes within SEQ ID NO: 1, whereas 8H12 recognizes an epitope on HCMV glycoprotein gB, and this activity is determined largely by the sequences contained in the variable light and heavy chains, particularly the CDRs. Accordingly, some embodiments of the present disclosure are directed to antibodies expressing the CDRs listed in Table 3.
[0080] For example, some embodiments of the present disclosure are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the heavy chain comprising one or more of SEQ ID NO: 15, SEQ ID NO: 16, and/or SEQ ID NO: 17, or a certain degree of homology with one or more of SEQ ID NO: 15, SEQ ID NO: 16 and/or SEQ ID NO: 17, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%. One or more of SEQ ID NO: 15, SEQ ID NO: 16, and/or SEQ ID NO: 17 may have conservative substitutions. Some embodiments of the present disclosure are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the heavy chain comprising one or more of SEQ ID NO: 21, SEQ ID NO: 21, and/or SEQ ID NO: 23, or a certain degree of homology with one or more of SEQ ID NO: 21, SEQ ID NO: 22 and/or SEQ ID NO: 23, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%. One or more of SEQ ID NO: 21, SEQ ID NO: 22, and/or SEQ ID NO: 23 may have conservative substitutions. Some embodiments of the present disclosure are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the heavy chain comprising one or more of SEQ ID NO: 27, SEQ ID NO: 28, and/or SEQ ID NO: 29, or a certain degree of homology with one or more of SEQ ID NO: 27, SEQ ID NO: 28 and/or SEQ ID NO: 29, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%. One or more of SEQ ID NO: 27, SEQ ID NO: 28, and/or SEQ ID NO: 29 may have conservative substitutions. Some embodiments of the present disclosure are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the light chain comprising one or more of SEQ ID NO: 18, SEQ ID NO: 19, and/or SEQ ID NO: 20, or a certain degree of homology with one or more of SEQ ID NO: 18, SEQ ID NO: 19 and/or SEQ ID NO: 20, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%. One or more of SEQ ID NO: 18, SEQ ID NO: 19, and/or SEQ ID NO: 20 may have conservative substitutions. Some embodiments of the present disclosure are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the light chain comprising one or more of SEQ ID NO: 24, SEQ ID NO: 25, and/or SEQ ID NO: 26, or a certain degree of homology with one or more of SEQ ID NO: 24, SEQ ID NO: 25 and/or SEQ ID NO: 26, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%. One or more of SEQ ID NO: 24, SEQ ID NO: 25, and/or SEQ ID NO: 26 may have conservative substitutions. Some embodiments of the present disclosure are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the light chain comprising one or more of SEQ ID NO: 30, SEQ ID NO: 31, and/or SEQ ID NO: 32, or a certain degree of homology with one or more of SEQ ID NO: 30, SEQ ID NO: 31 and/or SEQ ID NO: 32, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%. One or more of SEQ ID NO: 30, SEQ ID NO: 31, and/or SEQ ID NO: 32 may have conservative substitutions.
[0081] In some embodiments, the anti-HCMV antibodies or antigen-binding portions thereof are humanized antibodies, e.g. a murine humanized antibody. Techniques for humanization of murine antibodies are known to one of ordinary skill in the art and are generally reviewed in Safdari et al., (2013) Biotechnol. Genet. Eng. Rev., 29: 175-86, hereby incorporated by reference in its entirety. Humanization of antibodies generally comprises grafting of CDRs (for example, but not necessarily, one or more of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, and/or SEQ ID NO: 32, or conservative substituted variants thereof) into an appropriate human variable region framework, for example, as disclosed in Jones et al. (1986) Nature 321, 522-525, hereby incorporated by reference in its entirety. Common methods used include, but are not limited to, framework-homology-based humanization, germline humanization, complementary determining regions (CDR)-homology-based humanization and specificity determining residues (SDR) grafting. Proper orientation of the CDRs in the humanized antibody is typically necessary and can be determined by, for example, evaluating the crystal structure of the humanized antibody. The principal advantage of humanized antibodies comes from significantly reduced immunogenicity when compared to a murine monoclonal antibody, particularly the constant domain (Fc region) of a murine antibody, although humanizing the variable domains also leads to reduced immunogenicity.
[0082] Some embodiments of the invention are directed to vectors and vector systems containing nucleotide sequences that code for the variable regions of anti-HCMV antibodies, e.g. 10C10, 5C3, and 8H12, as well as cells transformed with such vectors and/or vector systems. The vector may be, for example but not necessarily, a plasmid; other explicitly non-limiting recombinant vectors are known in the art and may include, e.g. phage vectors such as a phage vector, other viral vectors such as non-replicating adenoviral vector, lentiviral vector, pSV, pCMV series of plasmid vectors, vaccinia and retroviral vectors, baculoviral vectors, cosmids, artificial chromosomes. The vector may be a mammalian expression vectors; for example, vectors may be transfected into mammalian cells and the DNA may be integrated into the genome by homologous recombination in the case of stable transfection, or alternatively the cells may be transiently transfected. Common to most engineered vectors are origin of replications, multicloning sites, and selectable markers, so as long as a vector (including systems of vectors, e.g. multiple plasmids) contain such a system they are considered to be covered by the scope of this invention. Common promoters for mammalian expression vectors include CMV and SV40 promoters; nonviral promoters such as EF-1 promoters are also known. In some embodiments, the present disclosure is directed to a vector or system of vectors containing one or more nucleic acid sequences encoding one or more CDRs of one or more heavy and/or light chains of one or more of the anti-HCMV antibodies of the present disclosure, e.g. nucleotide sequence or sequences coding for one or more of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, and/or SEQ ID NO: 32. These nucleotides coding for CDRs may have conservative substitutions and, independent of such conservative substitutions, may share a certain degree of homology (i.e. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%) with the nucleotide sequences coding for the CDRs within any one of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and/or SEQ ID NO: 8.
[0083] The nucleic acid sequences may have conservative substitutions, and may be codon optimized. As used herein, codon optimization refers to an in vitro mutagenesis of a nucleic acid to increase or maximize expression of a gene (e.g. a transgene relative to the unmodified nucleic acid, without changing (or with minimal change) to the amino acid sequence of the synthesized protein, i.e. synonymous mutations. Codon optimization can affect protein expression rates up to 1,000 fold, particularly by favoring efficient soluble protein expression. The codons changed are typically ones not generally used by the host cell translation system. Codon bias/codon usage frequency depends on the host organism, and is described, for example, in U.S. Pat. No. 8,326,547, hereby incorporated by reference in its entirety.
[0084] A vector or vector system that codes for one or both variable region(s) of 10C10 may contain one of or both of SEQ ID NO: 7 and SEQ ID NO: 8 or a nucleotide sequence or sequences that shares or share a degree of homology with SEQ ID NO: 7 and/or SEQ ID NO: 8, e.g. at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 95%, or more than 95% homology with either or both of SEQ ID NO: 7 and SEQ ID NO: 8. Independent of such homology, SEQ ID NO: 7 and/or SEQ ID NO: 8 may have conservative substitutions and such would be considered to be within the scope of this invention. The nucleotide sequences coding for the variable regions may or may not be on the same vector; for example, SEQ ID NO: 7 may be on a first vector (e.g. a first plasmid) and SEQ ID NO: 8 may be on a second vector (e.g. a second plasmid). Such a system may allow for greater control of expression, for example, by allowing for the expression of the variable light and/or heavy chain to be separately inducible.
[0085] A vector or vector system that codes for one or both variable region(s) of 5C3 may contain one of or both of SEQ ID NO: 3 and SEQ ID NO: 4 or a nucleotide sequence or sequences that shares or share a degree of homology with SEQ ID NO: 3 and/or SEQ ID NO: 4, e.g. at least 75% homology up to, at least 80% homology, at least 85% homology at least 90% homology, at least 95%, or more than 95% homology either or both of SEQ ID NO: 3 and SEQ ID NO: 4. Independent of such homology, SEQ ID NO: 3 and/or SEQ ID NO: 4 may have conservative substitutions and such would be considered to be within the scope of this invention. As discussed herein, the nucleotide sequences coding for the variable regions may or may not be on the same vector and expression of such may or may not be separately inducible.
[0086] A vector or vector system that codes for one or both variable region(s) of 8H12 may contain one of or both of SEQ ID NO: 5 and SEQ ID NO: 6 or a nucleotide sequence or sequences that shares or share a degree of homology with SEQ ID NO: 5 and/or SEQ ID NO: 6, e.g. at least 75% homology up to, at least 80% homology, at least 85% homology at least 90% homology, at least 95%, or more than 95% homology either or both of SEQ ID NO: 5 and SEQ ID NO: 6. Independent of such homology, SEQ ID NO: 5 and/or SEQ ID NO: 6 may have conservative substitutions and such would be considered to be within the scope of this invention. As discussed herein, the nucleotide sequences coding for the variable regions may or may not be on the same vector and expression of such may or may not be separately inducible.
[0087] Some embodiments of the present disclosure are directed to methods of making a recombinant anti-HCMV antibody, e.g. a chimeric anti-HCMV antibody or a humanized anti-HCMV antibody. In the case of a chimeric antibody, a host cell (e.g. a yeast cell or an E. coli cell) is transfected (e.g. by a phage) by a vector, including those discussed supra, containing genes coding for the variable heavy/light regions of one or more anti-HCMV antibodies, e.g. SEQ ID NO: 3 and/or SEQ ID NO:4 in the case of 5C3, SEQ ID NO: 7 and SEQ ID NO: 8 in the case of 10C10, SEQ ID NO: 5 and SEQ ID NO: 6 in the case of 8H12, or, in the case of humanized antibodies, they may be transfected by a vector that contains nucleotides coding for CDRs of the variable heavy/light regions of the anti-HCMV antibodies, e.g. nucleotide sequence or sequences coding for one or more of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, and/or SEQ ID NO: 32. These nucleotides coding for CDRs may have conservative substitutions and, independent of such conservative substitutions, may share a certain degree of homology (i.e. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or more than 95%) with the nucleotide sequences coding for one or more of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, and/or SEQ ID NO: 32. With either chimeric or humanized antibodies, the Fc region will remain human. The transformed host cell will then be induced to produce the recombinant antibodies, which may assemble the antibodies from heavy/light chains in the host cell and then transport the antibodies out of the cell, or the antibodies may self-assemble outside the host cell and be exported as heavy/light chains. Common host cells may include yeast cells, e.g. S. cerevisiae, S. pombe and P. pastoris, bacteria, e.g. E. coli, and mammalian cells, e.g. Chinese hamster ovary (CHO) cells, including DUXB11, DG44 and CHOK1 lineages, NSO murine myeloma cells, PER.C6 human cells, and human embryonic kidney (HEK) cells, e.g. HEK293. Other less common host cells, but still included within the scope of the invention, include plant cells, for example, those based on the Ti plasmid of Agrobacterium tumefaciens. Cell-free expression systems also exist, for example, based on E. coli cell lysate, containing cellular components necessary for transcription/translation. Eukaryotic and mammalian cell-free systems are also known in the art, for example wheat germ cell-free expression system, and those described in Brodel et al. (2015), Methods Mol Bio. 1261: 129-40, hereby incorporated by reference in its entirety. Some recombinant antibody production systems express the recombinant antibodies on the surface of the host cell before harvesting, others simply release the antibodies into a medium for collection. Such variations are intended to be within the scope of the present disclosure.
D. Kits and Methods of Use
[0088] One embodiment of the present disclosure is directed to kits for detecting HCMV present in a sample. These kits may comprise an anti-HCMV antibody or antigen-binding portion thereof of the present disclosure and various reagents, for example, reagents that aid in detection of binding between the anti-HCMV antibody and an epitope present on HCMV or an antigenic fragment thereof. In some embodiments, the anti-HCMV antibodies or antigen-binding portion thereof specifically bind to one or more epitopes within SEQ ID NO: 1.
[0089] The kits may be in vitro assays, such as immunoassays, e.g. enzyme immune assays (EIA), enzyme linked immunosorbent assay (ELISA), ELISPOT (enzyme-linked immunospot), radioimmunoassays (RIAs), immunofluorescence, and other assays known in the art, including but not limited to Western Blot analysis and/or immunoprecipitation methods. The in vitro assays may be competitive, or indirect, such as in a sandwich assay, or may be an antibody capture method. For example in a direct ELISA, a buffered solution of an antigen, e.g. a sample containing HCMV or an antigenic fragment thereof (e.g. a biological sample containing or suspected of containing HCMV), including but not limited to SEQ ID NO: 1, is added to a well of a microtiter plate, e.g. a 96-well plate. A solution of non-reacting protein, e.g. bovine serum albumin or casein is then added to the well. The anti-HCMV antibody or antigen-binding portions thereof conjugated to a reporter molecule enzyme is added, e.g. conjugated to horse-radish peroxidase, although that is not necessarily the enzyme, as other common enzymes include alkaline phosphatase, or -D-galactosidase, although other enzymes are conceivable and considered embodied by the present disclosure. A substrate for the enzyme is then added, which leads to a detectable signal. For example, adding TMB to horseradish peroxidase leads to a colored product, in which case the ELISA is a colorimetric assay. ELISAs may be run in a qualitative or quantitative format. Qualitative results provide a simple positive or negative result (yes or no) for a sample. The cutoff between positive and negative is determined by the analyst and may be statistical. Sandwich ELISAs generally follow the following protocol. Capture anti-HCMV antibody or antigen-binding portions thereof is bound to (i.e. immobilized) on a substrate, e.g. a microtiter plate. Antigen-containing sample (i.e. sample containing HCMV or an antigenic fragment thereof, including but not limited to SEQ ID NO: 1, is then added to the substrate at which point it is captured by the anti-HCMV antibodies. The substrate is then washed to remove unbound antigen. A second anti-HCMV antibody or antigen-binding portions thereof is added, which binds to a different epitope on HCMV, including but not limited SEQ ID NO: 1. The second anti-HCMV antibody or antigen-binding portions thereof is bound to a reporter molecule, e.g. an enzyme, although the reporter molecule may be any molecule which leads to a detectable signal. The plate may be washed a second time, and in those instances where the reporter molecule is an enzyme, a substrate may be added, e.g. TMB, that results in a detectable signal (also a colorimetric assay). A third type of common ELISA is competitive ELISA. In these embodiments, unlabeled anti-HCMV antibody or antigen-binding portions thereof is incubated in the presence of an antigen-containing sample (i.e. sample containing HCMV or an antigenic fragment thereof, including but not limited to SEQ ID NO: 1), which are then added to an antigen-coated well. The plate is washed so as to remove unbound antibodies. A secondary antibody that is specific to the primary antibody, e.g. a secondary antibody specific to anti-HCMV antibodies. The secondary antibody is bound to a reporter molecule, as described herein, such as an enzyme (or any other molecule that may lead to a detectable signal). Some competitive ELISA utilize labeled antigens rather than labeled antibodies; the less antigen in the sample, the more labeled antigen is retained and the stronger a detectable signal results.
[0090] Other forms of common in vitro assays include radioimmunoassays (RIAs). Typically a known quantity of an antigen is linked to a radioactive tracer, e.g. 1-125 although others are suitable for use, which is then mixed with a known amount of antibody specific for the antigen, e.g. anti-HCMV antibodies or antigen-binding portions thereof. Then, a sample containing unknown quantity of an antigen is added, (e.g. a biological sample that contains or is suspected of containing HCMV or an antigenic fragment thereof) is added. This is a direct competitive for specific binding; as the concentration of unlabeled antigen is increased, the binding between the anti-HCMV antibodies and the labeled standard is decreased, which is directly measurable by measuring radioactivity. Other assays are known and a person of ordinary skill in the art would readily recognize their applicability.
[0091] In some embodiments, the invention is directed to a method of detecting HCMV or an antigenic fragment thereof in a sample, including but not limited to SEQ ID NO:1. Such methods may utilize any of the assays described herein, or others that are known in the art. Several of the assays described herein are capable of quantifying the amount of antigen present in a sample, and so accordingly, in some embodiments, the present disclosure is directed to methods of quantifying the amount of HCMV or antigenic fragments thereof present in a sample, e.g. a biological sample.
[0092] The assays containing anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may or may not be utilized for diagnostic purposes. Accordingly, in some embodiments, the invention is directed to methods of diagnostic use of the anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure. Because of the specificity of the anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure, immunoassays containing anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may be sufficient to diagnose an individual as having an active or latent infection of HCMV. The antibodies or antigen-binding portions thereof need not be restricted to any particular epitopes, so long as the antibodies or antigen-binding portions thereof used are specific to HCMV. For example, in a sandwich assay, the first anti-HCMV antibody or antigen-binding portions thereof may bind to a first epitope, such as a gH or gB glycoprotein, and the second anti-HCMV antibody or antigen-binding portions thereof (which is bound to a reporter molecule) may bind to a second epitope; for example, but not necessarily, if the first anti-HCMV antibody or antigen-binding portions thereof specifically binds to the glycoprotein gH, the second may bind to glycoprotein gB, and the reverse is true as well. For example, the anti-HCMV antibody 8H12 specifically binds to glycoprotein gB, and the anti-HCMV antibodies 5C3 and 10C10 specifically bind to one or more epitopes within SEQ ID NO: 1, which is located within glycoprotein gH. Accordingly, kits and methods used to detect or quantify the amount of HCMV or an antigenic fragment thereof may contain 8H12 and one of 5C3 and 10C10 and would be considered within the scope of this invention. Or, any of 8H12, 5C3, 10C10, including antigen-binding portions thereof, and any other anti-HCMV antibody, so long as they are suitable for incorporation into such kits/methods. In some embodiments, the first antibody or antigen-binding portions thereof and second antibody or antigen-binding portions thereof may bind to the same antigen/glycoprotein, e.g. both may bind to glycoprotein gH, gB, or in some embodiments may bind to completely different antigens on surface of HCMV viral envelope. For example, but not necessarily limited to, as described in Example 10 supra, human-derived monoclonal antibody MSL-109 specifically binds to an epitope containing amino acid no. 168 of glycoprotein gH, while the monoclonal antibodies 10C10 and 5C3 specifically bind to the one or more epitopes within SEQ ID NO: 1. Because of the distance between binding sites, these antibodies or antigen-binding portions thereof may be suitable for use in those immunoassays, e.g. sandwich assays, in which multiple binding sites on the same target (e.g. HCMV or an antigenic fragment thereof) are necessary. Or, in some embodiments, one may target a totally different antigen, e.g. the first anti-HCMV antibody or antigen-binding portions thereof targets an epitope on glycoprotein gH (e.g. MSL-109, 10C10, and/or 5C3) and the second anti-HCMV antibody targets an epitope elsewhere, for example but not necessarily glycoprotein gB, gH, gL, gO, UL128, UL130, and/or UL131a and the antigenic fragments thereof of the corresponding antigens. One will appreciate that the anti-HCMV antibodies or antigen-binding portions thereof used for purposes of detecting and/or quantifying HCMV present in a sample or even for diagnostic purposes do not necessarily need to be capable of broadly neutralizing HCMV to possess utility for such purposes, accordingly anti-HCMV antibodies such as, for example, 8H12 are suitable for use in such diagnostic methods.
E. Therapeutic Compositions, Methods, and Vaccines
[0093] One embodiment of the present disclosure is directed towards pharmaceutical compositions comprising at least one anti-HCMV antibody or antigen-binding portion thereof of the present disclosure, as well as their methods of use in treating a patient in need thereof. The patient may have a latent or active infection by a virulent strain of HCMV. The anti-HCMV antibodies or antigen-binding portions thereof utilized in these compositions and methods may be any anti-HCMV antibody or antigen-binding portion thereof of the present disclosure, but of particular utility are those anti-HCMV antibodies or antigen-binding portions thereof that specifically bind to one or more epitopes within SEQ ID NO: 1 found on the glycoprotein gH, e.g. 10C10 and 5C3.
[0094] A pharmaceutically acceptable anti-HCMV antibody or antigen-binding portions thereof composition suitable for patient administration will contain an effective amount of the anti-HCMV antibody or antibodies or antigen-binding portions thereof in a formulation which both retains biological activity while also promoting maximal stability during storage within an acceptable temperature range. The pharmaceutical compositions can also include, depending on the formulation desired, pharmaceutically acceptable diluents, pharmaceutically acceptable carriers and/or pharmaceutically acceptable excipients, or any such vehicle commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water, physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution. The amount of an excipient that is useful in the pharmaceutical composition or formulation of this invention is an amount that serves to uniformly distribute the antibody throughout the composition so that it can be uniformly dispersed when it is to be delivered to a subject in need thereof. It may serve to dilute the antibody to a concentration which provides the desired beneficial palliative or curative results while at the same time minimizing any adverse side effects that might occur from too high a concentration. It may also have a preservative effect. Thus, for antibodies having a high physiological activity, more of the excipient will be employed. On the other hand, for any active ingredient(s) that exhibit a lower physiological activity, a lesser quantity of the excipient will be employed.
[0095] The pharmaceutically acceptable composition may be in liquid form or solid form. A solid formulation is generally, but not necessarily, lyophilized and brought into solution prior to administration for either single or multiple dosing. The formulations should not be exposed to extreme temperature or pH so as to avoid thermal denaturation. Thus, it is essential to formulate an antibody composition of the present disclosure within a biologically relevant pH range. A solution buffered to maintain a proper pH range during storage is often necessary, especially for liquid formulations stored for longer periods of time between formulation and administration. Typically, both liquid and solid formulations require storage at lower temperatures (usually 2-8 C.) in order to retain stability for longer periods. Formulated antibody compositions, especially liquid formulations, may contain a bacteriostat to prevent or minimize proteolysis during storage, including but not limited to effective concentrations (usually <1% w/v) of benzyl alcohol, phenol, m-cresol, chlorobutanol, methylparaben, and/or propylparaben. A bacteriostat may be contraindicated for some patients. Therefore, a lyophilized formulation may be reconstituted in a solution either containing or not containing such a component. Additional components may be added to either a buffered liquid or solid antibody formulation, including but not limited to sugars as a cryoprotectant (including but not necessarily limited to polyhydroxy hydrocarbons such as sorbitol, mannitol, glycerol and dulcitol and/or disaccharides such as sucrose, lactose, maltose or trehalose) and, in some instances, a relevant salt (including but not limited to NaCl, KCl or LiCl). Such antibody formulations, especially liquid formulations slated for long term storage, will rely on a useful range of total osmolarity to both promote long term stability at temperature of 2-8 C., or higher, while also making the formulation useful for parenteral injection. For example, but not necessarily, an effective range of total osmolarity (the total number of molecules in solution) may be from about 200 mOs/L to about 800 mOs/L. It will be apparent that the amount of a cyroprotectant, such as sucrose or sorbitol, will depend upon the amount of salt in the formulation in order for the total osmolarity of the solution to remain within an appropriate range. Therefore a salt free formulation may, but not necessarily, contain from about 5% to about 25% sucrose.
[0096] Alternatively, a salt free sorbitol-based formulation may, but not necessarily, contain sorbitol within a range from about 3% to about 12%. Salt-free formulations will of course warrant increased ranges of the respective cryoprotectant in order to maintain effective osmolarity levels. These formulation may also contain a divalent cation (including but not necessarily limited to MgCl.sub.2, CaCl.sub.2 and MnCl.sub.2); and a non-32 ionic surfactant (including but not necessarily limited to Polysorbate-80 (Tween 80), Polysorbate-60 (Tween 60), Polysorbate-40 (Tween 40) and Polysorbate-20 (Tween 20), polyoxyethylene alkyl ethers, including but not limited to Brij 58, Brij 35, as well as others such as Triton X-100, Triton X 114, NP40, Span 85 and the Pluronic series of non-ionic surfactants (e.g., Pluronic 121)). Any combination of such components, including probable inclusion of a bacteriostat, may be useful to fill the antibody-containing formulations of the present disclosure. The anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may also be a chemical derivative, which describes antibodies that contain additional chemical moieties which are not normally a part of the immunoglobulin molecule (e.g., pegylation). Such moieties may improve the solubility, half-life, absorption, etc. of the base molecule. Alternatively the moieties may attenuate undesirable side effects of the base molecule or decrease the toxicity of the base molecule.
[0097] For in vivo treatment of human and non-human patients, the patient is administered or provided a pharmaceutical formulation including at least one anti-HCMV antibody or antigen-binding portions thereof of the present disclosure. When used for in vivo therapy, the anti-HCMV antibodies or antigen-binding portions thereof of the invention are administered to the patient in therapeutically effective amounts (i.e., amounts that eliminate or reduce the total bacterial load). The antibodies are administered to a human patient, in accord with known methods, such as intravenous administration, for example, as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The antibodies or antigen-binding portions thereof can be administered parenterally, when possible, at the target cell site, or intravenously. In some embodiments, antibody is administered by intravenous or subcutaneous administration. Therapeutic compositions of the invention may be administered to a patient or subject systemically, parenterally, or locally. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
[0098] For parenteral administration, the anti-HCMV antibodies or antigen-binding portions thereof may formulated in a unit dosage injectable form (solution, suspension, emulsion) in association with a pharmaceutically acceptable, parenteral vehicle. Examples of such vehicles include, but are not limited, water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Non-aqueous vehicles include, but are not limited to, fixed oils and ethyl oleate. Liposomes can be used as carriers. The vehicle may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability, such as, for example, buffers and preservatives.
[0099] The anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may be administered to the host in any manner, strategy and/or combination available in the art in amounts sufficient to offer a therapeutic treatment against human cytomegalovirus. These compositions may be provided to the individual by a variety of routes known in the art, especially parenteral routes, including but in no way limited to parenteral routes such as intravenous (IV), intramuscular (IM); or subcutaneous (SC) administration, with IV administration being the norm within the art of therapeutic antibody administration. These compositions may be administered as separate or multiple doses (i.e., administration of the antibody at staggered times by maintaining the sterile condition of the formulation through the treatment regime).
[0100] The dose and dosage regimen depends upon a variety of factors readily determined by a physician, such as the nature of the infection, for example, its therapeutic index, the patient, and the patient's history. Generally, a therapeutically effective amount of an antibody is administered to a patient. In some embodiments, the amount of antibody administered is in the range of about 0.001 mg/kg to about 1000 mg/kg of patient body weight, and any range in between. Depending on the type and severity of the infection, about 0.1 mg/kg to about 50 mg/kg body weight (for example, about 0.1-15 mg/kg/dose) of antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The anti-HCMV antibodies can be delivered relatively low volume rates, for example but not necessarily from about 0.001 ml/day to 10 ml/day so as to minimize tissue disturbance or trauma near the site where the formulation is released. The formulation may be released at a rate of, depending on the specific biological agent(s), at a low dose, e.g., from about 0.01 g/hr or 0.1 g/hr, 0.25 g/hr, 1 g/hr, generally up to about 200 g/hr, or the formulation is delivered at a low volume rate e.g., a volume rate of from about 0.001 ml/day to about 1 ml/day, for example, 0.01 micrograms per day up to about 20 milligrams per day. Dosage depends on a number of factors such as potency, bioavailability, and toxicity of the active ingredient used (e.g. the anti-HCMV antibodies or antigen-binding portions thereof) and the requirements of the subject. The progress of this therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
[0101] Specific embodiments for delivery vehicles for anti-HCMV antibodies of the present disclosure include PLGA microspheres, as discussed herein and as further known in the art, as well as polymer-based non-degradable vehicles comprising poly (ethylene-co-vinyl acetate; PEVAc). Additionally, controlled-release and localized delivery of antibody-based therapeutic products is reviewed in Grainger, et al., 2004, Expert Opin. Biol. Ther. 4(7): 1029-1044), hereby incorporated by reference in its entirety. Suitable microcapsules capable of encapsulating the antibody may also include hydroxymethylcellulose or gelatin-microcapsules and polymethyl methacrylate microcapsules prepared by coacervation techniques or by interfacial polymerization. See PCT publication WO 99/24061 entitled Method for Producing IGF-1 Sustained-Release Formulations, wherein a protein is encapsulated in PLGA microspheres, this reference which is hereby incorporated herein by reference in its entirety. In addition, microemulsions or colloidal drug delivery systems such as liposomes and albumin microspheres, may also be used. Other preferred sustained-release compositions employ a bioadhesive to retain the antibody at the site of administration. As noted above, the sustained-release formulation may comprise a biodegradable polymer into which the antibody is disposed, which may provide for non-immediate release. Non-injectable devices may be described herein as an implant, pharmaceutical depot implant, depot implant, non-injectable depot or some such similar term. Common depot implants may include, but are not limited to, solid biodegradable and non-biodegradable polymer devices (such as an extended polymer or coaxial rod shaped device), as well as numerous pump systems also known in the art. Injectable devices are split into bolus injections (release and dissipation of the drug subsequent to injection), and repository or depot injections, which provide a storage reservoir at the site of injection, allowing for sustained-release of the biological agent over time. A depot implant may be surgically tethered to the point of delivery so as to provide an adequate reservoir for the prolonged release of the antibody over time. Such a device will be capable of carrying the drug formulation in such quantities as therapeutically or prophylactically required for treatment over the pre-selected period. The depot implant may also provide protection to the formulation from degradation by body processes (such as proteases) for the duration of treatment. As known in the art, the term sustained-release refers to the gradual (continuous or discontinuous) release of such an agent from the block polymer matrix over an extended period of time. Regardless of the specific device, the sustained-release of the composition will result in a local biologically effective concentrations of the antibody. A sustained release of the biological agent(s) will be for a period of a single day, several days, a week or more; but most likely for a month or more, or up to about six months, depending on the formulation. Natural or synthetic polymers known in the art will be useful as a depot implant due to characteristics such as versatile degradation kinetics, safety, and biocompatibility. These copolymers can be manipulated to modify the pharmacokinetics of the active ingredient, shield the agent from enzymatic attack, as well as degrading over time at the site of attachment or injection. The artisan will understand that there are ample teachings in the art to manipulate the properties of these copolymers, including the respective production process, catalysts used, and final molecular weight of the sustained-release depot implant or depot injection. Natural polymers include but are not limited to proteins (e.g., collagen, albumin or gelatin); polysaccharides (cellulose, starch, alginates, chitin, chitosan, cyclodextrin, dextran, hyaluronic acid) and lipids. Biodegradable synthetic polymers may include but are not limited to various polyesters, copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., 1983, Biopolymers 22:547-556), polylactides ([PLA]; U.S. Pat. No. 3,773,919 and EP 058,481), polylactate polyglycolate (PLGA) such as polylactide-co-glycolide (see, for example, U.S. Pat. Nos. 4,767,628 and 5,654,008), polyglycolide (PG), polyethylene glycol (PEG) conjugates of poly(-hydroxy acids), polyorthoesters, polyaspirins, polyphosphagenes, vinylpyrrolidone, polyvinyl alcohol (PVA), PVA-g-PLGA, PEGT-PBT copolymer (polyactive), methacrylates, poly(N-isopropylacrylamide), PEO-PPO-PEO (pluronics), PEO-PPO-PAA copolymers, PLGA-PEO-PLGA, polyorthoesters (POE), or any combinations thereof, as described above (see, for example, U.S. Pat. No. 6,991,654 and U.S. Pat. Appl. No. 20050187631, each of which is incorporated herein by reference in its entirety, hydrogels (see, for example, Langer et al., 1981, J. Biomed. Mater. Res. 15:167-277; Langer, 1982, Chem. Tech. 12:98-105, non-degradable ethylene-vinyl acetate (e.g. ethylene vinyl acetate disks and poly(ethylene-co-vinyl acetate)), degradable lactic acid-glycolic acid copolyers such as the Lupron Depot, poly-D-()-3-hydroxybutyric acid (EP 133,988), hyaluronic acid gels (see, for example, U.S. Pat. No. 4,636,524), alginic acid suspensions, polyorthoesters (POE), and the like. Polylactide (PLA) and its copolymers with glycolide (PLGA) have been well known in the art since the commercialization of the Lupron Depot, approved in 1989 as the first parenteral sustained-release formulation utilizing PLA polymers. Additional examples of products which utilize PLA and PLGA as excipients to achieve sustained-release of the active ingredient include Amidox (PLA; periodontal disease), Nutropin Depot (PLGA; with hGH), and the Trelstar Depot (PLGA; prostate cancer). Other synthetic polymers included but are not limited to poly(c-caprolactone), poly3-hydroxybutyrate, poly(-malic acid) and poly(dioxanone)]; polyanhydrides, polyurethane (see WO 2005/013936), polyamides, cyclodestrans, polyorthoesters, n-vinyl alcohol, polyethylene oxide/polyethylene terephthalate, polyphosphate, polyphosphonate, polyorthoester, polycyanoacrylate, polyethylenegylcol, polydihydropyran, and polyacytal. Non-biodegradable devices include but are not limited to various cellulose derivatives (carboxymethyl cellulose, cellulose acetate, cellulose acetate propionate, ethyl cellulose, hydroxypropyl methyl cellulose) silicon-based implants (polydimethylsiloxane), acrylic polymers, (polymethacrylate, polymethylmethacrylate, polyhydroxy(ethylmethylacrylate), as well as polyethylene-co-(vinyl acetate), poloxamer, polyvinylpyrrolidone, poloxamine, polypropylene, polyamide, polyacetal, polyester, poly ethylene-chlorotrifluoroethylene, polytetrafluoroethylene (PTFE or Teflon), styrene butadiene rubber, polyethylene, polypropylene, polyphenylene oxide-polystyrene, poly-a-chloro-p-xylene, polymethylpentene, polysulfone and other related biostable polymers. Carriers suitable for sustained-release depot formulations include, but are not limited to, microspheres, films, capsules, particles, gels, coatings, matrices, wafers, pills or other pharmaceutical delivery compositions. Examples of such sustained-release formulations are described above. See also U.S. Pat. Nos. 6,953,593; 6,946,146; 6,656,508; 6,541,033; and 6,451,346, the contents of each which are incorporated herein by reference. The dosage form must be capable of carrying the drug formulation in such quantities and concentration as therapeutically required for treatment over the pre-selected period, and must provide sufficient protection to the formulation from degradation by body processes for the duration of treatment. For example, the dosage form can be surrounded by an exterior made of a material that has properties to protect against degradation from metabolic processes and the risk of, e.g., leakage, cracking, breakage, or distortion. This can prevent expelling of the dosage form contents in an uncontrolled manner under stresses it would be subjected to during use, e.g., due to physical forces exerted upon the drug release device as a result of normal joint articulation and other movements by the subject or for example, in convective drug delivery devices, physical forces associated with pressure generated within the reservoir. The drug reservoir or other means for holding or containing the drug must also be of such material as to avoid unintended reactions with the active agent formulation, and is preferably biocompatible (e.g., where the dosage form is implanted, it is substantially non-reactive with respect to a subject's body or body fluids). Generally, the anti-HCMV antibodies are administered to an individual for at least 12 hours to at least a week, and most likely via an implant designed to deliver a drug for at least 10, 20, 30, 100 days or at least 4 months, or at least 6 months, 12 months, 24 months or more, as required.
[0102] In some embodiments, the anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may be co-administered with one or more additional treatments for HCMV, e.g. co-administered with one or more antivirals and/or additional anti-HCMV antibodies or antigen-binding portions thereof, including but not limited to additional anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure. The most common antiviral treatment for HCMV is ganciclovir, and accordingly in one embodiment the anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may be co-administered with ganciclovir. Other antivirals that would be acceptable include valganciclovir, forscarnet, and cidofovir, either in combination or alone, including in combination with ganciclovir. Additionally, co-administration may or may not be with additional anti-HCMV antibodies or antigen-binding portions thereof. Purely by way of example, those anti-HCMV antibodies which specifically bind to one or more epitopes within SEQ ID NO: 1 (e.g. 10C10 and 5C3) may be administered with additional anti-HCMV antibodies or antigen-binding portions thereof, including those that also target glycoprotein gH (but target a different epitope) such as MSL-109, as although previous studies have shown that human-derived MSL-109 is not broadly neutralizing, MSL-109 may be effective in combination with those anti-HCMV antibodies which specifically bind to one or more epitopes within SEQ ID NO: 1 (e.g. 10C10 and 5C3 or recombinant antibodies generated using the variable heavy/light regions or CDRs of such). Likewise, anti-HCMV antibodies which specifically bind to one or more epitopes within SEQ ID NO: 1 may be administered with antibodies that target glycoprotein gB, including the present anti-HCMV antibodies that target gB, as although not broadly neutralizing, are capable of neutralizing infection in at least some strains. For example, although 8H12 has not shown to be broadly neutralizing by itself, it may be effective in combination with those anti-HCMV antibodies which specifically bind to one or more epitopes within SEQ ID NO: 1 (e.g. 10C10 and 5C3 or recombinant antibodies generated using the variable heavy/light regions or CDRs of such) and thus should be considered part of this invention. The anti-HCMV antibodies or antigen-binding portions thereof that specifically target glycoprotein gH or antigenic fragments thereof may possibly combined other anti-HCMV antibodies or antigen-binding portions thereof, such as those targeting glycoprotein gL, which may be especially effective considering how glycoprotein gL is involved with gH in a heterodimer, trimer, and pentamer, or even anti-HCMV antibodies or antigen-binding portions thereof that target other antigens on the viral surface of HCMV, e.g. UL128, UL130 and/or UL131a. The anti-HCMV antibodies or antigen-binding portions thereof of the present disclosure may be administered with a variety of additional existing antibodies, such as Cytogam. These antibody combinations may or may not be co-administered with one or more antivirals, e.g. ganciclovir, valganciclovir, forscarnet, and/or cidofovir, and any other appropriate antivirals. Co-administration of the anti-HCMV antibodies of the present disclosure with each other or any other anti-HCMV antibodies and/or antivirals may or may not take place concurrently.
[0103] According to another embodiment, the present disclosure provides a passive vaccine or pharmaceutical compositions containing at least one anti-HCMV antibody or antigen-binding portions thereof of the invention and a pharmaceutically acceptable carrier. According to one embodiment, the vaccine or pharmaceutical compositions is a composition containing at least one antibody described herein and a pharmaceutically acceptable excipient. The vaccine can include a plurality of the antibodies having the characteristics described herein in any combination and can further include other anti-HCMV antibodies or antigen-binding portions thereof. The passive vaccine may comprise one or more pharmaceutically acceptable preservatives, carriers, and/or excipients, which are known in the art. In other embodiments, the present disclosure provides an active vaccine or pharmaceutical compositions containing HCMV or an antigenic fragment thereof. If HCMV is used, it may be attenuated. It may be heat-killed. If antigenic fragments are utilized, it may be preferable, although not necessary, to use glycoprotein gH, although fragments of glycoprotein gH such as those including SEQ ID NO: 1 may be acceptable, although the fragments containing SEQ ID NO: 1 should be large enough as to ensure that a proper conformational epitope is formed.
[0104] The present compositions may be used in an immunogenic composition to immunize an animal. Such immunogenic composition according to the invention may be used for the preparation of a vaccine. Preferably a prophylactic and/or therapeutic vaccine is produced. Thus, within the scope of this invention is an immunogenic or vaccine composition that contains a pharmaceutically acceptable carrier and an effective amount of an antigen as described supra. The carriers used in the composition can be selected on the basis of the mode and route of administration, and standard pharmaceutical practice. The composition can also contain an adjuvant. Examples of an adjuvant include a cholera toxin, Escherichia coli heat-labile enterotoxin, liposome, unmethylated DNA (CpG) or any other innate immune-stimulating complex. Various adjuvants that can be used to further increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
[0105] A vaccine formulation may be administered to a subject per se or in the form of a pharmaceutical or therapeutic composition. Compositions of the invention and an adjuvant may be manufactured by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes. Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the antigens of the invention into preparations which can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
[0106] For injection, vaccine preparations may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, phosphate buffered saline, or any other physiological saline buffer. The solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the composition may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
[0107] The amount of a composition administered depends, for example, on the particular antigen in the composition, whether an adjuvant is co-administered with the antigen, the type of adjuvant co-administered, the mode and frequency of administration, and the desired effect (e.g., protection or treatment), as can be determined by one skilled in the art. Determination of an effective amount of the vaccine formulation for administration is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein. An effective dose can be estimated initially from in vitro assays. For example, a dose can be formulated in animal models to achieve an induction of an immune response using techniques that are well known in the art. One having ordinary skill in the art could readily optimize administration to all animal species based on results described herein. Dosage amount and interval may be adjusted individually. For example, when used as a vaccine, the vaccine formulations of the invention may be administered in about 1 to 3 doses for a 1-36 week period. Preferably, 1 or 2 doses are administered, at intervals of about 3 weeks to about 4 months, and booster vaccinations may be given periodically thereafter. Alternative protocols may be appropriate for individual animals. A suitable dose is an amount of the vaccine formulation that, when administered as described above, is capable of raising an immune response in an immunized animal sufficient to protect the animal from an infection for at least 4 to 12 months. In general, the amount of the antigen present in a dose ranges from about 1 pg to about 100 mg per kg of host, typically from about 10 pg to about 1 mg, and preferably from about 100 pg to about 1 pg. Suitable dose range will vary with the route of injection and the size of the subject, but will typically range from about 0.1 mL to about 5 mL. Additional boosters can be given as needed.
F. Equivalents
[0108] Where a value of ranges is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges which may independently be included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either both of those included limits are also included in the invention.
[0109] Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference in their entireties.
[0110] As used herein and in the appended claims, the singular forms a, and and the include plural references unless the context clearly dictates otherwise.
[0111] The term about refers to a range of values which would not be considered by a person of ordinary skill in the art as substantially different from the baseline values. For example, the term about may refer to a value that is within 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value, as well as values intervening such stated values. Context will dictate what is appropriate in each circumstance.
[0112] Publications disclosed herein are provided solely for their disclosure prior to the filing date of the present disclosure. Nothing herein is to be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
[0113] Each of the applications and patents cited in this text, as well as each document or reference, patent or non-patent literature, cited in each of the applications and patents (including during the prosecution of each issued patent; application cited documents), and each of the PCT and foreign applications or patents corresponding to and/or claiming priority from any of these applications and patents, and each of the documents cited or referenced in each of the application cited documents, are hereby expressly incorporated herein by reference in their entirety. More generally, documents or references are cited in this text, either in a Reference List before the claims; or in the text itself; and, each of these documents or references (herein-cited references), as well as each document or reference cited in each of the herein-cited references (including any manufacturer's specifications, instructions, etc.), is hereby expressly incorporated herein by reference.
[0114] The following non-limiting examples serve to further illustrate the present disclosure.
VII. EXAMPLES
[0115] These examples identify and characterize potent, broad-spectrum human cytomegalovirus (HCMV) antibodies, specifically monoclonal antibodies (mAbs) that block infection of multiple cell types through a non-biased screening approach. High throughput selection of hybridomas derived from CMV-inoculated mice coupled with high-content neutralization (HCN) assays based on YFP reporter viruses were utilized to rapidly screen a large hybridoma library and identify an initial panel of 7 neutralizing mAbs. Two mAbs targeting the gH glycoprotein displayed remarkable potency, broad-spectrum properties, and the ability to inhibit both cell-free and cell-cell viral dissemination. Detailed biochemical characterization revealed that the gH mAbs bind to both the gH trimer and gH pentamer complexes, and the generation of conformational epitope libraries led to identification of a core binding region (SEQ ID NO: 1) in the central alpha helix-rich domain of the gH glycoproteins. In addition to developing anti-HCMV antibodies, the platform described here has led to the identification of an epitope within HCMV glycoprotein gH that is highly susceptible to antibody-mediated neutralization.
[0116] 1. Generation of Broadly-Neutralizing Anti-HCMV Antibodies
[0117] In this example, broad-spectrum anti-HCMV antibodies were generated using a high-throughput neutralization (HTN) assay. The measurement of fluorescent emission from cells infected with HCMV reporter strains provides an accurate proxy of HCMV infection levels. To validate that the reporter HCMV strain AD169 encoding for a chimeric IE2 protein Yellow Fluorescent Protein (YFP) (AD169.sub.IE2-YFP) could be utilized in a neutralization assay, various sources of anti-HCMV antibodies were tested for their neutralizing properties. HCMV-positive serum, purified anti-gH mAb 14-4b, supernatant from 14-4b hybridoma, and as controls HCMV-negative serum, an isotype control directed to MHCI heavy chain peptide (HC-10), and supernatant from anti-human CD44 hybridoma were pre-incubated with AD169.sub.IE2-YFP virus before adding to MRC5 cells. Fluorescence intensity from infected cells was than measured at 16 hpi using an Acumen .sup.eX3 fluorescent cytometer. Comparing mock-infected cells as 100% infection, purified 14-4b and supernatant from the 14-4b hybridoma were capable of neutralizing HCMV infection, while the isotype controls had no effect on infection levels, and the decrease of HCMV infection from virus incubated with HCMV-positive serum further validated the neutralization assay. Together the data support the validity of an AD169.sub.IE2-YFP-based neutralization assay to identify neutralizing antibody clones.
[0118] The use of a rapid and accurate fluorescent readout for quantifying HCMV infection presented an excellent strategy for the identification of novel neutralizing HCMV-antibodies. It was hypothesized that antibodies targeting the core binding and fusion envelope proteins (e.g. gB, gH, gL) would provide the best targets for broad-spectrum antibodies. To that end, mice were immunized with the lab strain AD169 because it expresses the core entry factors and lacks the pentamer complex due to the deletion of UL131a. The lack of the pentameric complex would thus exclude the generation of antibodies to the immunodominant UL128, UL130, and UL131 proteins. Following a series of immunization and boosts with purified virus, serum samples from various mice were analyzed for neutralization activity using the AD169.sub.IE2-YFP neutralization assay (
[0119] Subsequently, 2000 hybridoma clones were generated from the spleen of two mice using an automated clone picker to generate individual clones for identification of neutralizing antibodies. Supernatant from each hybridoma was subjected to the AD169.sub.IE2-YFP-MRC5 HTN assay. Following an initial neutralization assay (
[0120] To determine whether the neutralizing clones target viral glycoproteins, MRC5 fibroblasts infected with AD169.sub.IE2-YFP (MOI: 3) were subjected to flow cytometry with hybridoma clones (
[0121] 2. Identification of the HCMV-Neutralizing Antibody Viral Glycoprotein Targets
[0122] To determine the antigenic target(s) of the HCMV-neutralizing antibodies, an initial .sup.35S-methionine metabolic labeling experiment was conducted. MRC5 fibroblasts infected with AD169.sub.IE2-YFP (MOI: 5) were pulsed at 72 hpi for 12 hours prior to cell lysis. The antigenic targets of the neutralizing antibodies or an isotype control specific to GFP were recovered from cell lysates and resolved on a SDS-polyacrylamide gel (
[0123] As further confirmation of the identity of the proteins precipitated by the neutralizing antibodies, protein complexes recovered from AD169-infected fibroblasts with the Group I mAb 2F4 and Group II mAb 10C10 were resolved by SDS-PAGE and the predominant polypeptides were subjected to mass spectrometry analysis. The excised polypeptides recovered with 2F4 identified gB, while the 5C3-recovered proteins correspond to gH and gL peptides (Table 4). The data indicated that the neutralizing antibodies recover complexes that possess gH and gB glycoproteins.
[0124] To verify that the protein targets of the neutralizing antibodies were gB and gH, U373 glioblastoma cell lines expressing either the gH or gB protein that were cloned from the HCMV strain TB40/E (U373.sup.gH and U373.sup.gB) were generated (
[0125] In further validating that the antibodies recognize either gB or gH, the neutralizing antibodies were incubated with cell lysates from U373.sup.gH and U373.sup.gB cells and the recovered proteins were subjected to either an anti-gB or anti-gH immunoblot (
TABLE-US-00005 TABLE 4 Excised polypeptides Molecular Antibody Weight Group Clone (kDa) Rank Log(I) Gene Protein 1 2F4 130 1 7.8 UL55 gB 2 10C10 100 1 8.01 UL75 gH 30 1 7.74 UL115 gL
[0126] 3. Analysis of the Potency of HCMV-Neutralizing Antibodies
[0127] In order to examine the specificity of our HCMV-neutralizing antibodies, a reporter virus derived from the TB40/E HCMV strain was utilized, in which the US28 coding region was replaced with a DNA cassette encoding a FLAG-tagged YFP chimera (TB40/E.sub.FLAG-YFP). The TB40/E.sub.FLAG-YFP strain creates a robust fluorescent signal in the cytoplasm of infected cells that can be visualized beginning at 48 hpi and increasing in intensity throughout the infection cycle. TB40/E.sub.FLAG-YFP pre-incubated with -gH and -gB supernatants at 3 concentrations was used to infect MRC5 fibroblasts. At 120 hpi, fluorescence intensity was used to determine the number of YFP+ cells to calculate % infection using a non-neutralizing hybridoma as 100% (
[0128] To further assess the potency of the antibody panel, the IC50 values of the neutralizing antibodies were calculated using a AD169.sub.IE2-YFP or TB40/E.sub.FLAG-YFP HTN assay (
[0129] 4. Analysis of the Ability of Anti-gH Antibodies to Block Viral Infection and Dissemination
[0130] The ability of the -gH antibodies to neutralize additional clinical-like CMV strains was examined. Monoclonal antibodies 10C10 and 5C3 were pre-incubated with HCMV strains TB40/E, DAVIS, VHL/E, and TR at 9 g/mL prior to infection of MRC5 fibroblasts. At 72 hpi, total cell lysate were subjected to immunoblot analysis using an antibody to late antigen (
[0131] To determine the potency of the -gH mAbs against clinical-like strains, w a HTN assay using a fluorescently labeled antibody against the Immediate Early (IE) gene product (-IE.sup.FITC) was developed. AD169WT, TB40/EWT, VHL/E, and TR were pre-incubated with increasing concentrations of -gH mAb or Cytogam antibodies (
[0132] Finally, to assess how -gH mAbs affect HCMV proliferation, plaque reduction assays were performed in MRC5 cells infected with clinical-like strains DAVIS, TB40/EWT, VHL/E and TR (
[0133] 5. Examination of the Broad-Spectrum Neutralization Capability of Anti-gH mAbs in Epithelial Cells
[0134] To further analyze the efficacy of the -gH mAbs as a broad spectrum anti-viral, the potency in blocking virus infection of human retinal pigment epithelial cells (ARPE-19) was examinde. Accordingly, the TB40/E.sub.FLAG-YFP reporter strain was utilized to measure the efficacy of -gH mAbs to block infection of ARPE-19 cells (
TABLE-US-00006 TABLE 5 Different HCMV strains and assays performed Strain AD169- TB40/E IE2-YFO FLAG-YFP TR TB40/E VHL/E Davis Cell Type Fibroblast Fibroblast Fibroblast Epithelial Fibroblast Epithelial Fibroblast Epithelial Fibroblasts Assay IE2 FLAG-YFP Plaque -IE -IE Plaque -IE -IE Plaque -IE -IE Plaque 10C10 0.5 0.38 2.43 2.34 0.44 1.28 4.18 1.35 0.24 0.24 0.11 0.37 5C3 0.24 0.07 2.13 0.63 0.16 0.45 0.88 0.96 0.02 0.02 0.11 0.22 Cytogam 18.62 0.46 >6.25 >12.15 1.58 >6.25 >12.15 6.86 0.12 >12.15 10.91 >6.25
[0135] 6. Examination of the Capacity of Anti-gH mAbs to Block Cell-to-Cell Dissemination
[0136] To test whether the mAbs could also neutralize infection of replicated virus, transwell infection studies were conducted in fibroblast and epithelial cells (
[0137] To examine the ability of -gH mAbs to block cell-to-cell dissemination, ARPE-19 cells were infected with TB40/E-WT (moi: 0.1). At 48 hpi, cell supernatant was replaced with media containing various concentrations of -gH mAb, Cytogam antibodies, or an isotype control (0.5-12 g/mL). At 10 dpi, cells stained with an IE-FITC antibody to determine number of virus-infected cells. Cytogam and -gH mAbs were capable of limiting dissemination in a dose-dependent manner (
[0138] 7. -gH mAbs Bind to Multiple Glycoprotein Complexes
[0139] Given that gH undergoes extensive post-translational glycosylation and covalently binds to multiple viral proteins to generate a trimeric (gH/gL/gO) and pentameric complex (gH/gL/UL128/UL130/UL131), it was examiner whether the neutralizing -gH mAbs recognize diverse gH-containing complexes. Protein complexes recovered by anti-HCMV mAbs 10C10 and 5C3 from TB40/E-infected cells metabolically labeled with .sup.35S methionine at 120 hpi were subjected to PNGase treatment followed by SDS-PAGE under non-reducing conditions (
[0140] To confirm the identity of the protein complexes recovered by the gH mAbs, gH complexes recovered with 10C10 and 5C3 from TB40/E-infected fibroblasts were subjected to non-reducing SDS-PAGE followed by immunoblot analysis with an -gH mAb, rabbit anti-gL or anti-UL128 antibodies. The detection of UL128 that covalently binds to gH is used a proxy for the pentameric complex. As predicted, the anti-gH immunoblot revealed protein complexes with a wide range of molecular weights from 90 kDa to >250 kDa (
[0141] Finally, to confirm that the anti-gH antibodies were capable of binding to a region exposed on both gH/gL/gO trimer and the PC, stable U373 cell lines were constructed expressing gH, gL, and gO with a hemagglutinin (HA) tag, and cells that express gH, gL, and UL128 based on the TB40/E amino acid sequence (
[0142] 8. mAb 5C3 Binds Preferentially to gH Complexes
[0143] Cell lysates from U373 cells expressing different envelope proteins were incubated with different amounts of 10C10 or 5C3 mAb (2-0.1 g/mL) and the recovered protein complexes were resolved by SDS-PAGE and subjected to immunoblot analysis (
[0144] 9. -gH mAbs 10C10 and 5C3 Bind to Distinct but Proximal Epitopes
[0145] To determine whether 10C10 and 5C3 recognize the same epitope on the gH protein, antibodies labeled with Alexa Fluor 647 dye were utilized in a binding competition assay. U373.sup.gH/gL cells were simultaneously exposed to 10C10.sup.647 at a fixed concentration (1 g/mL) and non-fluorescent 10C10, 5C3, or an isotype control at increasing concentrations (1-20 g/mL) (
[0146] 10. Identification of 10C10 and 5C3 Epitopes
[0147] The epitope of 5C3 and 10C10 were identified by generating amino- and carboxyl-terminal mutations of gH (
[0148] To confirm the identity of the 5C3 epitope and determine if 10C10 also targeted this region of the gH protein, a flow cytometry-based binding assay was established using gH mutants constructed by substituting residues within the putative epitope region with alanine. The mutant constructs were then transfected into HEK-293 cells together with gL, and binding by anti-gH antibodies was analyzed with flow cytometry. The validity of the assay was first demonstrated by transfecting wildtype gH, a mutant construct containing two alanine substitutions upstream of the putative epitope region (478-79), and a mutant containing a single alanine substitution in the human anti-gH monoclonal antibody MSL-109 epitope region (aa168) (
[0149] For a high-resolution picture of the specific residues required for binding by 10C10 or 5C3, sequential alanine substitutions were incorporated between residues 480 and 492, in which two residues at a time were replaced with alanines (
TABLE-US-00007 TABLE 6 average binding of antibodies to different HCMV gH alanine mutants Alanine Avg. binding (% of mass) Mutant MSL-109 MSL-109 480-486 66 3 14 485-492 65 2 49 478-488 100 100 100 480-481 87 70 72 482-483 92 91 85 484-485 86 3 76 486-487 66 2 56 488-489 111 98 113 490-491 89 72 92
[0150] 11. Genomic Analysis of Anti-HCMV mAbs
[0151] Messenger RNA (mRNA) and cDNA was generated from hybridoma cells expressing the monoclonal antibodies using standard techniques. To amplify heavy and light antibody chains, a polymerase chain reaction (PCR) was performed in two rounds using a set of multi-family specific primers for heavy and light variable genes in the first round, followed by sequencing; see Table 1 supra. From the sequence data, a set of specific primers were generated for the variable portion of the antibody gene which included a specific 5 and 3 primer to the VH and JH ends of the heavy chain variable gene and the VL and JL ends of the light chain variable gene. These specific primers also contained restriction enzyme sequences for cloning the PCR product into a plasmid vector. The second round of PCR was performed on the mRNA using the specific set of primers. DNA products from the PCR were isolated using a DNA purification kit and digested with restriction enzymes specific for the sites included in the primers. The heavy and light variable genes were then cloned using standard techniques known in the art into commercial or self-made plasmid vectors containing heavy or light constant genes, respectively, on the 3 end of the cloning site, and a signal sequence derived from a commonly expressed protein on the 5 end of the cloning site. Vectors also contained additional genes and promoters for amplification and selection in bacteria and also genes and promoters for expression and selection of the recombinant antibody in mammalian cells.
[0152] 12. Examination of Serum from Pregnant Women
[0153] Supplementation of serum drawn from pregnant women during the first trimester of pregnancy with mAb 5C3 demonstrated enhanced HCMV neutralizing ability regardless of serostatus (
[0154] It will be understood by those of skill in the art that numerous and various modifications can be made without departing from the scope and spirit of the present disclosure. Therefore, it should be understood that various embodiments of the invention described herein are illustrative only and not intended to limit the scope of the invention. All references cited herein are hereby incorporated by reference in their entirety.