METHODS AND REAGENTS TO LABEL BACTERIA AND VIRUS AND IDENTIFY THEIR INTERACTING PROTEINS
20200333354 ยท 2020-10-22
Assignee
Inventors
- Weiguo Andy Tao (Lafayette, IN, US)
- Ying Zhang (Shanghai, CN)
- Mayank Srivastava (West Lafayette, IN, US)
Cpc classification
G01N2500/04
PHYSICS
G01N33/6842
PHYSICS
G01N33/6845
PHYSICS
International classification
Abstract
Disclosed herein is a chemo-proteomic probe for labelling and monitoring a live microbe interacting with a host cell and for qualitative and quantitative analyses of those proteins involved during a microbe infects the host cell. This probe comprises a functional group for conjugating to a surface protein of a live microbe under a physiological condition; a photo-reactive group for covalent cross-linking to an interacting cell protein of a host; and a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative proteomics analyses. The probe may further comprise a visualization tag. This technology takes advantage of the high throughput feature of mass spectrometry analysis and combines it with a uniquely designed chemistry to achieve high efficient isolation and analysis of host cell proteins interacting with a pathogen at different stages of an infection.
Claims
1. A chemo-proteomic probe comprising: a) a functional group for conjugating to a surface protein of a live microbe under a physiological condition; b) a photo-reactive group for covalent cross-linking to an interacting protein of a host cell; and c) a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative analyses.
2. The chemo-proteomic probe according to claim 1 further comprising a visualization tag for viewing the interactions between the microbe and a host cell in real time.
3. The chemo-proteomic probe according to claim 1, wherein the live microbe is a pathogen to human or an animal comprising a bacterium or a virus.
4. The chemo-proteomic probe according to claim 1, wherein the probe is suitable for studying the temporal interactions between a pathogen and its host cell.
5. The chemo-proteomic probe according to claim 1, wherein the photo-reactive group is a photocrosslinker or a photocleavable caging group.
6. The chemo-proteomic probe according to claim 6, wherein the photocrosslinker is a diazirine or an aryl azide.
7. The chemo-proteomic probe according to claim 1, wherein the probe has a formula: ##STR00008## or an acceptable salt thereof, wherein X is said functional group selected from the group consisting of N-hydroxysuccinimide (NHS), maleimide (MAL), or aminooxy (ONH.sub.2).
8. The chemo-proteomic probe according to claim 7, wherein said X is ##STR00009##
9. The chemo-proteomic probe according to claim 1, wherein the tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative analyses is selected from the group consisting of biotin, thiobiotin, azide-alkyne, aldehyde-hydrazine, aldehyde-hydroxylamine, thiol-iodoacetyl, and a thiobiotin-based affinity tag.
10. The chemo-proteomic probe according to claim 1, wherein the live microbe is a bacterium or a virus and the docking surface reactive group of a host cell for covalent conjugation is a reactive group of glycan.
11. The chemo-proteomic probe according to claim 1, wherein the live microbe is a bacterium or a virus and the docking surface reactive group of a host cell for covalent conjugation is a functional group selected from the group consisting of amino (NH.sub.2) and thiol (SH).
12. A method of identifying proteins interactions between a host and a pathogen microbe in real time, comprising the steps of: a) providing a chemo-proteomic probe comprising: a functional group for conjugating to a surface protein of a live microbe under a physiological condition; a photo-reactive group for covalent cross-linking to an interacting protein of a host cell; and a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative analyses; b) allowing the microbe to infect the host; c) crosslinking at fixed time points so that the interacting proteins of the host cells have sufficiently interacted with the surface proteins of the pathogen microbe; d) isolating the cross-linked complex of the surface proteins of said pathogen microbe and the interacting cell proteins of a host utilizing the tag; and e) performing qualitative and quantitative analyses of the isolated cross-linked protein complex.
13. The method according to claim 12, wherein the pathogen microbe is a virus or a bacterium.
14. The method according to claim 12, wherein the qualitative and quantitative analysis is to sequence the isolated cross-linked protein complex by mass spectroscopy.
15. The method according to claim 12, wherein the chemo-proteomic probe further comprising a visualization tag to view the microbe-host cell interaction in real time.
16. The method according to claim 15, wherein the photo-reactive group is a diazirine or an aryl azide.
17. The method according to claim 15, wherein the chemo-proteomic probe has a formula: ##STR00010## or an acceptable salt thereof, wherein X is said functional group selected from the group consisting of N-hydroxysuccinimide (NHS), maleimide (MAL), or aminooxy (ONH.sub.2).
18. The method according to claim 19, wherein said X is ##STR00011##
19. The method according to claim 19, wherein the tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting cell protein of a host for qualitative and quantitative analyses is selected from the group consisting of biotin, thiobiotin, azide-alkyne, aldehyde-hydrazine/hydroxylamine, thiol-iodoacetyl, and a thiobiotin-based affinity tag.
20. A kit for identifying interactions between a host cell and a pathogen microbe in real time, comprising: a) a chemo-proteomic probe comprising: a functional group for conjugating to a surface protein of a live microbe under a physiological condition; a photo-reactive group for covalent cross-linking to an interacting cell protein of a host; and a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting cell protein of a host for qualitative and quantitative proteomics analyses; and b) reagents for enabling said conjugation and crosslinking.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
BRIEF DESCRIPTION OF SEQUENCE LISTING
[0028] SEQ ID NO:1, Peptide E protein of Zika identified by mass spectrometric analysis:
TABLE-US-00001 IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTV SNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRG WGNGCGLFGKGSLVTCAKFTCSKKMTGKSIQPENLEYRIMLSVHGSQHSG MIGYETDEDRAKVEVTPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYL TMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQT VVVLGSQEGAVHTALAGALEAEMDGAKGRLFSGHLKCRLKMDKLRLKGVS YSLCTAAFTFTKVPAETLHGTVTVEVQYAGTDGPCKIPVQMAVDMQTLTP VGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGDKKITHHWHRSG STIGKAFEATVRGAKRMAVLGDTAWDFGSVGGVFNSLGKGIHQIFGAAFK SLFGGMSWFSQILIGTLLVWLGLNTKNGSISLTCLALGGVMIFLSTAVSA
DETAILED DESCRIPTION
[0029] While the concepts of the present disclosure are illustrated and described in detail in the figures and the description herein, results in the figures and their description are to be considered as exemplary and not restrictive in character; it being understood that only the illustrative embodiments are shown and described and that all changes and modifications that come within the spirit of the disclosure are desired to be protected.
[0030] As used herein, the following terms and phrases shall have the meanings set forth below. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art.
[0031] In the present disclosure the term about can allow for a degree of variability in a value or range, for example, within 10%, within 5%, or within 1% of a stated value or of a stated limit of a range. In the present disclosure, the term substantially can allow for a degree of variability in a value or range, for example, within 90%, within 95%, 99%, 99.5%, 99.9%, 99.99%, or at least about 99.999% or more of a stated value or of a stated limit of a range.
[0032] The term substituted as used herein refers to a functional group in which one or more hydrogen atoms contained therein are replaced by one or more non-hydrogen atoms. The term functional group or substituent as used herein refers to a group that can be or is substituted onto a molecule. Examples of substituents or functional groups include, but are not limited to, a halogen (e.g., F, Cl, Br, and I); an oxygen atom in groups such as hydroxyl groups, alkoxy groups, aryloxy groups, aralkyloxy groups, oxo(carbonyl) groups, carboxyl groups including carboxylic acids, carboxylates, and carboxylate esters; a sulfur atom in groups such as thiol groups, alkyl and aryl sulfide groups, sulfoxide groups, sulfone groups, sulfonyl groups, and sulfonamide groups; a nitrogen atom in groups such as amines, azides, hydroxylamines, cyano, nitro groups, N-oxides, hydrazides, and enamines; and other heteroatoms in various other groups.
[0033] Disclosed herein is a chemo-proteomic probe for labelling and monitoring a live microbe interacting with a host cell and for qualitative and quantitative analyses of those proteins involved during a microbe infects the host cell. This probe comprises a functional group for conjugating to a surface protein of a live microbe under a physiological condition; a photo-reactive group for covalent cross-linking to an interacting cell protein of a host; and a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative proteomics analyses. The probe may further comprise a visualization tag. This technology takes advantage of the high throughput feature of mass spectrometry analysis and combines it with a uniquely designed chemistry to achieve high efficient isolation and analysis of host cell proteins interacting with a pathogen at different stages of an infection.
[0034] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe comprising: [0035] a) a functional group for conjugating to a surface protein of a live microbe under a physiological condition; [0036] b) a photo-reactive group for covalent cross-linking to an interacting protein of a host cell; and [0037] c) a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative analyses.
[0038] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, the chemo-proteomic probe further comprising a visualization tag for viewing the interactions between the microbe and a host cell in real time.
[0039] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the live microbe is a pathogen to human or an animal comprising a bacterium or a virus.
[0040] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the live microbe is a bacterium or a virus.
[0041] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the probe is suitable for studying the temporal interactions between a pathogen and its host cell.
[0042] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the photo-reactive group is a photocrosslinker or a photocleavable caging group.
[0043] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the photocrosslinker is a diazirine or an aryl azide.
[0044] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the probe has a formula:
##STR00001## [0045] or an acceptable salt thereof, wherein X is said functional group selected from the group consisting of N-hydroxysuccinimide (NHS), maleimide (MAL), or aminooxy (ONH.sub.2).
[0046] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the probe has a formula (I) and wherein said X is
##STR00002##
[0047] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative analyses is selected from the group consisting of biotin, thiobiotin, azide-alkyne, aldehyde-hydrazine, aldehyde-hydroxylamine, thiol-iodoacetyl, and a thiobiotin-based affinity tag.
[0048] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the live microbe is a bacterium or a virus and the docking surface reactive group of a host cell for covalent conjugation is a reactive group of glycan.
[0049] In some illustrative embodiments, the present disclosure relates to a chemo-proteomic probe as disclosed herein, wherein the live microbe is a bacterium or a virus and the docking surface reactive group of a host cell for covalent conjugation is a functional group selected from the group consisting of amino (NH.sub.2) and thiol (SH).
[0050] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time, comprising the steps of: [0051] a) providing a chemo-proteomic probe comprising: a functional group for conjugating to a surface protein of a live microbe under a physiological condition; a photo-reactive group for covalent cross-linking to an interacting protein of a host cell; and a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting protein of a host cell for qualitative and quantitative analyses; [0052] b) allowing the microbe to infect the host; [0053] c) crosslinking at fixed time points so that the interacting proteins of the host cells have sufficiently interacted with the surface proteins of the pathogen microbe; [0054] d) isolating the cross-linked complex of the surface proteins of said pathogen microbe and the interacting cell proteins of a host utilizing the tag; and [0055] e) performing qualitative and quantitative analyses of the isolated cross-linked protein complex.
[0056] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the pathogen microbe is a virus or a bacterium.
[0057] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the qualitative and quantitative analysis is to sequence the isolated cross-linked protein complex by mass spectroscopy.
[0058] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the chemo-proteomic probe further comprising a visualization tag to view the microbe-host cell interaction in real time.
[0059] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the photo-reactive group is a diazirine or an aryl azide.
[0060] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the chemo-proteomic probe has a formula:
##STR00003## [0061] or an acceptable salt thereof, wherein X is said functional group selected from the group consisting of N-hydroxysuccinimide (NHS), maleimide (MAL), or aminooxy (ONH.sub.2).
[0062] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the probe has a formula (I) and wherein said X is
##STR00004##
[0063] In some other illustrative embodiments, the present disclosure relates to a method of identifying proteins interactions between a host and a pathogen microbe in real time as disclosed herein, wherein the tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting cell protein of a host for qualitative and quantitative analyses is selected from the group consisting of biotin, thiobiotin, azide-alkyne, aldehyde-hydrazine/hydroxylamine, thiol-iodoacetyl, and a thiobiotin-based affinity tag.
[0064] In some other illustrative embodiments, the present disclosure relates to a kit for identifying interactions between a host cell and a pathogen microbe in real time, comprising: [0065] a) a chemo-proteomic probe comprising: a functional group for conjugating to a surface protein of a live microbe under a physiological condition; a photo-reactive group for covalent cross-linking to an interacting cell protein of a host; and a tag for isolating the cross-linked complex of the surface protein of said live microbe and the interacting cell protein of a host for qualitative and quantitative proteomics analyses; and [0066] b) reagents for enabling said conjugation and crosslinking.
[0067] The interaction between hosts and pathogens are complex and are still incompletely understood. Although in vivo pathogen-host cell protein interactions have been achieved through various approaches on certain time point during the infection, studying the temporal profile of interaction between pathogen and host and their dynamic regulation during infection is still challenge due to the lacking of method. Towards this goal, we developed an in-vivo crosslinking chemical proteomics strategy in this study and it is successfully demonstrated to provide a comprehensive approach for describing temporal interactions changes in pathogen and host during infection in a temporal manner. As this chemical proteomic approach is applicable to many bacteria or virus, we believe it would contribute to the discovery and understanding of host-pathogen interactions in other systems, and therefore can further help to acquire new insights into the communication between the two organisms as well as to get a better understanding of the infection process on a molecular level.
[0068] The use of photoactivatable probes offers a key advantage of light-controlled conversion of transient noncovalent interactions into covalent isolable complexes, thus enabling large-scale identification of ligand (e.g., drug, lipid or enzyme)-binding proteins by mass spectrometry. In previous study, through functionalized dendrimer with a UV crosslinking group together with a fluorescent group and an isolation group, we achieved tracing of the endocytosis of nanoparticle into cells. Therefore, we assume that taking advantage of the photo-crosslinking can be carried out in live mammalian cells where protein-protein interactions take place, and labeling the pathogen with such a tailor-made chemo-proteomics probe would be used to study the entry of pathogen into host cells.
[0069] Uncovering specific interactions between host cells and pathogens and measuring the proteome changes in host cells after pathogen infection is critical for understanding the biology of pathogen infection..sup.[1] The study of infectious diseases has greatly benefited from the contribution of proteomic approaches which can provide a global view of host-pathogen interactions..sup.[2] However, there are still questions to be addressed. Most of the existing strategies for mapping of the host-pathogen interaction or the changes in proteome of host only focus on certain infection time points,.sup.[3-5] and thereby fall short in providing a temporal interaction profile that can cover a more complete infection cycle. Moreover, a lot of these interactions may be weak and transient, and thus are difficult to capture by traditional approaches.
[0070] Recently, several chemical proteomic approaches were introduced to identify receptors for ligands..sup.[6,7] These studies also imply their application in finding new putative pathogen-host interactions. As these approaches mainly aimed at capturing receptor through chemical reactions occurring on the host cell surface, they are not suitable for revealing the interactome after the pathogen enters the host cells. On the other hand, the use of photoactivatable probes offers a key advantage of light-controlled conversion of transient noncovalent interactions into covalent isolable complexes, thus enabling large-scale identification of ligands (e.g., drug, lipid)-binding proteins or substrates of enzyme within the cells by mass spectrometry (MS)..sup.[8-11]
[0071] Here, we report the development of a novel chemical proteomics strategy, termed host and pathogen temporal interaction profiling (HAPTIP), to globally map the host-pathogen interactome and demonstrate its application to the Salmonella infection process. Salmonella are Gram-negative bacterial pathogens that can infect a wide range of animals including humans, farm animals, and even plants..sup.[12] Upon infection, Salmonella replicates within host cells in a membrane bound compartment, called the Salmonella-containing vacuole (SCV)..sup.[13] Intravacuolar bacterial replication depends on tightly controlled interactions with host cell vesicular compartments. Therefore, it is crucial albeit technically challenging to characterize the interactions involved in the Salmonella infection process. The core of the HAPTIP method is a new multifunctional chemical proteomics probe bearing a labeling group that conjugates the probe to Salmonella surface, a photo-reactive diazirine group which allows for covalent crosslinking of Salmonella proteins to their interacting host cell proteins thereby facilitating the discovery of transient or weak interactions, and an isolation group for purifying the interacting proteins for quantitative proteomics analysis. We apply the HAPTIP to study the interactome of host-pathogen in a time-resolved manner throughout the course of SCV formation. To the best of our knowledge, this is the first attempt to chemically label living bacteria for proteome profiling of host cell response.
[0072] Labeling living bacteria chemically requires careful considerations: The labeling reaction and resulting covalent attachment should have minimal impact on the function and activity of bacteria; and the labeling should have good efficiency for the follow-up identification of low abundance, specific interacting proteins in the host cells. Accordingly, we prepared three probes with different types of labeling group (
[0073] after mildly oxidizing glycans on the Salmonella surface under physiological condition..sup.[15,16] As the oxidation condition we utilized only oxidizes the terminal sialic acid on the cell surface and the probe was designed with a cell permeant polyethylene glycol chain, the labeling is expected to attach the probe on the outmost surface, thus facilitating capturing interacting proteins with minimum steric hindrance. Moreover, because lipopolysaccharide (LPS) present on the outer membrane of Gram negative bacteria can recognize and bind cell surface receptors during infection, we assume that labeling the glycan chain would help to identify LPS-interacting proteins as well.
[0074] Salmonella was labeled with three distinctive probes and we examined the labeling efficiency and its effects on Salmonella growth, infection efficiency and intracellular survival. Results showed that the NHS-probe labeling affected bacterial growth (
[0075] As illustrated in
[0076] In total, we identified 442 crosslinked proteins in two biological replicates over the three time points during Salmonella internalization into macrophage cells. Proteins identified from samples and controls in each time point is shown in
[0077] Among specific proteins identified in each time point (
[0078] In addition to proteins those are previously reported to interact with Salmonella, we also discovered several proteins from macrophage that previously are not known to interact with Salmonella during early stages of infection, such as Cd98, Cd180, Cd147 and Cd11b. Some of these were reported as receptor or ligands for LPS in other bacteria but have not been reported in the Salmonella-macrophage system. For example, the lipid raft-associated protein Cd98 is required for vaccinia virus endocytosis,.sup.[23] while the immunoglobulin superfamily member Cd147 is a critical host receptor for the meningococcal pilus components PilE and PilV..sup.[24] Among them, we chose an interacting protein, Cd11b, to further verify its interaction with Salmonella. Cd11b was previously reported to bind LPS and promote TLR4 signaling and importantly, may participate in LPS uptake into cells..sup.[25] But its role has not been clearly described in the process of Salmonella entry. To verify the interaction between Cd11b and macrophages in vitro, we applied a biotin switch method using a commercially available crosslinking reagent. Salmonella was first labeled by (Sulfosuccinimidyl-2-[6-(biotinamido)-2-(p-azidobenzamido) hexanoamido] ethyl-1,3-dithiopropionate) (Sulfo-SBED) and the whole bacteria extract then was incubated with the lysate of macrophage. The mixture was irradiated by the same UV as described before and the crosslinked proteins were purified by NeutrAvidin beads. The recovered proteins were treated with the gel-loading buffer that contains the reduction reagent dithiothreitol to reduce the disulfide bond on the crosslinking reagent, which resulted in the transfer of biotin group to Salmonella-interacting proteins in host cells to facilitate their pull-down by NeutrAvidin beads. The western blot result confirmed the crosslinked Cd11b after UV crosslinking, while a much weaker signal was observed without UV crosslinking (
[0079] The interaction between host cells and pathogens are highly dynamic and complex with many questions to be answered. It is extremely valuable to provide a dynamic picture of such interactions during the infection process. Towards this goal, we developed a novel time-resolved chemical proteomics strategy. It is conceivable that the general strategy of HAPTIP can be applicable to many bacteria or virus, thus contributing to the discovery and understanding of host-pathogen interactions in multiple infection systems.
[0080] The design and synthesis of the multifunctional probe is shown in Scheme 1 shown below. Moreover, we checked the feasibility of crosslink using two proteins (Concanavalin A and Fetuin) with known interaction (
[0081] The outbreak of Zika in early 2016 created worldwide urgency and demanded rapid development in research pertaining to Zika virus. Till date, this has led to the elucidation of structure of Zika virus, development of neutralizing antibodies, and exploration of the host factors involved in Zika entry into various cell lines. The later, though, is not completely unraveled, primarily due to the lack of a robust and high-throughput method to study the enveloped virus internalization. Here, we present a novel technology to trace the early stage entry of Zika virus into host cells. Zika virus was labeled on its surface with a chemical probe, which carries a UV-photocrosslinker to covalently link any virus-interacting proteins on UV exposure, and a biotin tag for subsequent enrichment and mass spectrometric identification. The surface modified virus was allowed to either attach or enter Vero cells, followed by UV-photocrosslinking at certain time points, to reveal the receptor or other host proteins critical for virus internalization. We identified Neural Cell Adhesion Molecule (NCAM1) as the potential attachment factor/receptor for Zika virus, which we validated using antibody inhibition in Vero cells and overexpression into HEK 293T cells. Furthermore, using the technology we isolated other direct interactors of Zika virus, which might be critical for its pathogenesis. The method could serve as a universal tool to map the entry pathway of other enveloped virus, including Dengue and West Nile from the family Flaviviridae.
[0082] Zika was first discovered in the Zika valley of Uganda in 1947, however, only after the recent outbreak in South Americas it was declared a health emergency. Early cases were observed with skin rash, fever and other mild symptoms, but later a close relation between Zika infection and microcephaly in newborns and Guillain-Barr syndrome (GBS) in adults were reported. The primary mode of transmission to humans is through an infected mosquito, Aedes aegypti.
[0083] Zika belongs to Flaviviridae, the same family as dengue virus (DENV), West Nile virus (WNV), Japanese encephalitis virus (JEV), and yellow fever virus (YFV). It is a positive-strand RNA virus with a genome of about 11,000 nucleotides, which are translated into a single polyprotein, further processed by viral and host proteases to form three structural and seven non-structural proteins. Like other flavivirus, a mature Zika virus is composed of a nucleocapsid enclosed in an icosahedral shell containing 180 copies (90 dimers) each of the envelop E and membrane M proteins. E protein is the key surface glycoprotein involved in receptor-binding and membrane fusion with the host cell.
[0084] Zika virus has been the focus of immense investigation since the recent epidemic. Initial studies on Zika structure revealed its structural similarity with other virus from Flaviviridae, besides the peculiar Asn154 glycosylation site present on each of the E proteins, the thermal stability, and the compact surface of the virus. Progress has also been made towards developing therapeutics, by isolating neutralizing monoclonal antibodies from infected human subjects. However, a much deeper understanding of the immune response elicited and the various virus-host interactions are required for the rapid development of antiviral agents, both of which are limited due to lack of available high-throughput methods. Furthermore, mapping the host factors critical for viral infection will highlight the molecular pathways manipulated by the virus to maneuver to its benefits.
[0085] Here, we present a novel chemical proteomic technology to trace the virus entry and identify virus-interacting proteins. The virus surface proteins were chemically labeled using a probe that bears UV-photocrosslinker and a biotin handle (
[0086] Example of Virus Labeling.
[0087] Our understanding of ZIKV internalization and cellular trafficking would greatly benefit from a systematic, temporal characterization of major proteins involved in the dynamic virus entry. Real-time fluorescence microscopy has been used to study the transport, acidification, and fusion of single virus. The movement of single virus demonstrated an intriguing and dynamic process. The molecular information, in particular protein machinery involved in the process, is typically limited to labeled molecules in the amazing technique. On the other hand, affinity and chemical proteomics studies identified virus-interacting proteins. The molecular mechanisms and dynamic virus-host interactions responsible for the internalization of ZIKV, however, have remained unresolved.
[0088] We think a systematic quantitative measurement of temporal changes in virus-protein interactions is extremely valuable for the identification of host molecules as potential therapeutic targets. We have previously used chemical proteomics strategies and modified a nanoparticle, polyamidoamine generation 3 (PAMAM G3) dendrimer, to understand the endocytic pathways of a nanoparticle. Here, we expand the concept and hypothesize that chemical modification of ZIKV would not significantly affect its infectivity and would allow us to track the virus entry into living cells and identify virus-interacting proteins by mass spectrometry (MS), revealing the spatiotemporal distribution of the key proteins involved in the pathways for ZIKV entry and trafficking.
[0089] We devised and synthesized a multifunctional chemical probe (
[0090] The labeling was first examined with a standard protein and then with intact ZIKV. Bovine serum albumin (BSA) was incubated with 1 mM of reagent in phosphate buffer pH 7 at 4 C. and the labeled protein was enriched on streptavidin beads and analyzed by SDS-PAGE. The labeling efficiency was estimated to be 25-30% (
[0091] We used the labeled ZIKV to infect Vero cells and interacting proteins were crosslinked at fixed time points to identify the virus host factors and elucidate the virus entry mechanism (
[0092] In total, we identified around 300 crosslinked proteins across three time points, out of which more than 70 proteins are previously implicated in virus infection (
[0093] To further investigate whether the strategy was also capable of correlating spatial information with the virus-crosslinked proteins, we performed the ANOVA test and Cytoscape to determine whether there is statistical overrepresentation of specific genes or proteins in the sample at specific time points and identify proteins specific at the attachment or cellular entry stages (
[0094] We further demonstrated that the strategy allowed us to identify clusters of proteins representing a temporal shift of ZIKV subcellular localizations and in many cases, the subcellular localizations and functions of crosslinked proteins highly correlate to the temporal information (
[0095] We also observed certain proteins enriched in all three time points such as STAT1, a key mediator of Type-I Interferon Signaling. It has been reported that ZIKV suppresses the host immune response by inhibiting the type-I interferon signaling pathway. Previous studies also have suggested the mechanism of blocking immune response by ZIKV as either the degradation of STAT2 (Signal Transducer and Activator of Transcription), or antagonism of STAT1 and STAT2 phosphorylation. We identified STAT1 across all the three time points. The receptor-activated C kinase (RACK1), which mediates the interactions between IFN receptor and STAT1, was also identified as a ZIKV-interacting protein. Previously, a different class of virus was shown to interact with RACK1, thus initiating the dissociation of RACK1-STAT1 complex and inhibition of interferon signaling by the virus 4. Our study emphasizes the involvement of both RACK1 and STAT1 in the immune response elicited by the ZIKV infection, suggesting ZIKV might employ a similar approach to suppress the host immune response.
[0096] To identify any parallel mode of virus entry mechanisms, we examined temporally ZIKV-crosslinked proteins against protein components involved in major endocytic mechanisms for ZIKV internalization (
[0097] Finally, considering NCAM1 was exclusively crosslinked at 0 minute and NCAM is abundantly expressed in brain, we further examined whether NCAM1 is a potential receptor for ZIKA infection leading to neurological disorders. In the first validation experiment, we investigated if antibody blocking of NCAM causes reduction in ZIKV infectivity. For this purpose, we employed CD56 antibody which binds to the extracellular immunoglobulin-like domains present in all three isoforms of NCAM. We first tested the ability of the antibody to bind to the Vero cell membrane using immunofluorescence without membrane permeabilization, and observed a strong fluorescence signal (
[0098] In conclusion, we have developed a chemical proteomic approach in which virus were chemically tagged with a biocompatible probe, to reveal the virus-host interactions in real-time. In this study, we applied the technology to ZIKV and identified multiple ZIKA-interacting proteins that indicate ZIKV subcellular localizations and potential entry mechanisms, among which a new ZIKV receptor was discovered and validated through virus attachment and entry assays. Inhibition of NCAM by antibody reduced the ZIKV entry into Vero cells, while its overexpression in HEK 293T cells increased viral binding. The strategy highlighted its unique feature that allowed us to track the virus movement in real-time, which is challenging due to the highly dynamic nature of the process and the transient virus-host protein interactions 9. Moreover, the crosslinking chemistry permits the identification of potential receptors which present analytical challenges to identify the interaction on cell membrane.sup.50, 51. Compared to the previously reported mass spectrometric methods for the identification of receptors specific to glycoproteins.sup.10, 11, our method offers the additional advantage of covalently linking proteins at different time points, thus serving the dual purpose of identification of receptors and other host factors involved at different stages of virus entry. Lastly, this novel technology can be applied to relatively unstable enveloped viruses, owing to the minimal labeling by cysteine-reactive maleimide group.
[0099] Experimental Procedures for Virus Labeling
[0100] Cells and Reagents: Vero (African green monkey kidney) and HEK 293T (human embryonic kidney) cells were maintained in DMEM media supplemented with heat-inactivated 10% FBS, at 37 C. and under 5% CO.sub.2. Low passage cells were used for the virus propagation and all other infection experiments. The anti-NCAM monoclonal antibody for blocking cell surface protein and immunofluorescence assay was purchased from BD Biosciences (Cat. No. 559043), while the antibody for Western blot was obtained from Cell Signaling (Cat. No. 3576). Streptavidin-HRP antibody was bought from R&D Systems (Cat. No. DY998), and 4G2 antibody was generously provided by Richard Kuhn, Purdue University. All reagents for synthesis were obtained from Sigma-Aldrich. ChemPep Inc, Peptides International Inc, Novabiochem (EMD Millipore), and
[0101] Mature Zika Preparation
[0102] Approximately 110{circumflex over ()}9 Vero-Furin cells (15) were infected at a multiplicity of infection (MOI) of 0.1 with Zika virus (strain H/PF/2013) at 37 C. (16). Virus particles were purified from media collected at 60 and 72 hours post infection (hpi) according to the procedure below. Briefly, virus particles were precipitated from the media with 8% polyethylene glycol (PEG) 8000 overnight at 4 C. pelleted at 8891g for 50 minutes at 4 C. Re-suspended particles were pelleted through a 24% sucrose cushion, re-suspended in 0.5 mL NTE buffer (20 mM Tris pH 8.0, 120 mM NaCl, 1 mM EDTA) and purified with a discontinuous gradient in 5% intervals from 35% to 10% K-tartrate, 20 mM Tris pH 8.0, 1 mM EDTA. Mature virus was extracted from the gradient, concentrated and buffer exchanged into NTE buffer.
Plaque Assay
[0103] The plaque assay was performed as described below. Purified Zika virus was diluted serially in the order of ten folds, and incubated with monolayers of Vero cells for 1 hour at room temperature. Cells were layered with agarose, and incubated at 37 C. for 3 days. Plaques were counted following cell staining using Neutral red.
Synthesis and Purification of a Multi-Functional Chemical Probe
[0104] The virus-labeling chemical probe was synthesized on the Rink-Amide-AM-Resin (200-400 mesh) 1% DVB manually, using standard solid phase peptide synthesis approach (Scheme 1). A 20% piperidine solution in DMF (N,N-Dimethylformamide) was used to deprotect the fmoc (9-Fluorenylmethoxycarbonyl) groups, while 95% TFA (Trifluoroacetic acid) was used for boc (tert-Butoxycarbonyl) group deprotection. HCTU (O-(1H-6-Chlorobenzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate) was utilized as an activating agent for the carboxyl group on the incoming reactant, in presence of the base NMM (4-methylmorpholine). The synthesis was performed on the 30 mol scale and using 2.5-fold excess of the reagents compared to the resin. Each step involved the deprotection of amine group, activation of carboxyl group followed by coupling reaction. The excess reagents were removed by thorough washing of beads by DMF. Ninhydrin test was performed after each deprotection and coupling reaction.
##STR00005## ##STR00006## ##STR00007##
[0105] The synthesis was performed using the strategy, as previously described.sup.5. 80 mg (30 mol) of Rink-Amide-AM-Resin was added to the fritted reaction vessel. Beads were conditioned with DMF for 15 minutes. The solution was removed by filtration, and 20% piperidine in DMF was added to the beads for fmoc deprotection. The mixture was end-to-end rotated for 30 minutes, and solution was removed followed by washing of beads with DMF. A reaction mixture of Fmoc-Lys-Biotin-OH (44.60 mg, 75 mol), HCTU (31.03 mg, 75 mol), and NMM (16.49 l, 150 mol) in DMF was added to the resin, and rotated for 4 hours at room temperature. The resin was washed with DMF, and fmoc deprotection steps were repeated. A solution of N-Fmoc-N-succinyl-4,7,10-trioxa-1,13-tridecanediamine (40.70 mg, 75 mol), HCTU (31.03 mg, 75 mol), and NMM (16.49 l, 150 mol) in DMF was rotated with the resin for 4 hours. Excess reagents were removed, and the resin was washed with DMF. Similarly, Fmoc-Lys(Boc)-OH (35.14 mg, 75 mol), N-Fmoc-N-succinyl-4,7,10-trioxa-1,13-tridecanediamine (40.70 mg, 75 mol), and 6-Maleimidohexanoic acid (15.84 mg, 75 mol) were coupled to the resin after fmoc deprotection steps. The resin was washed with DMF and dichloromethane, and the molecule was cleaved from the resin using 95:5 mixture of TFA:TIS (Triisopropylsilane) for 1.5 hours. The cleavage step also deprotects the boc group, making available a free amine in the product. The crude product was concentrated and HPLC (Agilent 1100) purified using a gradient of 5-85% B (A: 0.1% TFA/H.sub.2O, B: 0.1% TFA/CH.sub.3OH) over 30 minutes on Waters XBridge Prep BEH130 C18 column (5 m, 10250 mm) to yield 1 (25.68 mg, 19.8 mol, 66%). MALDI-TOF and NMR were used to characterize the product.
[0106] .sup.1H NMR (500 MHz, DMSO-d.sub.6) 7.91 (d, J=8.1 Hz, 1H), 7.86-7.71 (m, 4H), 7.66 (q, J=5.9 Hz, 2H), 7.54 (bs, 3H), 7.26-7.18 (m, 1H), 6.91 (s, 2H), 6.89-6.83 (m, 1H), 6.42-6.20 (m, 2H), 4.28-4.16 (m, 1H), 4.10-3.94 (m, 3H), 3.49-3.18 (m, 24H), 3.04-2.85 (m, 11H), 2.70 (dd, J=15, 5.6 Hz, 1H), 2.71-2.61 (m, 2H), 2.49 (d, J=12.4 Hz, 1H), 2.33-2.16 (m, 8H), 1.94 (dt, J=13.4, 7.4 Hz, 4H), 1.68-1.47 (m, 11H), 1.46-1.32 (m, 11H), 1.31-0.99 (m, 11H).
[0107] .sup.13C NMR (126 MHz, DMSO) 174.1, 172.0, 171.8, 171.6, 171.6, 171.5, 171.1, 162.8, 158.2, 158.0, 134.5, 117.4, 115.1, 112.7, 69.8, 69.6, 68.1, 68.1, 61.1, 59.3, 55.5, 52.4, 37.0, 36.0, 35.9, 35.8, 35.3, 35.2, 31.4, 31.2, 30.8, 30.7, 30.6, 29.4, 29.4, 29.3, 29.0, 28.3, 28.1, 27.8, 26.7, 25.8, 25.4, 24.9, 23.0, 22.5. A 1297.358 peak in MALDI was observed corresponding to the expected M+H.sup.+.
[0108] The pure maleimide-biotin compound 1 (20 mg, 15.42 mol) was dissolved in DMF and reacted with excess NHS-LC-Diazirine (succinimidyl-6-(4,4-azipentanamido)hexanoate) in phosphate buffer pH 8, for 2 hours at room temperature. The product was purified by directly injecting into the HPLC and using similar conditions as described above. The chemo-proteomic probe 2 for labeling a virus or a bacterium was obtained as a white powder (14.06 mg, 9.25 mol, 60%) and characterized by MALDI-TOF, .sup.1H and .sup.13C NMR.
[0109] .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.00-7.88 (m, 2H), 7.88-7.77 (m, 4H), 7.72 (p, J=5.8 Hz, 3H), 7.28 (p, J=2.7, 2.2 Hz, 1H), 6.99 (s, 2H), 6.94 (s, 1H), 6.45-6.31 (m, 2H), 4.32-4.26 (m, 1H), 4.15-4.03 (m, 3H), 3.54-3.41 (m, 17H), 3.40-3.24 (m, 7H), 3.14-2.92 (m, 16H), 2.81 (dd, J=12.4, 5.1 Hz, 1H), 2.56 (d, J=12.4 Hz, 1H), 2.40-2.23 (m, 8H), 2.06-1.96 (m, 6H), 1.96-1.88 (m, 2H), 1.72-1.52 (m, 13H), 1.52-1.40 (m, 10H), 1.40-1.08 (m, 18H), 0.96 (s, 3H).
[0110] .sup.13C NMR (126 MHz, DMSO) 174.0, 171.8, 171.6, 171.5, 171.5, 171.4, 171.1, 170.5, 162.7, 134.5, 69.8, 69.5, 68.1, 61.1, 59.2, 55.4, 52.6, 52.4, 37.0, 35.8, 35.7, 35.4, 35.2, 35.2, 31.5, 31.4, 30.7, 29.9, 29.8, 29.4, 29.3, 29.2, 28.9, 28.9, 28.2, 28.0, 27.8, 26.1, 25.8, 25.3, 25.1, 24.8, 23.0, 19.3. MALDI showed a peak at 1492.232 m/z, corresponding to the MN.sub.2+H.sup.+. This is due to the loss of N.sub.2 from diazirine under MALDI conditions.
[0111] Virus Labeling/BSA Labeling
[0112] Purified Zika virus or 50 g Bovine Serum Albumin (BSA) was diluted to 500 l with PBS pH 7, and mixed with the labeling chemical probe in the final concentration of 1 mM. The labeling was carried out by gentle end-to-end rotation in 4 C. overnight. For the infection experiment, virus labeling was initiated a day before the cells reached <90% confluency for infection. The reaction was quenched by adding three times excess of cysteine.
[0113] Virus Infection and Crosslinking of Host-Proteins
[0114] Vero cells were first grown in T-150 flasks in DMEM supplemented with 10% FBS, then passaged to the 15 cm plates and grown to <90% confluence. Cells were washed with cold PBS twice, and cooled down to 4 C. The labeled virus was diluted in DMEM and added to the cells at an MOI of 5. Cells were gently rocked for 1 hour in 4 C., to allow for virus attachment. For the receptor crosslinking, the unbound virus was removed, cells were washed once with cold PBS, and directly exposed to the UV light for 15 minutes on ice. All the above operations were performed on ice and using cold PBS to minimize any virus entry. To understand the virus internalization mechanism, additionally virus was allowed to enter cells by incubation in 37 C. for 4 or 8 minutes, following pre-attachment for an hour at 4 C. Subsequent to UV photocrosslinking, cells were collected by scraping in PBS, and stored in 80 C. until further processing. As a control, cells treated with the labeling chemical probe and exposed to UV were included to account for random crosslinking.
[0115] Sample Preparation for LC-MS Analysis
[0116] Frozen cells were lysed in 1% SDS, 50 mM Tris HCl pH 7.5 supplemented with protease inhibitor on ice, using sonication (10 cycles for 10 seconds each, with an interval of 10 seconds). Cell lysates were cleared by centrifugation at 14000 rpm to pellet down cell debris, and supernatant were used for the biotin-Neutravidin affinity purification. Bicinchoninic acid (BCA) assay (Thermo Fisher Scientific) was performed for protein quantitation, and the lysates equivalent to 1 mg protein for each sample were reduced and alkylated by boiling at 95 C., in 10 mM TCEP (Tris(2-carboxyethyl)phosphine) and 40 mM CAA (chloroacetamide) respectively. The lysates were then diluted to 0.1% SDS and rotated with 50 l preconditioned Neutravidin beads slurry in 4 C. overnight. The beads were washed three times with 0.1% SDS in Tris-HCl pH 8, and then transferred to the low protein binding eppendorf tubes, where they were further washed three times with 25 mM ammonium bicarbonate (ABC) buffer pH 8. 200 l ABC buffer was added to the beads, and proteins were digested on-bead at 37 C. using 2 g Lys-C for 3 hours and 200 ng trypsin for 12 hours. The supernatant containing peptides was collected and beads were washed twice with 50 l ABC buffer, further pooled with the supernatant. Peptides were acidified and desalted using in-house StageTips with SDB-XC (3M). The peptides were dried in SpeedVac before subjecting to LC-MS/MS analysis.
[0117] LC-MS/MS Analysis
[0118] The peptides were dissolved in 0.1% formic acid and injected into Easy-nLC 1000 (Thermo Fisher Scientific). The peptides were separated on a 45 cm in-house column (360 m OD75 m ID), packed with C18 resin (2.2 m, 100 , Bischoff Chromatography, Leonberg, Germany) and heated to 60 C. with a column heater (Analytical Sales and Services, Flanders, N.J.). The mobile phase was comprised of 0.1% formic acid in ultra-pure water (solvent A) and 0.1% formic acid in 80% Acetonitrile (solvent B), and the gradient used for separation was 10-30% B over a linear 60 minutes at a flow rate of 250 nl/min. The EASY-nLC 1000 was connected online to the LTQ-Orbitrap Velos Pro mass spectrometer (Thermo Fisher Scientific) by a nanospray source. Data acquisition was performed in the data-dependent mode, in which a full scan (range from m/z 350-1800 with a resolution of 30,000 at m/z 400) was followed by MS/MS scans of top 10 intense ions (normalized collision energy 30%, automatic gain control 3e4, maximum injection time 100 ms) with a dynamic exclusion for 60 s and dynamic list of 500.
[0119] LC-MS Data Processing
[0120] Raw files were processed with MaxQuant v1.5.5.1.sup.6, and the Label-free Quantitation (LFQ).sup.7 was performed. The raw data was searched against UniProtKB green monkey (Chlorocebus sabaeus) FASTA database with Andromeda search engine.sup.8, using standard parameters. The first peptide precursor mass tolerance was set at 20 ppm, and MS/MS tolerance at 0.6 Da. Carbamidomethylation was set as a fixed modification for cysteines, while oxidation of methionine and acetylation at N-terminus were selected as variable modifications. Enzyme specificity was set to trypsin with maximum two missed cleavages. The search was performed with 1% false discovery rate (FDR) at both peptide and protein levels. The identifications were transferred from the sequenced peaks to the unidentified peaks of the same m/z within a time window of 0.7 minutes (match between runs) across samples.
[0121] Statistical Analysis
[0122] Data was analyzed by Perseus 1.6.1.1.sup.9. Initially, the LFQ intensities were extracted from the MaxQuant output file. All potential contaminants were removed, along with proteins only identified by site. Proteins with valid values in minimum two out of three replicates in at least one group were only considered, and values were imputed for all missing values based on normal distribution. The t-test was performed to identify significant outliers (permutation-based FDR 5%). Proteins in the significant region with at least 2.5-fold change for UV at different time points vs control were considered as crosslinked proteins, which were further analyzed by Ingenuity Pathway Analysis, DAVID (Database for Annotation, Visualization, and Integrated Discovery).sup.10, 11, and STRING.sup.12, 13. Proteins were matched to their homologs from UniProt human database for the analysis. Principal Component Analysis (PCA) was performed with a Benjamin-Hochberg FDR cut-off of 0.05.
[0123] Antibody Inhibition of Virus Infection
[0124] Antibody inhibition assay was performed according to the protocol described before.sup.14. Vero cells in six-well plate were preincubated with 30 g/ml of anti-NCAM or control IgG in DMEM for 45 min at room temperature. Cells were then infected with purified Zika at an MOI of 0.1 in the presence of antibody. Cellular RNA was purified after 24 h, and RT-qPCR was performed to measure viral RNA.
[0125] RNA Extraction and RT-qPCR
[0126] RNA was extracted using RNeasy mini kit (Qiagen, Valencia, Calif.) as per manufacturer's protocol, and RT-qPCR was performed using SuperScript III Platinum SYBR Green One-Step qRT-PCR kit (Invitrogen, Grand Island, N.Y.). The purified total RNA in water, were normalized and used to generate cDNA. Gene expression was measured using Applied Biosystems 7300 real-time PCR system. The conditions used were 4 minutes at 50 C., 5 minutes at 95 C., and 40 cycles of 15 seconds at 95 C. and 1 minute at 60 C. The number of viral RNA copies was determined using a standard curve.
[0127] Overexpression of NCAM in HEK293T Cells
[0128] HEK293T cells at the confluency of 60% were transfected with an expression plasmid with NCAM1 (GenScript, OHu00262D), using lipofectamine 2000 reagent. 48 hours post transfection, cells were challenged with Zika virus at MOI of 0.1. The virus was incubated with the cells at 4 C. for 1 hour, and increase in viral attachment was measured using RT-qPCR.sup.15.
[0129] Immunofluorescence
[0130] Vero cells or HEK293T cells (for transfection with NCAM1) were seeded on cover slips in 24-well plate. Cells were washed with PBS and fixed with 3.7% paraformaldehyde for 10 minutes at room temperature. Cells were again washed with PBS three times and blocked with 2% BSA in PBS for 1 hour. Anti-NCAM antibody in blocking solution was incubated with the cells for 1 hour at room temperature. Cells were washed three times and incubated with anti-mouse FITC or anti-mouse Alexa Fluor 488 for 1 hour at room temperature. DAPI staining was performed for 10 minutes, followed by final three PBS washes. Cover slips were mounted on glass slide and images were captured using Olympus IX81 fluorescence microscope with a 60 oil immersion objective.
[0131] Western Blot
[0132] Following overexpression of NCAM1 in HEK293T, cells were lysed at 48 hours post transfection. The samples were boiled at 95 C. in gel loading buffer and 1,4-Dithiothreitol (DTT) for 5 minutes. The cell lysates were separated on the precast NuPAGE 4-12% Bis-Tris polyacrylamide gels (Invitrogen) for 90 minutes at constant voltage of 150V. A MOPS solution (50 mM MOPS, 50 mM Tris-base, 1 mM EDTA, 0.1% SDS) was used as a running buffer. The proteins were transferred onto polyvinylidene fluoride membranes in Bicine-Bis-Tris transfer buffer containing 12% methanol, for 75 minutes at a constant current of 275 mA. The membrane was blocked with 2% BSA in TBST, and probed with anti-human NCAM (Cell Signaling) for 1 hour at room temperature. Following washings, anti-mouse IgG HRP-conjugated secondary antibody (Cell Signaling) was utilized for visualization.
Example Bacterium Salmonella Labeling
[0133] As illustrated in
[0134] Except for extensive washing with different buffers to remove non-specific adsorptions, another important consideration in pathogen-host interaction studies is that protein abundances within a cell would change significantly as trigger significant changes, and the background could be quite different than the one observed in an uninfected cell. Therefore, control isolation is also performed in the same biological context tested. The proteins enriched by NeutrAvidin beads either from samples and controls are digested on-beads sequentially with Lys C and trypsin, and the obtained peptides were characterized and quantified by label-free LC-MS/MS. To increase the confidence level of the cross-linked proteins being true pathogen-interacting proteins, proteins only identified in UV-treated samples were considered as proteins cross-linked with the pathogen.
[0135] After subtracting the control hits (infected cells using labeled salmonella but without UV irradiation), in total, we identified 442 cross-linked proteins in two biological replicates over the three time points during salmonella internalization into macrophage cells. Proteins identified from samples and controls in each time point is shown in
[0136] We then analyzed the proteomics data to see whether this approach was capable of correlating spatial information with the captured cross-linked proteins, and whether these cross-linked proteins can fall into distinct biological processes or pathways. Gene ontology cellular component (GOCC) analysis shows the proteins with the highest levels of enrichment originated from extracellular regions (including vesicles, organelles, and exosomes) or from membrane-bound vesicles or organelles, especially at 0.5 and 1 h (
[0137] The GOCC results agree with the infection process, as adhesion to the host cell surface is important for many bacteria to initiate infection, and during the entry the salmonella may further fuse with the cellular membrane to form SCV. We identified more nucleus proteins in 6 hour samples than the other two time points. We assumed that the reason is the SCV membrane may damage in the late endocytosis process and the pathogen may escape into the host cell cytosol and become associated with nucleus proteins. The function analysis indicates many of proteins identified in these three time points are related to biological processes implicated in endocytosis, salmonella infection, regulation of actin cytoskeleton as well as focal adhesion (
[0138] As this approach provides a temporal profile of the interaction between salmonella and macrophages, which is a particular advantage of this approach, we then further looked into proteins identified in each time point (
[0139] GO Analysis
[0140] Functional annotation of gene ontology and KEGG pathway for each protein were retrieved from UNIPROT database (http://www.uniprot.org). KEGG pathway and GO enrichment analysis of the differentially expressed proteins were conducted according to the information from the KEGG Pathway and GO databases, respectively, using the following formula:
[0145] The ratio value was defined as the protein number of identified for each functional category normalized by protein number of genome background. The GO term or pathway is considered as a significant enrichment of differential proteins when p value is blow 0.05. Among them, several important biological process and pathway were particularly highlighted with red.
[0146] Those skilled in the art will recognize that numerous modifications can be made to the specific implementations described above. The implementations should not be limited to the particular limitations described. Other implementations may be possible.
[0147] While the inventions have been illustrated and described in detail in the drawings and foregoing description, the same is to be considered as illustrative and not restrictive in character, it being understood that only certain embodiments have been shown and described and that all changes and modifications that come within the spirit of the invention are desired to be protected.
[0148] It is intended that that the scope of the present methods and compositions be defined by the following claims. However, it must be understood that this disclosure may be practiced otherwise than is specifically explained and illustrated without departing from its spirit or scope. It should be understood by those skilled in the art that various alternatives to the embodiments described herein may be employed in practicing the claims without departing from the spirit and scope as defined in the following claims.
REFERENCES CITED
[0149] [1] W. S. Garrett, Science 2015, 348, 80-86. [0150] [2] P. M. J. Beltran, J. D. Federspiel, X. Sheng, I. M. Cristea, Mol. Syst. Biol. 2017, 13, 922. [0151] [3] M. P. Weekes, P. Tomasec, E. L. Huttlin, C. A. Fielding, D. Nusinow, R. J. Stanton, E. C. Wang, R. Aicheler, I. Murrell, G. W. Wilkinson, P. J. Lehner, S. P. Gygi, Cell 2014, 157, 1460-1472. [0152] [4] P. Scaturro, A. Stukalov, D. A. Haas, M. Cortese, K. Draganova, A. Plaszczyca, R. Bartenschlager, M. Gtz, A. Pichlmair, Nature 2018, 561, 253-257. [0153] [5] Y. F. Yang, M. Hu, K. W. Yu, X. M. Zeng, X. Y. Liu Mass spectrometry-based proteomic approaches to study pathogenic bacteria-host interactions. Protein Cell, 2015 6, 265-274. [0154] [6] A. P. Frei, O. Y. Jeon, S. Kilcher, H. Moest, L. M. Henning, C. Jost, A. Plckthun, J. Mercer, R. Aebersold, E. M. Carreira, B. Wollscheid, Nat. Biotech. 2012, 30, 997-1001. [0155] [7] N. Sobotzki, M. A. Schafroth, A. Rudnicka, A. Koetemann, F. Marty, S. Goetze, Y. Yamauchi, E. M. Carreira, B. Wollscheid, Nat. Commun. 2018, 9, 1519. [0156] [8] L. Bar-Peled, E. K. Kemper, R. M. Suciu, E. V. Vinogradova, K. M. Backus, B. D. Horning, T. A. Paul, T. A. Ichu, R. U. Svensson, J. Olucha, M. W. Chang, B. P. Kok, Z. Zhu, N. T. Ihle, M. M. Dix, P. Jiang, M. M. Hayward, E. Saez, R. J. Shaw, B. F. Cravatt, Cell 2017, 171, 696-709. [0157] [9] D. He, X. Xie, F. Yang, H. Zhang, H. M. Su, Y. Ge, H. P. Song, P. R. Chen, Angew. Chem. Int. Ed., 2017, 56, 14521-14525; Angew. Chem. 2017, 129, 14713-14717. [0158] [10] M. Broncel, R. A. Serwa, P. Ciepla, E. Krause, M. J. Dallman, A. I. Magee, E. W. Tate, Angew. Chem. Int. Ed 2015, 54, 5948-5951; Angew. Chem. 2015, 127, 6046-6049. [0159] [11] L. N. Wang, L. Yang, L. Pan, N. R. Kadasala, L. Xue, R. J. Schuster, L. L. Parker, A. Wei, W. A. Tao, J. Am. Chem. Soc. 2015, 137, 12772-12775. [0160] [12] A. Haraga, M. B. Ohlson, S. I. Miller, Nat. Rev. Micro., 2008, 6, 53-66. [0161] [13] O. Steele-Mortimer, Curr. Opin. Microbiol. 2008, 11, 38-45. [0162] [14] T. H. Greg Bioconjugate Techniques, 2.sup.nd Edition, Academic Press, New York, 2008, pp. 171 and 183. [0163] [15] Y. Zeng, T. N. C Ramya, A. Dirksen, P. E. Dawson, J. C. Paulson, Nat. Meth., 2009, 6, 207-209. [0164] [16] H. P. Xiao, S. Suttapitugsakul, F. X. Sun, R. H. Wu, Acc. Chem. Res., 2018, 51, 1796-1806. [0165] [17] Z. Q. Li, P. L. Hao, L. Li, C. Y. J. Tan, X. M. Cheng, G. Y. J. Chen, S. K. Sze, H. M. Shen, S. Q. Yao, Angew. Chem. Int. Ed., 2013, 52, 8551-8556; Angew. Chem. 2013, 125, 8713-8718. [0166] [18] S. Schleker, J. C. Sun, B. Raghavan, M. Srnec, N. Muller, M. Koepfinger, L. Murthy, Z. M. Zhao, J. Klein-Seetharaman, Proteomics Clin. Appl. 2012, 6, 117-133. [0167] [19] L. D. Rogers, A. R. Kristensen, E. C. Boyle, D. P. Robinson, R. T. Ly, B. B. Finlay, L. J. Foster, J. Proteomics 2008, 71, 97-108. [0168] [20] G. J. Rapsinski, T. N. Newman, G. O. Oppong, J. P. van Putten, . Tkel, J. Biol. Chem. 2013, 288, 14178-14188. [0169] [21] L. A. Knodler, O. Steele-Mortimer, Traffic 2003, 4, 587-599. [0170] [22] I. Zanoni, R. Ostuni, L. R. Marek, S. Barresi, R. Barbalat, G. M. Barton, F. Granucci, J. C. Kagan, Cell 2011, 147, 868-880. [0171] [23] N. Schroeder, C. S. Chung, C. H. Chen, Liao, C L, W. Chang, J. Virol. 2012, 86, 4868-4882. [0172] [24] S. C. Bernard, N. Simpson, O. Join-Lambert, C. Federici, M. P. Laran-Chich, N. Maissa, H. Bouzinba-Segard, P. C. Morand, F. Chretien, S. Taouji, E. Chevet, S. Janel, F. Lafont, M. Coureuil, A. Segura, F. Niedergang, S. Marullo, P. O. Couraud, X. Nassif, S. Bourdoulous, Nat. Med. 2014, 20, 725-731. [0173] [25] J. C. Kagan, Trends Immunol. 2017, 38, 696-704.