Translation Control Tool for Plants
20200332304 ยท 2020-10-22
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/8213
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
Abstract
The present invention provides for a system comprising (a) first polynucleotide encoding a first promoter operatively linked to an open reading frame (ORF) encoding an endoribonuclease, or an enzymatic active fragment thereof, which cleaves a cognition sequence (cog), and (b) a second polynucleotide encoding a second promoter operatively linked to a nucleotide sequence encoding (i) a cog linked to a coding sequence of interest (COI), (ii) a cog linked to the 3 end of a first COI and the 5 end of a second COI, or (iii) a cog locating within a LS (or targeting sequence) linked to a COI.
Claims
1. A system comprising (a) first polynucleotide encoding a first promoter operatively linked to an open reading frame (ORF) encoding (i) optionally a localization signal (LS) and (ii) an endoribonuclease, or an enzymatic active fragment thereof, which cleaves a cognition sequence (cog), wherein the LS is linked to the 5 end of the endoribonuclease; (b) a second polynucleotide encoding a second promoter operatively linked to a nucleotide sequence encoding (i) a cog linked to a coding sequence of interest (COI), (ii) a cog linked to the 3 end of a first COI and the 5 end of a second COI, or (iii) a cog locating within a LS (or targeting sequence) linked to a COI; and optionally one or more (c) third polynucleotide encoding a third promoter operatively linked to a nucleotide sequence encoding (i) a cog linked to a coding sequence of interest (COI), (ii) a cog linked to the 3 end of a COI and the 5 end of a second COI, or (iii) a cog locating within a LS (or targeting sequence) linked to a COI.
2. The system of claim 1, wherein the endoribonuclase is an endoribonuclase encoded by one of the genes listed in
3. The system of claim 2, wherein the endoribonuclase is an endoribonuclase encoded by one of the genes listed in
4. The system of claim 3, wherein the endoribonuclase is one selected from the group consisting of Pseudomonas aeruginosa Csy4, Moraxella catarrhalis Csy4, Escherichia coli CasE, Verrucosispora maris CasE, Lactobacillus delbrueckii CasE, and Thauera aminoaromatica CasE.
5. The system of claim 3, wherein the endoribonuclase is one selected from the group consisting of Shewanella piezotolerans Csy4, Pseudomonas aeruginosa Csy4, Selenomonas ruminantium Csy4, Psychrobacter sp. Csy4, and Acinetobacter baumannii Csy4.
6. The system of claim 1, wherein the second polynucleotide encodes a second promoter operatively linked to a nucleotide sequence encoding a cog linked to a coding sequence of interest (COI); wherein when the nucleotide sequence is transcribed into a transcript, the transcript comprises from 5 to 3: a 5 Cap, a 5 UTR (untranslated region), the cog, the COI, a 3 UTR, and a poly-A tail.
7. The system of claim 1, wherein the second polynucleotide encodes a second promoter operatively linked to a nucleotide sequence encoding (ii) a cog linked to the 3 end of a first COI and the 5 end of a second COI; wherein when the nucleotide sequence is transcribed into a transcript, the transcript comprises from 5 to 3: a 5 Cap, a first 5 UTR (untranslated region), the first COI, a first 3 UTR, the cog, a second 5 UTR, the second COI, a second 3 UTR, and a poly-A tail.
8. The system of claim 1, wherein the second polynucleotide encodes a second promoter operatively linked to a nucleotide sequence encoding (iii) a cog locating within a LS (or targeting sequence) linked to a COI; wherein when the nucleotide sequence is transcribed into a transcript, the transcript comprises from 5 to 3: a 5 Cap, a 5 UTR (untranslated region), a targeting sequence with the cog located within the targeting sequence, the COI, a 3 UTR, and a poly-A tail.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
DETAILED DESCRIPTION OF THE INVENTION
[0045] Before the invention is described in detail, it is to be understood that, unless otherwise indicated, this invention is not limited to particular sequences, expression vectors, synthetic TF, host microorganisms, or processes, as such may vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting.
[0046] As used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to an expression vector includes a single expression vector as well as a plurality of expression vectors, either the same (e.g., the same operon) or different; reference to cell includes a single cell as well as a plurality of cells; and the like.
[0047] In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings:
[0048] The terms optional or optionally as used herein mean that the subsequently described feature or structure may or may not be present, or that the subsequently described event or circumstance may or may not occur, and that the description includes instances where a particular feature or structure is present and instances where the feature or structure is absent, or instances where the event or circumstance occurs and instances where it does not.
[0049] The terms host cell and host microorganism are used interchangeably herein to refer to a living biological cell that can be transformed via insertion of an expression vector.
[0050] The term heterologous as used herein refers to a material, or nucleotide or amino acid sequence, that is found in or is linked to another material, or nucleotide or amino acid sequence, wherein the materials, or nucleotide or amino acid sequences, are foreign to each other (i.e., not found or linked together in nature).
[0051] The terms expression vector or vector refer to a compound and/or composition that transduces, transforms, or infects a host microorganism, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell, or in a manner not native to the cell. An expression vector contains a sequence of nucleic acids (ordinarily RNA or DNA) to be expressed by the host microorganism. Optionally, the expression vector also comprises materials to aid in achieving entry of the nucleic acid into the host microorganism, such as a virus, liposome, protein coating, or the like. The expression vectors contemplated for use in the present invention include those into which a nucleic acid sequence can be inserted, along with any preferred or required operational elements. Further, the expression vector must be one that can be transferred into a host microorganism and replicated therein. Particular expression vectors are plasmids, particularly those with restriction sites that have been well documented and that contain the operational elements preferred or required for transcription of the nucleic acid sequence. Such plasmids, as well as other expression vectors, are well known to those of ordinary skill in the art.
[0052] As used herein, the terms nucleic acid sequence, sequence of nucleic acids, and variations thereof shall be generic to polydeoxyribonucleotides (containing 2-deoxy-D-ribose), to polyribonucleotides (containing D-ribose), to any other type of polynucleotide that is an N-glycoside of a purine or pyrimidine base, and to other polymers containing nonnucleotidic backbones, provided that the polymers contain nucleobases in a configuration that allows for base pairing and base stacking, as found in DNA and RNA. Thus, these terms include known types of nucleic acid sequence modifications, for example, substitution of one or more of the naturally occurring nucleotides with an analog; internucleotide modifications, such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), with negatively charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), and with positively charged linkages (e.g., arninoalklyphosphoramidates, aminoalkylphosphotriesters); those containing pendant moieties, such as, for example, proteins (including nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.); those with intercalators (e.g., acridine, psoralen, etc.); and those containing chelators (e.g., metals, radioactive metals, boron, oxidative metals, etc.). As used herein, the symbols for nucleotides and polynucleotides are those recommended by the IUPAC-IUB Commission of Biochemical Nomenclature (Biochem. 9:4022, 1970).
[0053] The term operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
[0054] The amino acid sequence of Pseudomonas aeruginosa Csy4 is:
TABLE-US-00002 (SEQIDNO:1) 10203040 MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRI 50607080 GVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLR 90100110120 DHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRH 130140150160 DLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIR 170180 HGPLQVTAEEGGFTCYGLSKGGFVPWF
[0055] An enzymatic active fragment of an endoribonuclase comprises an amino acid sequence having a sequence identity equal to or more than 70%, 80%, 90%, 95%, or 99% to SEQ ID NO:1. In some embodiments, the enzymatic active fragment comprises one or more of the following: H at position 29, E at position 49, R at position 102, Q at position 104, S at position 148, S at position 150, T at position 151, F at position 155, and Y at position 176. In some embodiments, the enzymatic active fragment comprises: H at position 29 and S at position.
[0056] The host cell can be an animal or plant cell. The host cell can be a mammalian, insect, or yeast cell. n some embodiments, the vector comprises nucleotide sequences which enable its stable maintenance in the host cell or integration into the genome of the host cell. One skilled in the art is able to determine what sequences to use in a particular host cell. In some embodiments, the host cell is a plant cell, or a plant cell in a plant.
[0057] Suitable plant promoters include, but are not limited to, the 35S promoter. The promoter can be heterologous to the gene encoding the endoribonuclase and/or COI.
[0058] In some embodiments, the plant is selected from the group consisting of Arabidopsis, poplar, eucalyptus, rice, corn, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, and Brachypodium.
[0059] In some embodiments, the present invention provides plants, plant cells, seeds, flowers, leave, fruit, or biomass.
[0060] Suitable host cells, promoters, nucleotide control sequences, and the like, and techniques thereof, are taught in PCT International Patent Application No. PCT/US2012/023182, which is hereby incorporated by reference.
[0061] The invention is useful to engineer plants for biofuel purposes and other uses of biomass as feedstocks for chemical industry. The invention is also useful for engineering of plants, such as crop plants to yield more of one or more certain byproducts. The invention could also be used to increase pathogen resistance or tolerance.
REFERENCES CITED
[0062] 1. Gonzalez, T. L., Liang, Y., Nguyen, B. N., Staskawicz, B. J., Loqu, D. and Hammond, M. C. (2015) Tight regulation of plant immune responses by combining promoter and suicide exon elements. Nucleic Acids Res. [0063] 2. Brckner, K., Schafer, P., Weber, E., Grtzner, R., Marillonnet, S. and Tissier, A. (2015) A library of synthetic transcription activator-like effector-activated promoters for coordinated orthogonal gene expression in plants. The Plant Journal, n/a-n/a. [0064] 3. Chern, M., Fitzgerald, H., Canlas, P., Navarre, D. and Ronald, P. (2005) Overexpression of a rice NPR1 homolog leads to constitutive activation of defense response and hypersensitivity to light. Mol Plant Microbe Interact, 18, 511-520. [0065] 4. Voelker, S. L., Lachenbruch, B., Meinzer, F. C., Jourdes, M., Ki, C., Patten, A. M., Davin, L. B., Lewis, N. G., Tuskan, G. A., Gunter, L. et al. (2010) Antisense down-regulation of 4CL expression alters lignification, tree growth, and saccharification potential of field-grown poplar. Plant Physiol, 154, 874-886. [0066] 5. Kasuga, M., Liu, Q., Miura, S., Yamaguchi-Shinozaki, K. and Shinozaki, K. (1999) Improving plant drought, salt, and freezing tolerance by gene transfer of a single stress-inducible transcription factor. Nat Biotech, 17, 287-291. [0067] 6. Hieno, A., Naznin, H. A., Hyakumachi, M., Sakurai, T., Tokizawa, M., Koyama, H., Sato, N., Nishiyama, T., Hasebe, M., Zimmer, A. D. et al. (2014) ppdb: plant promoter database version 3.0. Nucleic Acids Res, 42, D1188-1192. [0068] 7. Lescot, M., Dehais, P., Thijs, G., Marchal, K., Moreau, Y., Van de Peer, Y., Rouze, P. and Rombauts, S. (2002) PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res, 30, 325-327. [0069] 8. Liu, W., Mazarei, M., Peng, Y., Fethe, M. H., Rudis, M. R., Lin, J., Millwood, R. J., Arelli, P. R. and Stewart, C. N., Jr. (2014) Computational discovery of soybean promoter cis-regulatory elements for the construction of soybean cyst nematode-inducible synthetic promoters. Plant Biotechnol J, 12, 1015-1026. [0070] 9. Bocobza, S. E. and Aharoni, A. (2014) Small molecules that interact with RNA: riboswitch-based gene control and its involvement in metabolic regulation in plants and algae. Plant J, 79, 693-703. [0071] 10. Moore, I., Samalova, M. and Kurup, S. (2006) Transactivated and chemically inducible gene expression in plants. The Plant Journal, 45, 651-683. [0072] 11. Coego, A., Brizuela, E., Castillejo, P., Ruiz, S., Koncz, C., del Pozo, J. C., Pineiro, M., Jarillo, J. A., Paz-Ares, J. and Leon, J. (2014) The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J, 77, 944-953. [0073] 12. Wilde, R. J., Shufflebottom, D., Cooke, S., Jasinska, I., Merryweather, A., Beri, R., Brammar, W. J., Bevan, M. and Schuch, W. (1992) Control of gene expression in tobacco cells using a bacterial operator-repressor system. The EMBO journal, 11, 1251-1259. [0074] 13. Gatz, C., Frohberg, C. and Wendenburg, R. (1992) Stringent repression and homogeneous de-repression by tetracycline of a modified CaMV 35S promoter in intact transgenic tobacco plants. Plant J, 2, 397-404. [0075] 14. Barkley, M. D. and Bourgeois, S. (1980) In Miller, J. H. and Reznikoff, W. S. (eds.). Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., pp. 177-220. [0076] 15. Bertrand, K. P., Postle, K., Wray Jr, L. V. and Reznikoff, W. S. (1983) Overlapping divergent promoters control expression of Tn10 tetracycline resistance. Gene, 23, 149-156. [0077] 16. Mahfouz, M. M., Li, L., Piatek, M., Fang, X., Mansour, H., Bangarusamy, D. K. and Zhu, J. K. (2012) Targeted transcriptional repression using a chimeric TALE-SRDX repressor protein. Plant Mol Biol, 78, 311-321. [0078] 17. Guan, X., Stege, J., Kim, M., Dahmani, Z., Fan, N., Heifetz, P., Barbas, C. F., 3rd and Briggs, S. P. (2002) Heritable endogenous gene regulation in plants with designed polydactyl zinc finger transcription factors. Proc Natl Acad Sci USA, 99, 13296-13301. [0079] 18. Lowder, L. G., Zhang, D., Baltes, N. J., Paul, J. W., 3rd, Tang, X., Zheng, X., Voytas, D. F., Hsieh, T. F., Zhang, Y. and Qi, Y. (2015) A CRISPR/Cas9 Toolbox for Multiplexed Plant Genome Editing and Transcriptional Regulation. Plant Physiol, 169, 971-985. [0080] 19. Zhang, B., Pan, X., Cobb, G. P. and Anderson, T. A. (2006) Plant microRNA: A small regulatory molecule with big impact. Dev. Biol., 289, 3-16. [0081] 20. Ossowski, S., Schwab, R. and Weigel, D. (2008) Gene silencing in plants using artificial microRNAs and other small RNAs. Plant J, 53, 674-690. [0082] 21. Zhou, M. and Luo, H. (2013) MicroRNA-mediated gene regulation: potential applications for plant genetic engineering. Plant Mol Biol, 83, 59-75. [0083] 22. Brown, B. D., Gentner, B., Cantore, A., Colleoni, S., Amendola, M., Zingale, A., Baccarini, A., Lazzari, G., Galli, C. and Naldini, L. (2007) Endogenous microRNA can be broadly exploited to regulate transgene expression according to tissue, lineage and differentiation state. Nat Biotech, 25, 1457-1467. [0084] 23. Seyhan, A. A. (2016) A multiplexed miRNA and transgene expression platform for simultaneous repression and expression of protein coding sequences. Molecular bioSystems, 12, 295-312. [0085] 24. Brosnan, C. A. and Voinnet, O. (2011) Cell-to-cell and long-distance siRNA movement in plants: mechanisms and biological implications. Curr. Opin. Plant Biol., 14, 580-587. [0086] 25. van Dongen, S., Abreu-Goodger, C. and Enright, A. J. (2008) Detecting microRNA binding and siRNA off-target effects from expression data. Nat. Methods, 5, 1023-1025. [0087] 26. Cerny, R. E., Qi, Y., Aydt, C. M., Huang, S., Listello, J. J., Fabbri, B. J., Conner, T. W., Crossland, L. and Huang, J. (2003) RNA-binding protein-mediated translational repression of transgene expression in plants. Plant Mol Biol, 52, 357-369. [0088] 27. Haurwitz, R. E., Jinek, M., Wiedenheft, B., Zhou, K. and Doudna, J. A. (2010) Sequence- and Structure-Specific RNA Processing by a CRISPR Endonuclease. Science, 329, 1355-1358. [0089] 28. Haurwitz, R. E., Sternberg, S. H. and Doudna, J. A. (2012) Csy4 relies on an unusual catalytic dyad to position and cleave CRISPR RNA. [0090] 29. Sternberg, S. H., Haurwitz, R. E. and Doudna, J. A. (2012) Mechanism of substrate selection by a highly specific CRISPR endoribonuclease. RNA, 18, 661-672. [0091] 30. Qi, L., Haurwitz, R. E., Shao, W., Doudna, J. A. and Arkin, A. P. (2012) RNA processing enables predictable programming of gene expression. Nat Biotech, 30, 1002-1006. [0092] 31. Du, P., Miao, C., Lou, Q., Wang, Z. and Lou, C. (2015) Engineering Translational Activators with CRISPR-Cas System. ACS Synth Biol. [0093] 32. Borchardt, E. K., Vandoros, L. A., Huang, M., Lackey, P. E., Marzluff, W. F. and Asokan, A. (2015) Controlling mRNA stability and translation with the CRISPR endoribonuclease Csy4. RNA, 21, 1921-1930. [0094] 33. Eudes, A., Sathitsuksanoh, N., Baidoo, E. E., George, A., Liang, Y., Yang, F., Singh, S., Keasling, J. D., Simmons, B. A. and Logue, D. (2015) Expression of a bacterial 3-dehydroshikimate dehydratase reduces lignin content and improves biomass saccharification efficiency. Plant Biotechnol J, 13, 1241-1250. [0095] 34. Ham, T. S., Dmytriv, Z., Plahar, H., Chen, J., Hillson, N. J. and Keasling, J. D. (2012) Design, implementation and practice of JBEI-ICE: an open source biological part registry platform and tools. Nucleic Acids Res, 40, e141. [0096] 35. Sparkes, I. A., Runions, J., Kearns, A. and Hawes, C. (2006) Rapid, transient expression of fluorescent fusion proteins in tobacco plants and generation of stably transformed plants. Nat Protoc., 1, 2019-2025. [0097] 36. Voinnet, O., Rivas, S., Mestre, P. and Baulcombe, D. (2003) An enhanced transient expression system in plants based on suppression of gene silencing by the p19 protein of tomato bushy stunt virus. Plant J, 33, 949-956. [0098] 37. Clough, S. J. and Bent, A. F. (1998) Floral dip: a simplified method for Agrobacterium-mediated transformation of Arabidopsis thaliana. Plant J, 16, 735-743. [0099] 38. Kanehisa, M., Sato, Y., Kawashima, M., Furumichi, M. and Tanabe, M. (2016) KEGG as a reference resource for gene and protein annotation. Nucleic Acids Res, 44, D457-462. [0100] 39. Grissa, I., Vergnaud, G. and Pourcel, C. (2007) The CRISPRdb database and tools to display CRISPRs and to generate dictionaries of spacers and repeats. BMC Bioinformatics, 8, 172. [0101] 40. Chen, S., Tao, L., Zeng, L., Vega-Sanchez, M. E., Umemura, K. and Wang, G.-L. (2006) A highly efficient transient protoplast system for analyzing defence gene expression and protein-protein interactions in rice. Mol. Plant Pathol., 7, 417-427. [0102] 41. Visa, N., Izaurralde, E., Ferreira, J., Daneholt, B. and Mattaj, I. W. (1996) A nuclear cap-binding complex binds Balbiani ring pre-mRNA cotranscriptionally and accompanies the ribonucleoprotein particle during nuclear export. The Journal of Cell Biology, 133, 5-14. [0103] 42. Fuke, H. and Ohno, M. (2008) Role of poly (A) tail as an identity element for mRNA nuclear export. Nucleic Acids Res., 36, 1037-1049. [0104] 43. Bell-Lelong, D. A., Cusumano, J. C., Meyer, K. and Chapple, C. (1997) Cinnamate-4-Hydroxylase Expression in Arabidopsis (Regulation in Response to Development and the Environment). Plant Physiol., 113, 729-738. [0105] 44. Ebert, P. R., Ha, S. B. and An, G. (1987) Identification of an essential upstream element in the nopaline synthase promoter by stable and transient assays. Proc Natl Acad Sci USA, 84, 5745-5749. [0106] 45. Aoyama, T. and Chua, N. H. (1997) A glucocorticoid-mediated transcriptional induction system in transgenic plants. Plant J, 11, 605-612. [0107] 46. Padidam, M. (2003) Chemically regulated gene expression in plants. Curr Opin Plant Biol, 6, 169-177. [0108] 47. Cazzonelli, C. I. and Velten, J. (2006) An in vivo, luciferase-based, Agrobacterium-infiltration assay system: implications for post-transcriptional gene silencing. Planta, 224, 582-597. [0109] 48. Yang, Y., Costa, A., Leonhardt, N., Siegel, R. and Schroeder, J. (2008) Isolation of a strong Arabidopsis guard cell promoter and its potential as a research tool. Plant methods, 4, 6. [0110] 49. Dong, Q., Schlueter, S. D. and Brendel, V. (2004) PlantGDB, plant genome database and analysis tools. Nucleic Acids Res, 32, D354-359. [0111] 50. Duvick, J., Fu, A., Muppirala, U., Sabharwal, M., Wilkerson, M. D., Lawrence, C. J., Lushbough, C. and Brendel, V. (2008) PlantGDB: a resource for comparative plant genomics. Nucleic Acids Res., 36, D959-D965. [0112] 51. Smanski, M. J., Zhou, H., Claesen, J., Shen, B., Fischbach, M. A. and Voigt, C. A. (2016) Synthetic biology to access and expand nature's chemical diversity. Nat Rev Micro, 14, 135-149. [0113] 52. Liu, W. and Stewart, C. N., Jr. (2015) Plant synthetic biology. Trends Plant Sci, 20, 309-317. [0114] 53. Jansen, R. P. (2001) mRNA localization: message on the move. Nat Rev Mol Cell Biol, 2, 247-256. [0115] 54. Murthy, K. G., Park, P. and Manley, J. L. (1991) A nuclear micrococcal-sensitive, ATP-dependent exoribonuclease degrades uncapped but not capped RNA substrates. Nucleic Acids Res, 19, 2685-2692. [0116] 55. Hugouvieux, V., Murata, Y., Young, J., Kwak, M., Mackesy, D. and Schroeder, J. (2002) Localization, ion channel regulation and genetic interactions during abscisic acid signaling of the nuclear mRNA cap-binding protein, ABH1. Plant Physiol, 130, 1276-1287. [0117] 56. Hugouvieux, V., Kwak, J. M. and Schroeder, J. I. (2001) An mRNA cap binding protein, ABH1, modulates early abscisic acid signal transduction in Arabidopsis. Cell, 106, 477-487. [0118] 57. Gallie, D. R. (1991) The cap and poly(A) tail function synergistically to regulate mRNA translational efficiency. Genes Dev, 5, 2108-2116. [0119] 58. Abramson, R. D., Browning, K. S., Dever, T. E., Lawson, T. G., Thach, R. E., Ravel, J. M. and Merrick, W. C. (1988) Initiation factors that bind mRNA. A comparison of mammalian factors with wheat germ factors. J Biol Chem, 263, 5462-5467. [0120] 59. Frohberg, C., Heins, L. and Gatz, C. (1991) Characterization of the interaction of plant transcription factors using a bacterial repressor protein. Proceedings of the National Academy of Sciences of the United States of America, 88, 10470-10474. [0121] 60. Weinmann, P., Gossen, M., Hillen, W., Bujard, H. and Gatz, C. (1994) A chimeric transactivator allows tetracycline-responsive gene expression in whole plants. Plant J, 5, 559-569. [0122] 61. Love, J., Scott, A. C. and Thompson, W. F. (2000) Technical advance: stringent control of transgene expression in Arabidopsis thaliana using the Top10 promoter system. Plant J, 21, 579-588. [0123] 62. Moore, I., Galweiler, L., Grosskopf, D., Schell, J. and Palme, K. (1998) A transcription activation system for regulated gene expression in transgenic plants. Proc Natl Acad Sci USA, 95, 376-381. [0124] 63. Hickey, S. F., Sridhar, M., Westermann, A. J., Qin, Q., Vijayendra, P., Liou, G. and Hammond, M. C. (2012) Transgene regulation in plants by alternative splicing of a suicide exon. Nucleic Acids Res., 40, 4701-4710. [0125] 64. Rose, A. B. (2004) The effect of intron location on intron-mediated enhancement of gene expression in Arabidopsis. Plant J, 40, 744-751. [0126] 65. Meshcheriakova, Y. A., Saxena, P. and Lomonossoff, G. P. (2014) Fine-tuning levels of heterologous gene expression in plants by orthogonal variation of the untranslated regions of a nonreplicating transient expression system. Plant Biotechnol J, 12, 718-727. [0127] 66. Kanoria, S. and Burma, P. K. (2012) A 28 nt long synthetic 5UTR (synJ) as an enhancer of transgene expression in dicotyledonous plants. BMC Biotechnol, 12, 85. [0128] 67. Dugdale, B., Mortimer, C. L., Kato, M., James, T. A., Harding, R. M. and Dale, J. L. (2014) Design and construction of an in-plant activation cassette for transgene expression and recombinant protein production in plants. Nat. Protocols, 9, 1010-1027. [0129] 68. Mariani, C., De Beuckeleer, M., Truettner, J., Leemans, J., and Goldberg, R. B. (1990). Induction of male sterility in plants by a chimeric ribonuclease gene. Nature, 347, 737-741. [0130] 69. Singh, S. P., Singh, S. P., Pandey, T., Singh, R. R., and Sawant, S. V. (2015). A novel male sterility-fertility restoration system in plants for hybrid seed production. Scientific Reports, 5, 1274. [0131] 70. Laubinger, S., Sachsenberg, T., Zeller, G., Busch, W., Lohmann, J. U., Ratsch, G. and Weigel, D. (2008) Dual roles of the nuclear cap-binding complex and SERRATE in pre-mRNA splicing and microRNA processing in Arabidopsis thaliana. Proc Natl Acad Sci USA, 105, 8795-8800. [0132] 71. Nissim, L., Perli, Samuel D., Fridkin, A., Perez-Pinera, P. and Lu, Timothy K. (2014) Multiplexed and Programmable Regulation of Gene Networks with an Integrated RNA and CRISPR/Cas Toolkit in Human Cells. Mol. Cell, 54, 698-710. [0133] 72. Patron, N. J., Orzaez, D., Marillonnet, S., Warzecha, H., Matthewman, C., Youles, M., Raitskin, O., Leveau, A., Farre, G., Rogers, C. et al. (2015) Standards for plant synthetic biology: a common syntax for exchange of DNA parts. The New phytol. 208, 13-19.
[0134] It is to be understood that, while the invention has been described in conjunction with the preferred specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.
[0135] All patents, patent applications, and publications mentioned herein are hereby incorporated by reference in their entireties.
[0136] The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.
Example 1
Endoribonuclease-Based Two-Component Repressor Systems for Tight Expression Control in Plants
[0137] Tight control and multifactorial regulation of gene expression are important challenges in genetic engineering and are critical for the development of regulatory circuits. In synthetic biology, meeting these challenges will facilitate targeted gene expression and the fine-tuning of metabolic pathways to avoid the accumulation of undesired intermediates that would be toxic in some cells. By employing the endoribonuclease Csy4 and its recognition sequence from the CRISPR/Cas system in Pseudomonas aeruginosa and manipulating 5UTR of mRNA, we developed a two-component expression-repression system to tightly control synthesis of transgene products. We demonstrated this regulatory device was functional in monocotyledonous and dicotyledonous species, and showed that it can be used to repress transgene expression by >400-fold and to synchronize repression of multiple transgenes. Moreover, we validated this system's capacity to offer not only tissue-specific transgene repression, but also stimuli-dependent expression control. Finally, using a bioinformatics approach, we identified 54 orthologous systems from various bacteria, and then validated in planta the activity for three out of six of those systems, demonstrating the potential diversity of such two-component repressor system.
[0138] Here we present the design of a two-component expression-repressor system to support tight control of transgene expression in plants. We use the site-specific endoribonuclease (endoRNase) Csy4the CRISPR/Cas Subtype Ypest protein 4 from CRISPR/Cas system in Pseudomonas aeruginosa (27). Csy4 is a small protein of 187-amino-acids with a molecular weight of 21 kD that cleaves a 28-nucleotide sequence originally found within the repetitive units of the precursor CRISPR RNA (27). Csy4's small size, high fidelity, and known recognition sequence have attracted interest for its use as a major component in several synthetic devices (27-29). In E. coli, Csy4 and its recognition sequence were used to control the integrity of mRNA regulatory elements and enabled predictable regulation of multi-gene operons (30). Qi et al. also showed that Csy4 could be used to repress expression of chimeric GFP in Saccharomyces cerevisiae when the coding sequence was truncated after the cleavage of Csy4's recognition sequence (30). Most recently in E. coli, Csy4's recognition sequence was used to control the removal of a cis-repressive RNA module that acts as translational repressor. The elimination of the repressor element upon Csy4 expression was used to relieve translation inhibition (31). Activity and kinetics of Csy4 for transgene mRNA cleavage have also been studied in mammalian cells (32).
[0139] In this study, we showed that Csy4 can be used to repress transgene expression by >400-fold and to synchronize repression of multiple transgenes. It is also a versatile tool for depleting transgene products in a cell-type-specific manner and after the perception of an external stimulus. We demonstrated for three reporter proteins that their expression is effectively repressed by Csy4 activity on their respective mRNA, without modifying their original encoding sequences. Moreover, we isolated several Csy4 orthologous systems and validated the activity for three of them. Finally we showed that Csy4 was effective in repressing transgene expression in at least three plant speciesincluding dicotyledonous and monocotyledonous plants suggesting that this approach could be deployed to control a large diversity of transgenes in various host plants.
Materials and Methods
Construction of Multi-Gene Plasmids
[0140] Construction of multi-gene plasmids was carried out using the MultiSite Gateway 3-fragment reaction (MultiSite Gateway Pro, Invitrogen). Briefly, the Gateway reaction allows building a transgene cluster of Promoter1::Gene1::Terminator1-Promoter2::Gene2::Terminator2 in a binary vector. The destination vector for the Gateway reaction is a binary vector with plant Promoter1 located upstream of the attR1 recombination site and Terminator2 located downstream of attR2 recombination site. The three types of entry clones used correspond to attL1-Gene1-attL4, attR4-Terminator1-Promoter2-attR3, attL3-Gene2-attL2, respectively. Each MultiSite Gateway reaction was performed with the LR Clonase II Plus enzyme mix and equal molar of each component construct according to the manufacturer's manual. More details about the destination vector and the entry clones are described below. A list of expression clones, the destination vectors and entry clones is presented in Table 1. Cloning primers are listed in Table 2.
[0141] Most of the destination vectors are a series of vectors developed based on pTKan-p35S::attR1-GW-attR2::tRBCS (1). pTKan-pAct2::cogRFP::tNOS-p35S::attR1-GW-attR2::tRBCS was assembled using an in-fusion cloning kit (In-Fusion HD, Clontech) by incorporation of PCR fragments of pAct2 and cogRFP-tNOS at the ApaI site located between the T-DNA Right Border and p35S promoter of the pTKan-p35S::attR1-GW-attR2::tRBCS vector. The pTKan-p35S::RFP::tNOS-p35S::attR1-GW-attR2::tRBCS and the pTKan-pNOS::RFP::tNOS-p35S::GVG::tE9-pUAS::attR1-GW-attR2::tRBCS vectors were constructed as described in Gonzalez, Liang et al. 2015. The pTKan-p35S::attR1-GW-attR2::YFP::tRBCS vector was provided by Eudes et al. (33).
[0142] Genes of interest were synthesized (GenScript, Piscataway, N.J., USA) or PCR amplified with attB sites incorporated. BP recombination reactions (MultiSite Gateway Pro, Invitrogen) were performed with each gene of interest and pDONR221 P1-P4 or pDONR221 P3-P2 vectors to generate entry clones corresponding to attL1-Gene1-attL4 or attL3-Gene2-attL2, respectively. Entry clones encoding attR4-Terminator1-Promoter2-attR3 were developed based on pDONR221-attR4-tG7-pC4H-attR3, in which the pC4H fragment was removed using both AvrII and HindIII restriction enzymes and replaced by PCR products corresponding to pNOS, pGCI or pZmUbi inserted by in-fusion cloning (In-Fusion HD, Clontech). All sequences and plasmids developed under this project will be made publicly available through the ICE repository (34)
Agrobacterium-Mediated Transient Leaf Transformations
[0143] Binary vectors based on the pTKan plasmid were transformed into Agrobacterium tumefaciens strain GV3101 and selected on LB plates containing 100 g/mL rifampicin, 30 g/mL gentamicin and 50 g/mL spectinomycin. Agrobacterium-mediated transient leaf transformation was performed as described previously (35) with small modifications. Briefly, 5 mL agrobacterium liquid culture was grown for 20 to 24 h at 30 C. Agrobacterium cells were pelleted by centrifugation at 5,000 g for 5 min and resuspended in infiltration medium, containing 50 mM MES-KOH, pH 5.6, 2 mM Na.sub.3PO.sub.4, 0.5% (w/v) dextrose and 200 M acetosyringone. A. tumefaciens strain C58C1 containing p19 plasmid (36) was selected on LB plates containing 100 g/mL rifampicin, 5 g/mL tetracycline and 50 g/mL kanamycin and cultured under the same condition as strain GV3101. Both Agrobacterium strains were adjusted to a final OD.sub.600 nm 0.3 before co-infiltration to Nicotiana benthamiana leaves with a needleless syringe. N. benthamiana plants were grown in a growth chamber under 16/8 h and 26/24 C. day/night cycles. Three-to-four week old plants were used for leaf infiltration.
Whole Leaf Imaging for Fluorescent Signals
[0144] Three days after infiltration, tobacco leaves were detached from the plants and imaged for fluorescence signals with an Amersham Imager 600 (GE Healthcare Life Sciences). GFP and RFP epi-fluorescence signals were detected and imaged with the preset blue light settings (excitation 460 nm, Cy2:525BP20 filter) and green light settings (excitation 520 nm, Cy3:605BP40 filter), respectively. Time needed for signal saturation for the strongest signal intensity in the image was set as the exposure time for imaging.
RT-PCR and Real-Time qPCR Analysis
[0145] For RNA extraction, 50 to 100 mg leaf samples were snap frozen in liquid nitrogen after fluorescence analysis until further analysis. RNA isolation and purification was performed using the RNeasy Plant Mini Kit (Qiagen) and the RNase-Free DNase Set (Qiagen). 400 to 1000 ng of total RNA was used for cDNA synthesis using the Transcriptor High Fidelity cDNA Synthesis Kit (Roche). Absence of DNA contamination in the RNA samples was confirmed each time by the absence of amplification of ELONGATION FACTOR 1 in the negative control samples that were generated for each RNA sample by excluding reverse-transcriptase in the cDNA synthesis reaction. RT-PCR was performed using OneTaq DNA polymerase (New England Biolabs, Ipswich, Mass., USA) and gene-specific primers (Table 2). The number of amplification cycles was adjusted for each gene to avoid reaching reaction saturation. For real-time qPCR analysis, cDNAs were amplified using the QuantiFast SYBR Green PCR kit (Qiagen) in the CFX96 Real-Time System (BIO-RAD). The multi-gene expression binary vectors harbor a kanamycin-resistant marker (Kan) under the control of the manopine synthase promoter (pMAS) for plant selection. The expression of the Kan gene was used as the reference gene for normalization for qPCR analysis. Primer sequences for RT-PCR and real-time qPCR analysis are listed in Table 2.
Activity Detection of Firefly Luciferase
[0146] For activity detection of firefly luciferase in tobacco leaves, leaf discs were made using a cork borer (Cole-Parmer) from tobacco leaves two days after infiltration. Leaf discs from similar locations on each side of a leaf were used for comparison between treatments with or without DEX induction. Incubation media were composed of tobacco Infiltration Media supplemented with 1 mM D-Luciferin (Thermo Fisher Scientific Inc.), 0.5% (v/v) DMSO and 15 M DEX. DEX was omitted for non-DEX treatments. Chemiluminescent images were taken in manual mode for 5 min with an Amersham Imager 600 (GE Healthcare Life Sciences).
Arabidopsis Plant Growth and Transformation
[0147] Wild type and transgenic A. thaliana plants in the study were of Col-0 ecotype. Plant growth conditions were 16/8 h day/night cycles, 23 C. and 60% humidity. Agrobacterium strain GV3101 harboring the desired binary vectors was used to transform Arabidopsis plants with the floral dip method (37). T1 and T2 transgenic plants were selected on Murashige and Skoog medium (PhytoTechnology Laboratories, Shawnee Mission, Kans.) supplemented with 1% sucrose, 0.8% (w/v) agar and 50 g/mL kanamycin.
Identification of CSY4 Orthologs
[0148] Three KEGG (38) orthologous groups were identified as CRISPR-associated endoribonucleases: K19091, K19126, and K19130 (http://www.genome.jp/kegg/ko.html). Each enzyme in these three groups was compared to each other for unique protein sequence so that no duplicates would be screened. The genome containing each unique Cas enzyme was then scanned with CRISPRdb (39) for the associated CRISPR repeat sequence (http://crispr.u-psud.fr/crispr/). Any enzyme that existed in a genome with more than one CRISPR repeat sequence was discarded. Enzymes with the same recognition sequence as other enzymes were discarded so that no duplicates would be screened. The growth requirements of the hosting organisms were then examined; we discarded all enzymes whose native host preferred growth below 10 C. or above 37 C. to better match the mesophilic environment the enzymes would encounter in plant cells. The filtered orthologs were clustered by a multiple sequence alignment of their recognition repeats and a single representative of each clade was nominated for BLASTing and synthesis.
Transcript BLAST in Plant GDB
[0149] BLAST searches for recognition sequences of Csy4 and its orthologs were performed at the PlantGDB BLAST website (http://www.plantgdb.org/cgi-bin/blast/PlantGDBblast). The BLAST was performed against sequences in mRNA databases (EST, cDNA, HTC, TSA, EST) for all plant species present in Plant GDB. Default searching parameters were applied.
Rice Protoplast Isolation and Transformation
[0150] Seeds of Japonica rice Cv. Kitaake were surface sterilized with 95% ethanol for 1 min, 50% bleach for 20 min and washed extensively before growth on solid medium containing half Murashige and Skoog medium (PhytoTechnology Laboratories, Shawnee Mission, Kans.), 3% sucrose, and 0.15% (w/v) phytagel. Rice seedlings were grown in dark conditions for 10 to 15 days. Shoot parts were then harvested for protoplast isolation and transformation as described by Chen et al. (40)
Microscopy
[0151] An LSM 710 confocal Microscope (Carl Zeiss) was used for confocal laser-scanning microscopy of tobacco and Arabidopsis leaf epidermal cells. The excitation and detection wavelengths were as follows: excitation 488 nm, emission 500-540 nm for GFP; excitation 553 nm, emission 580-650 nm for RFP; and excitation 514 nm, emission 520-620 nm for YFP. Images were processed using the Zeiss LSM Image Browser and Adobe Photoshop CS6.
[0152] Fluorescence of rice protoplast cells was visualized using an epifluorescence microscope (Leica DM4000B). GFP fluorescence detection was performed with a 350-680 nm LED light source (SOLA SM II 365, Lumencor), and a GFP filter cube (excitation filter 470BP40 nm; dichromatic mirror 500 nm; suppression filter 525BP50 nm). Images were captured using MetaMorph software and processed with Adobe Photoshop CS6.
Results
[0153] Csy4 Represses cogGFP and cogRFP Expression in Tobacco Leaves
[0154] A plant codon optimized DNA sequence encoding a fusion protein corresponding to a nuclear localization signal (NLS) linked to Csy4 from P. aeruginosa was generated to test the endoRNase activity of Csy4 in plants. The used of the NLS allows targeting Csy4 protein to nucleus in order to minimize the export of Csy4-cleaved mRNA since untranslated regions (UTRs) are important elements contributing to nuclear mRNA export (41,42). Nuclear localization of the synthetic Csy4 was confirmed when YFP was fused to its C-terminus (
[0155] We first tested and confirmed that the insertion of the recognition sequence of Csy4 per se does not affect transgene expression, and did so by comparing fluorescent signals in pC4H::GFP versus pC4H::cogGFP, and pC4H::RFP versus pC4H::cogRFP via transient expression assays in tobacco leaves (data not shown). Then, constructs p35S::Csy4+pC4H::cogGFP and p35S::HPTII+pC4H::cogGFP were agro-infiltrated into each half of the same tobacco leaf for expression assays. GFP fluorescence was detected in the absence of Csy4 but lost in its presence (
Csy4 Represses cogGFP and cogRFP Expression Through Transcript Cleavage
[0156] To confirm that the elimination of fluorescence from the reporter genes is due to mRNA cleavage mediated by Csy4, primers located either spanning or distal to the downstream side of the Csy4 recognition site were utilized for RT-PCR to analyze the levels and integrity of reporter gene transcripts (
[0157] Real-time qPCR was performed to quantify the cleavage efficiency of Csy4 via magnitude of the transcript reduction of the reporter genes in the presence or absence of Csy4 (
Csy4 Allows Synchronized Repression of cogGFP and cogRFP
[0158] After demonstrating that Csy4 can effectively repress protein accumulation from one transgene, we further investigated the capacity of Csy4 to simultaneously control the expression of multiple genes and generated a multi-gene expression cassette containing the following genes: pAct2::cogRFP, p35S::cogGFP, and pNOS::Csy4. We also generated an expression control cassette in which the encoding sequence of HPTII was used to replace that of Csy4. Fluorescence analysis of GFP and RFP showed that both were deeply reduced in tissues transformed with the gene cassette harboring the Csy4 gene, indicating that Csy4 was capable of synchronizing expression repression of both transgenes (
Csy4 Allows Conditional Repression of cogFLUC
[0159] The use of conditionally active promoters to drive the expression of Csy4 would permit the repression of transgene expression under specific stimuli. Therefore we picked the widely used dexamethasone (DEX) induction system (45,46) to control the expression of Csy4 and test whether we could conditionally repress transgene expression after a stimulus (supply of DEX for this promoter). A multi-gene expression cassette was built containing p35S::GVG synthetic transcription factor, pUASx6::Csy4 and pC4H::cogFireflyLuciferase (cogFLUC); and a control cassette was generated by replacing Csy4 encoding sequence by that of HPTII. Leaf discs were cut from the same agro-infiltrated leaves and split into two sample sets for treatments with or without the DEX inducer. Regardless of DEX content, the reaction media contained D-luciferin, the substrate for FLUC, and DMSO, to increase the accessibility of D-luciferin to cells (47). Chemiluminescence imaging of leaf discs were taken 10 min, 30 min, 1 h, 3 h, and 5 h after transfer of the samples in the reaction media. When leaf discs were immersed in the luciferin solution containing DEX, luminescent signal from leaves agro-infiltrated with the construct harboring pUASx6::Csy4 peaked at 0.5 h and started to decay around 1 h after the beginning of the treatment. After 5 h, the luminescent signal almost completely disappeared, showing that there was no new FLUC protein synthesized (
Csy4 can be Used for Cell-Type-Specific Repression of cogGFP
[0160] The use of developmentally regulated or tissue-specific promoters to drive the expression of Csy4 would permit the repression of transgene expression or eliminate transgene product(s) in a spatiotemporal manner. Thus we selected a guard-cell-specific promoter pGC1 (48) to control the expression of Csy4 and test whether we could repress transgene expression only in guard cells. Stably transformed Arabidopsis plants harboring a gene cassette consisting of p35S::cogGFP, pNOS::cogRFP, and Csy4 driven by pGC1 were generated, as were control Arabidopsis lines harboring the same gene cassette except that the encoding sequence of Csy4 was replaced by that of HPTII. Fluorescence analysis of the control lines shows that GFP expression was seen in all epidermal cells, including guard cells (
Csy4 Expression does not Affect Plant Growth
[0161] The application of a heterologous or synthetic regulatory system in plants has a prerequisite that the expression of the regulator should not interrupt normal plant growth and development. When Csy4 was driven by a cell-type-specific promoter, pGC1::Csy4, transgenic Arabidopsis lines did not show abnormal phenotypes (data not shown). We further generated Arabidopsis transgenic lines carrying the p35S::Csy4 gene, which constitutively expresses Csy4. Expression of Csy4 in leaves of T2 transgenic lines were confirmed by RT-PCR (
[0162] Specificity of Csy4 cutting activity to its recognition sequence has been tested and proven in bacteria (27). The recognition sequence of Csy4 was BLASTed against the Plant Genome Database (Plant GDB) (http://www.plantgdb.org/cgi-bin/blast/PlantGDBblast), which uploads sequence data from GenBank and UniProt and stores data after reorganization, curation, and processing (49). A non-redundant set of PlantGDB-assembled Unique Transcripts (PUTs) is assembled by Plant GDB for all species with >10,000 published transcripts (50). Transcript BLAST in Plant GDB searches for homologous sequences from transcript-related databases of GenBank as well as from PUTs. Four entries containing the Csy4 recognition sequence were identified but correspond to a single cDNA sequence (gi 189453176) from Papaver somniferum. None was found in the other plant species.
Csy4 Represses cogGFP Expression in Rice Protoplast
[0163] Because of the agronomical and economical importance of grasses, we used the same gene cassettes (p35S::Csy4+pC4H::cogGFP and p35S::HPTII+pC4H::cogGFP) that were used for the tobacco leaf transient expression system and tested Csy4 activity in a rice protoplast expression system. Fluorescence analysis of transformed protoplasts showed that GFP fluorescence was significantly reduced in cells transformed with the gene cassette containing the Csy4 gene, demonstrating that Csy4 was expressed and active to cleave cogGFP mRNA (
Csy4 Orthologs Showed Transgene Repression Activity in Tobacco Leaves
[0164] To find other candidate endoRNase enzymes to build additional and independent two-component repressor systems for plants, we performed a bioinformatics analysis of sequenced CRISPR/Cas systems known to use endoRNases to process CRISPR transcripts. The enzymes themselves are annotated by different names and may or may not align well to each other; orthologs have historically been identified more by position in the Cas cassette than by amino acid sequence and are thus called Csy4, Cas6f, CasE, or Cse3, even when they have identical protein sequences (27, 43). We cross-referenced unique protein sequences from relevant KEGG orthology groups (38) with unique CRISPR repeats from CRISPRdb (39) and kept only those that came from mesophilic hosts. We identified and clustered the 54 enzymes that survived screening by recognition sequence alignment (
DISCUSSION
[0165] One of the aims of plant synthetic biology is to provide genetic devices that allow precise gene expression regulation to support plant metabolic engineering, agronomical trait improvement, and development of novel traits in crops (51). In contrast to the microbial field, the application of synthetic biology on plants is rather limited, mainly due to the poor availability of tools (52). Here we present new genetic devices based on a two-component system that uses an endoRNase and its specific recognition site. We built one of these devices using Csy4, the Cas6 endoribonuclease from P. aeruginosa, which has an ability to recognize and cleave with precision a 28-nucleotide RNA sequence, and we showed that it could be used to repress expression of transgenes with high efficiency in plants. Very high performance of transcript cleavage by Csy4 was confirmed by RT-PCR, since either no amplification or negligible amplification at the recognition site was observed when Csy4 is expressed. The insertion of endoRNase recognition site at the end of the 5UTR of the mRNA allows not only the deletion of the 5 UTR but also the de-capping of the transgene transcript. Consequently, the design limits nucleus-cytosol translocation (53), reduces transcript stability (54), and prevents the formation of both the cap-binding complex (55,56) and the translation initiation complex (57,58), thereby eliminating the transgene product. Moreover, the insertion of the recognition sequence in the 5UTR also avoids the modification of the protein sequence of the target gene, thus preventing protein inactivation, mistargeting and/or destabilization. For all three reporter-genes tested (cogGFP, cogRFP, and cogFLUC), we consistently observed the nearly complete if not total elimination of transgene products when Csy4 was co-expressed in the same cells. Meanwhile, the accumulation of transgene products, as measured by fluorescence or luminescence, was not affected by the insertion of the recognition sequence in the 5UTR in the absence of the specific endoRNase.
[0166] Csy4 represses transgene expression by specific 5UTR removal, thus the repression efficiency was analyzed by quantification of transgene products (fluorescence and luminescence) and 5UTR integrity of transgene mRNAs with or without Csy4 co-expression. Real-time qPCR analysis showed that for cogGFP and cogRFP genes, each individually expressed under the control of the strong pNOS promoter, constitutive expression of Csy4 leads up to 400-fold reductions of full-length transcript accumulations. Quantification of transgene products measured by fluorescence shows a deep reduction, if not complete elimination, of reporter proteins when Csy4 is co-expressed, which is consistent with the qPCR analysis. The co-expression of Csy4 led to a greater full-length transcript reduction of transgenes when the transgenes were driven by a very strong promoter, pNOS, in comparison to when the same transgene was driven by a weaker promoter, pC4H. This suggests that the amount of Csy4 protein was not limiting, and that the repression magnitude will be determined by the amount of mRNA and saturation of Csy4 catalytic activity.
[0167] Similar to Lad and TetR repressor systems (12,13), Csy4-dependent repression is designed as a two-component system, composed of a regulatory sequence and an effector protein. We have shown that the Csy4 recognition sequence can be conveniently inserted upstream of the start codon in the 5UTR without affecting the expression of the target gene, while exerting efficient repression in the presence of the Csy4 protein. Moreover, we demonstrated the universality of our two-component repression system based on Csy4, as we showed that it could be used to control multiple transgenes simultaneously that were under the control of different promoters. In contrast, LacO and TetO sequencesthe DNA motifs recognized by Lad and TetR, respectivelyneed to be inserted into regulatory regions of the promoters driving the transgene to be regulated by those Lad and TetR repressors. Incorporation of LacO and TetO DNA domains into promoters is context-dependent and requires optimization for each synthetic promoter to be efficiently repressed by the Lad and TetR repressor proteins (12,59). To date, the use of LacO/Lacl and TetO/TetR two-component systems is typically coupled with a small number of well-characterized minimal-promoters (12,13,60-62), but their application for other promoters is rather limited. In addition, unlike promoter-based repression systems such as the LacO/Lacl and TetO/TetR systems, Csy4 repression works at a post-transcriptional level, offering additional regulatory options. Layered regulation enhances precise expression of transgenes and metabolic pathways by facilitating accurate spatial, temporal, or conditional control of transgene expression. Recently, a non-leaky, inducible transgene expression system was developed based on the combination of chemical induction and alternative splicing machinery (1,63). Layered expression regulation also increases engineering flexibility. For example, if multiple transgenes in a synthetic circuit are co-regulated at the transcriptional level, one or more of these transgenes can be independently repressed by the insertion of the Csy4 recognition sequence and a conditionally expressed Csy4 protein, or by the use of other Csy4 orthologous two-component repressor systems.
[0168] The successful application in transiently and stably transformed plant-cell hosts composed of monocot and dicot plant species further support the robustness and efficiency of this two-component repressor device. We have shown that very strong and specific repression can be achieved when two transgenes of interest and Csy4 were driven by constitutive promoters as well as when Csy4 was under the control of a cell-specific promoter. It has not been tested and it is unknown how many mRNAs a single Csy4 protein can cleave. Thus it is plausible that, under specific conditions, transgene repression would not be complete if the Csy4 were poorly expressed, and the amount of Csy4 protein was limited relative to the abundance transgene transcript containing the recognition site. In the case of limiting Csy4 protein amount and a full repression need, the Csy4 protein level could be enhanced without the need for the identification of a new promoter. Increased Csy4 expression could be achieved by the insertion of an exon in the encoding sequence (64) or the use of viral 5UTR and 3UTR that would boost mRNA stability and translation efficiency (65,66). Alternatively, for an extremely weak promoter driving the expression of Csy4, a virus-vector assisted activation technology (67) could be applied to boost the accumulation of Csy4 protein and reach the required protein amount for complete transgene transcript elimination. It should be noted that even partial repression could be beneficial for situations when the product of the transgene regulated by Csy4 activity is essential.
[0169] The identification of 54 independent two-component expression-repressor systems, and the validation of three of them (out of six tested), exhibit the great potential for plant metabolic engineering and the development of layer expression regulation. It will allow the construction of several independent two-component expression-repressor systems for independent regulation of various transgenes, but also the design of single or multiple transgenes that can be regulated by multiple factors. For example, different recognition sequences could be inserted in the 5UTR and 3UTR of the transgene, and each recognition sequence would be cleaved by its specific endoRNase, under the control of specific promoters. In addition, they could be used to create degrees of conditional repression of transgenes to fine-tune engineered metabolic pathways. This would be achieved with the use of different promoters to control the expression of endoRNases, each exhibiting the different cleavage efficiency of their respective recognition sequences; or by a strategy of independent repression (e.g., the use of two endoRNases, each controlling the deletion of 5UTR or 3UTR).
[0170] The use of such two-component expression-repressor systems is not limited to the regulation of metabolic pathways. It could be deployed to control the expression of toxic proteins. For example, it could be used to control the expression of a toxic protein used to generate male sterility in crops, such as the bacterial cytotoxic ribonuclease (Barnase) or the Arabidopsis autophagy-related gene BECLIN1 (68, 69). This could be achieved by the insertion of the endoRNase recognition sequences in the 5UTR of the mRNA encoding the toxic protein, and the generation of two independent crop lines. One (female line) would harbor the toxin gene expressed in the anther tapetum tissue, causing male sterility due to tapetum degeneration. The second line (male line) would express the specific endoRNase in the same tissue. The F1 population resulting from the crossing of both engineered parents would be fertile, because the endoRNase would block the production of the toxic protein and allow normal tapetal development. Such a system would support general breeding programs and the development of hybrid crops exhibiting so-called hybrid vigor. While keeping the breeding option, this controlled fertility presents an opportunity to develop sterile energy crops used for cellulosic biofuels and avoid gene flow from crops to wild relatives, which is a major limitation in the attempts to engineer energy crops such as sorghum.
[0171] Besides regulating protein-encoding RNAs, Csy4-mediated transcript cleavage may be applied for the regulation of other functional RNAs. For instance, the precursor of microRNAs, pre-miRNAs, share the common 5-capping feature as pre-mRNAs (70) and are likely to be subjected to Csy4 repression with the recognition sequence inserted in the 5 UTR. Cleavage activity of Csy4 has been deployed in human cells for the production of multiple guide RNAs from a single transcript in CRISPR/CAS targeting (71), and it may function as well in plants.
[0172] The rational design and engineering of biological devices requires well-characterized and robust regulatory parts (72). Our study in plants, when coupled with previous work in bacteria (30,31), yeast (30), and mammalian cells (32, 71), suggests that the Csy4 protein and its recognition sequence are a universal two-component repressor device for the efficient genetic engineering of diverse organisms. We also identified several new two-component repressor systems, orthologous to Csy4, and already validated the functionality of some them in planta. We believe that several of them will be as universal as the Csy4 system. The availability of multiple two-component repressor systems could be used in a single organism to create complex and universal regulatory circuits to control diverse metabolic pathways.
TABLE-US-00003 TABLE 1 Expression clones and the construction clones. For simplicity, terminators are not indicated. (i) Expression clones by regular Gateway recombination reaction. # Expression Clone Expression Vector Entry Clone C68 pTKan-p355::Csy4 pTKan-p355::attR1-GW-attR2 pDONR221-att1-Csy4-att2 C97 pTKan-p355::Csy4::YFP pTKan-p355::attR1-GW- pDONR221-att1-Csy4-att2 attR2::YFP (ii) Expression clones by multi-site Gateway recombination reaction. # Expression Clone Expression Vector Entry Clone 1 Entry Clone 2 Entry Clone 3 C44 pTKan-p35S::Csy4- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- pC4H::cogGFP GW-attR2 Csy4-attL4 attR4-pC4H-attR3 attL3-cogGFP- attL2 C45 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3-cogGFP- pC4H::cogGFP attL2 C90 pTKan-p35S::Csy4- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- pC4H::cogRFP GW-attR2 Csy4-attL4 attR4-pC4H-attR3 attL3-cogRFP- attL2 C91 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3-cogRFP- pC4H::cogRFP attL2 C132 pTKan-p35S::Csy4- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- pNOS::cogGFP GW-attR2 Csy4-attL4 attR4-pNOS- attL3-cogGFP- attR3 attL2 C134 pTKan-p35S::Csy4- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- pNOS::cogRFP GW-attR2 Csy4-attL4 attR4-pNOS- attL3-cogRFP- attR3 attL2 C135 pTKan- pTKan- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- p35S::attR1-GW- HPTII-attL4 attR4-pNOS- attL3-cogGFP- pNOS::cogGFP attR2 attR3 attL2 C137 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pNOS- attL3-cogRFP- pNOS::cogRFP attR3 attL2 C285 pTKan-p35S::RFP- pTKan-p35S::RFP- pDONR221-attL1- pDONR221- pDONR221- p35S::Csy4- p35S::attR1-GW- Csy4-attL4 attR4-pZmUbi- attL3-cogGFP- pZmUbi::cogGFP attR2 attR3 attL2 C286 pTKan-p35S::RFP- pTKan-p35S::RFP- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- p35S::attR1-GW- HPTII-attL4 attR4-pZmUbi- attL3-cogGFP- pZmUbi::cogGFP attR2 attR3 attL2 C310 pTKan-pNOS::RFP- pTKan-pNOS::RFP- pDONR221-attL1- pDONR221- pDONR221- p35S::cogGFP2AG p35S::attR1-GW- cogGFP2AGUS- attR4-pGC1-attR3 attL3-Csy4-attL2 US-pGCI::Csy4 attR2 attL4 C311 pTKan-pNOS::RFP- pTKan-pNOS::RFP- pDONR221-attL1- pDONR221- pDONR221- p35S::cogGFP2AG p35S::attR1-GW- cogGFP2AGUS- attR4-pGC1-attR3 attL3-HPTII-attL2 US-pGCI::HPTII attR2 attL4 C323 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::BBH18- GW-attR2 BBH18-attL4 attR4-pC4H-attR3 attL3- pC4H::cogBBH18G cogBBH18GFP- FP attL2 C324 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::ND02- GW-attR2 ND02-attL4 attR4-pC4H-attR3 attL3- pC4H::cogND02GF cogND02GFP- P attL2 C325 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::AB18- GW-attR2 AB18-attL4 attR4-pC4H-attR3 attL3- pC4H::cogAB18GF cogAB18GFP- P attL2 C326 pTKan-p35S::RP62- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- pC4H::cogRP62GF GW-attR2 RP62-attL4 attR4-pC4H-attR3 attL3- P cogRP62GFP- attL2 C328 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::MZ1T- GW-attR2 MZ1T-attL4 attR4-pC4H-attR3 attL3- pC4H::cogMZ1TGF cogMZ1TGFP- P attL2 C329 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::MG1655- GW-attR2 MG1655-attL4 attR4-pC4H-attR3 attL3- pC4H::cogMG1655 cogMG1655GFP- GFP attL2 C330 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3- pC4H::cogBBH18G cogBBH18GFP- FP attL2 C331 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3- pC4H::cogND02GF cogND02GFP- P attL2 C332 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3- pC4H::cogAB18GF cogAB18GFP- P attL2 C333 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3- pC4H::cogRP62GF cogRP62GFP- P attL2 C335 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3- pC4H::cogMZ1TGF cogMZ1TGFP- P attL2 C336 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3- pC4H::cogMG1655 cogMG1655GFP- GFP attL2 C352 pTKan-pNOS::RFP- pTKan-pNOS::RFP- pDONR221-attL1- pDONR221- pDONR221- p35S::GVG- p35S::GVG- Csy4-attL4 attR4-pC4H-attR3 attL3-cogFLUC- pUAS::Csy4-pC4H:: pUAS::attR1-GW- attL2 cogFLUC attR2 C354 pTKan-pNOS::RFP- pTKan-pNOS::RFP- pDONR221-attL1- pDONR221- pDONR221- p35S::GVG- p35S::GVG- HPTII-attL4 attR4-pC4H-attR3 attL3-cogFLUC- pUAS::HPTII- pUAS::attR1-GW- attL2 pC4H::cogFLUC attR2 C358 pTKan- pTKan- pDONR221-attL1- pDONR221- pDONR221- pAct2::cogRFP- pAct2::cogRFP- cogGFP-attL4 attR4-pNOS- attL3-Csy4-attL2 p35S::cogGFP- p35S::attR1-GW- attR3 pNOS::Csy4 attR2 C359 pTKan- pTKan- pDONR221-attL1- pDONR221- pDONR221- pAct2::cogRFP- pAct2::cogRFP- cogGFP-attL4 attR4-pNOS- attL3-HPTII-attL2 p35S::cogGFP- p35S::attR1-GW- attR3 pNOS::HPTII attR2 C360 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL attR4-pC4H-attR3 attL3-GFP-attL2 pC4H::GFP pDONR221-attLl- HPTII-attL4 C361 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3-RFP-attL2 pC4H::RFP pDONR221-attL1- HPTII-attL4 C362 pTKan- pTKan-p35S::attR1- pDONR221-attL1- pDONR221- pDONR221- p35S::HPTII- GW-attR2 HPTII-attL4 attR4-pC4H-attR3 attL3-FLUC-attL2 pC4H::FLUC pDONR221-attLl- HPTII-attL4 C363 pTKan- pTKan-p35S::attR1- pDONR221-at pDONR221- pDONR221- p35S::HPTII- GW-attR2 attR4-pC4H-attR3 attL3-cogFLUC- pC4H::cogFLUC attL2 C365 pTKan-p35S::Csy4- pTKan-p35S::attR1- pDONR221-attL1 pDONR221- pDONR221- pC4H::cogFLUC GW-attR2 attR4-pC4H-attR3 attL3-cogFLUC- attL2
TABLE-US-00004 TABLE2 Primerlist. Name Experiment,5->3sequence Tm Site BPcloningof 65 pDONR221-attB3-NLSCSY4-attB2 attb3-CSY4Nuc-F gacaactttgtataataaagttggcatggctccaaaaaagaaaagaaagg AttB3 (SEQIDNO:2) attb2-CSY4Nuc-R gaccactttgtacaagaaagctgggtctcagaaccaaggcacgaatc AttB2 (SEQIDNO:3) BPcloningof 62 pDONR221-attB3-HPTII-attB2 attb3-Hygr-F gacaactttgtataataaagttggcatgaaaaagcctgaactcacc AttB3 (SEQIDNO:4) attb2-Hygr-R gaccactttgtacaagaaagctgggtctttctttgccctcggacg AttB2 (SEQIDNO:5) BPcloningof 65 pDONR221-attB3-RFP-attB2 attB3-RFP-F gacaactttgtataataaagttggcatggcctcctccgagaac AttB3 (SEQIDNO:6) R-attB2-RFP gaccactttgtacaagaaagctgggtccaggaacaggtggtggcg AttB2 (SEQIDNO:7) SubcloningofcogGFP-attB2 58 F-cogGFP-F cgttcactgccgtataggcagctaagaaatatggtgagcaagggcgagg (SEQIDNO:8) R-attB2-GFP accactttgtacaagaaagctgggtacttgtacagctcgtccatgcc AttB2 (SEQIDNO:9) SubcloningofcogRFP-attB2 65 F-csycog-RFP cgttcactgccgtataggcagctaagaaatatggcctcctccgagaac (inpairwithR-attB2-RFP) (SEQIDNO:10) SubcloningofcogFLuc-attB2 59 F-cogFFLuc-F cgttcactgccgtataggcagctaagaaatatggttactgatgctaaaaatattaag (SEQIDNO:11) R-attB2-FFLuc gaccactttgtacaagaaagctgggtctcacagcgatctttcctc (SEQIDNO:12) BPcloningofpDONR221-attB3- 64 cogGFP/RFP/FLuc-attB2 F-attB3-csycog gacaactttgtataataaagttggccgttcactgccgtataggc AttB3 (inpairwithR-attB2-GFP/RFP/FLuc) (SEQIDNO:13) InfusioncloningofpTKan-pAct2- cogRFP-tNOS-p35S-attR1-GW-attR2 AmplificationofpAct2 62 F-pTKan-ApaIe-pAct2 ggggatcctctagagggagtcgacaaaatttagaacg (ApaIeliminated) (SEQIDNO:14) R-cog-pAct2 gcctatacggcagtgaacgttcaaagcggagaggaaaatatatg (SEQIDNO:15) AmplificationofcogRFP 65 R-tNOS-pTKan-ApaI tccgcggacgtcccgggcccGAGCTTGCATGCCGGTCG ApaI (inpairwithF-csycog-RFP) (SEQIDNO:16) InfusioncloningofpGCIinto 57 pDON-tG7-pGCIB4rB3rconstruct F-tG7-pGCI tgtaccccgggtaccaagcttgagtaaagattcagtaacccg HindIII (SEQIDNO:17) R-attR3-pGCI tattatacaaagttgtcctaggatttcttgagtagtgattttgaag AvrII (SEQIDNO:18) InfusioncloningofpGmUbiinto 62 pDON-tG7-pGmUbiB4rB3rconstruct F-tG7-pGmUbi tgtaccccgggtaccaagcttcagtgcagcgtgacccg HindIII (SEQIDNO:19) R-attR3-pGmUbi tattatacaaagttgtcctaggggatcctctagagtcgacctg AvrII (SEQIDNO:20) RT-PCRofcogGFP,primers 54 spanningthecleavagesite pC4H3UTR-F ctcagcagcttcttctgc (SEQIDNO:21) GFP92R gacacgctgaacttgtgg (SEQIDNO:22) RT-PCRofcogGFP,primers 55 downstreamofthecleavagesite GFP455F atatcatggccgacaagcag (SEQIDNO:23) GFP643R tctcgttggggtctttgctc (SEQIDNO:24) RT-PCRofCSY4 57 CSY4-62F agacccagagttccctccag (SEQIDNO:25) CSY4-237R agccctaaggtcatctgctg (SEQIDNO:26) RT-PCRandqPCRofcogRFP, 54 primersspanningthecleavagesite RFP89R tcgatctcgaactcgtggcc (inpairwithpC4H3UTR-F) (SEQIDNO:27) RT-PCRofcogRFP,primers 58 downstreamofthecleavagesite RFP661F catcaagttggacatcacctc (SEQIDNO:28) attB2R ccactttgtacaagaaagctgg (SEQIDNO:29) RT-PCRofEF1 63 EF1New-F agggtccaaccctccttgaggc (SEQIDNO:30) EF1New-R gcccctttggctgggtcgtc (SEQIDNO:31) RT-PCRofND02 56 ND02-q1F caagttgaccgcaaatcctgt (SEQIDNO:32) ND02-q1R ctgcttttccctgcaaccac (SEQIDNO:33) RT-PCRofMZ1T 58 MZ1T-q1F gcaaggggagatgcagctaa (SEQIDNO:34) MZ1T-q1R cactctctgagcaggccttc (SEQIDNO:35) qPCRofKAN 60 Kan-q1F atctcctgtcatctcaccttgc (SEQIDNO:36) Kan-q1R tttcgcttggtggtcgaatg (SEQIDNO:37) qPCRofCSY4 60 CSY4-q1F agctttggttgcacaaggtg (SEQIDNO:38) CSY4-q1R aaagccctaaggtcatctgctg (SEQIDNO:39) qPCRofcogGFP 60 attB3-cog taaagttggccgttcactgc (SEQIDNO:40) pC4H-cogGFP_1R aacttgtggccgtttacgtc (SEQIDNO:41) qPCRofcogRFP 60 attB3-cog(inpairwithRFP89R) Seethesameprimersabove
[0173] While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.