HER3/HER2 bispecific antibodies binding to the beta-hairpin of HER3 and domain II of HER2
10808038 ยท 2020-10-20
Assignee
Inventors
- Birgit Bossenmaier (Seefeld, DE)
- Richard Buick (Belfast, GB)
- Stefan Dengl (Munich, DE)
- Michael Gerg (Munich, DE)
- Carmen Peess (Tutzing, DE)
- Wolfgang Schaefer (Mannheim, DE)
- Michael Schraeml (Penzberg, DE)
- Claudio Sustmann (Munich, DE)
Cpc classification
A61K47/6829
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6879
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
Abstract
The invention relates to HER3/HER2 bispecific antibodies binding to the beta-hairpin of HER3 and domain II of HER2, their preparation and use as medicament.
Claims
1. An isolated bispecific antibody which binds to human HER3 and to human HER2, wherein the antibody binds to an epitope of human HER3 within the amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in the polypeptide of SEQ ID NO: 18 and binds to domain II of human HER2 comprising the amino acid sequence of SEQ ID NO: 59.
2. The bispecific antibody according to claim 1, wherein the bispecific antibody is bivalent.
3. An isolated nucleic acid encoding the bispecific antibody according to claim 1.
4. A host cell comprising the nucleic acid of claim 3.
5. A method of producing a bispecific antibody according to claim 3, said method comprising culturing the host cell of claim 4 so that the antibody is produced.
6. A pharmaceutical formulation comprising the bispecific antibody according to claim 1 and a pharmaceutically acceptable carrier.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
DETAILED DESCRIPTION OF EMBODIMENTS OF THE INVENTION
I. Definitions
(31) An acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework derived from a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
(32) An affinity matured antibody refers to an antibody with one or more alterations in one or more hypervariable regions (HVRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
(33) The terms bispecific HER3/HER2 antibody, a bispecific (HER3/HER2) antibody that binds to (human) HER3 and that binds to (human) HER2 and a bispecific (HER3/HER2) antibody that specifically binds to (human) HER3 and that specifically binds to (human) HER2 refer to an antibody that is capable of binding HER3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting HER3 and is capable of binding HER2 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting HER2. In one embodiment, the extent of binding of an bispecific HER3/HER2 antibody to an unrelated, non-HER3 protein (except of HER4) is less than about 10% of the binding of the antibody to HER3 or HER2 as measured, e.g., by a Surface Plasmon Resonance assay (e.g. BIACORE). In certain embodiments, an antibody that binds to human HER3 or HER2 has a KD value of the binding affinity for binding to human HER3 or HER2 of 1 M, 100 nM, 10 nM, 1 nM, 0.1 nM, 0.01 nM, or 0.001 nM (e.g. 10.sup.8 M or less, e.g. from 10.sup.8 M to 10.sup.13 M, e.g., from 10.sup.9 M to 10.sup.13 M). In certain embodiments the antibody according to the invention, binds (also) to human HER4 and has a KD value of the binding affinity for binding to human HER4 of 1 M, 100 nM, 10 nM, 1 nM, 0.1 nM, 0.01 nM, or 0.001 nM (e.g. 10.sup.8 M or less, e.g. from 10.sup.8 M to 10.sup.13 M, e.g., from 10.sup.9 M to 10.sup.13 M). In one preferred embodiment the respective KD value of the binding affinities is determined in a Surface Plasmon Resonance assay using the wildtype Extracellular domain (ECD) of human HER3 or HER2 (HER3-ECD or HER2-ECD) for the HER3 binding affinity or HER2 binding affinity, respectively. and wildtype human HER4-ECD for the HER4 binding affinity, respectively. In case the bispecific HER3/HER2 antibody also binds to (human) HER4, the terms bispecific HER3/HER2 antibody, an bispecific (HER3/HER2) antibody that binds to (human) HER3 and that binds to (human) HER2 and an bispecific (HER3/HER2) antibody that specifically binds to (human) HER3 and that specifically binds to (human) HER2 refer to a multispecific HER3/HER2 antibody that also binds to (human) HER4, a multispecific (HER3/HER2) antibody that binds to (human) HER3 and that binds to (human) HER2 that also binds to (human) HER4 and a multispecific (HER3/HER2) antibody that specifically binds to (human) HER3 and that specifically binds to (human) HER2 that also binds to (human) HER4.
(34) The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
(35) An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab, Fab-SH, F(ab)2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
(36) An antibody that binds to the same epitope as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more. An exemplary competition assay is provided herein.
(37) Antibody specificity refers to selective recognition of the antibody for a particular epitope of an antigen. Natural antibodies, for example, are monospecific.
(38) Bispecific antibodies according to the invention are antibodies which have two different antigen-binding specificities. Antibodies of the present invention are specific for two different antigens, VEGF as first antigen and ANG-2 as second antigen.
(39) The term monospecific antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen.
(40) The term valent as used within the current application denotes the presence of a specified number of binding sites in an antibody molecule. As such, the terms bivalent, tetravalent, and hexavalent denote the presence of two binding site, four binding sites, and six binding sites, respectively, in an antibody molecule. In one preferred embodiment of the invention the bispecific antibodies according to the invention are bivalent.
(41) The term cancer as used herein may be, for example, lung cancer, non small cell lung (NSCL) cancer, bronchioloalviolar cell lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, mesothelioma, hepatocellular cancer, biliary cancer, neoplasms of the central nervous system (CNS), spinal axis tumors, brain stem glioma, glioblastoma multiforme, astrocytomas, schwanomas, ependymonas, medulloblastomas, meningiomas, squamous cell carcinomas, pituitary adenoma, lymphoma, lymphocytic leukemia, including refractory versions of any of the above cancers, or a combination of one or more of the above cancers. In one preferred embodiment such cancer is a breast cancer, ovarian cancer, cervical cancer, lung cancer or prostate cancer. In one preferred embodiment such cancers are further characterized by HER3 expression (or overexpression). In one preferred embodiment such cancers are additionally further characterized by HER2 expression (or overexpression). One further embodiment the invention are the bispecific HER3/HER2 antibodies of the present invention for use in the simultaneous treatment of primary tumors and new metastases.
(42) The term chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
(43) The class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, and IgA.sub.2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called , , , , and respectively.
(44) The term cytotoxic agent as used herein refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof and the various antitumor or anticancer agents disclosed below. In one preferred embodiment the cytotoxic agent is Pseudomonas exotoxin A or variants thereof. In one preferred embodiment the cytotoxic agent is amatoxin or a variants thereof.
(45) Effector functions refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
(46) An effective amount of an agent, e.g., a pharmaceutical formulation, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
(47) The term epitope includes any polypeptide determinant capable of specific binding to an antibody. In certain embodiments, epitope determinant include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and or specific charge characteristics. An epitope is a region of an antigen that is bound by an antibody.
(48) The term Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
(49) The term includes native sequence Fc regions and variant Fc regions. In one embodiment, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991), NIH Publication 91-3242.
(50) Framework or FR refers to variable domain residues other than hypervariable region (HVR) residues. The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
(51) The terms full length antibody, intact antibody, and whole antibody are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
(52) The terms host cell, host cell line, and host cell culture are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include transformants and transformed cells, which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
(53) A human antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
(54) A human consensus framework is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, 5th ed., Bethesda Md. (1991), NIH Publication 91-3242, Vols. 1-3. In one embodiment, for the VL, the subgroup is subgroup kappa I as in Kabat et al., supra. In one embodiment, for the VH, the subgroup is subgroup III as in Kabat et al., supra.
(55) A humanized antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs. In certain embodiments, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody. A humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody. A humanized variant of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization. In one preferred embodiment, a murine HVR is grafted into the framework region of a human antibody to prepare the humanized antibody. See e.g. Riechmann, L., et al., Nature 332 (1988) 323-327; and Neuberger, M. S., et al., Nature 314 (1985) 268-270. The murine variable region amino acid sequence is aligned to a collection of human germline antibody V-genes, and sorted according to sequence identity and homology. The acceptor sequence is selected based on high overall sequence homology and optionally also the presence of the right canonical residues already in the acceptor sequence (see Poul, M-A. and Lefranc, M-P., in Ingnierie des anticorps banques combinatores ed. by Lefranc, M-P. and Lefranc, G., Les Editions INSERM, 1997). The germline V-gene encodes only the region up to the beginning of HVR3 for the heavy chain, and till the middle of HVR3 of the light chain. Therefore, the genes of the germline V-genes are not aligned over the whole V-domain. The humanized construct comprises the human frameworks 1 to 3, the murine HVRs, and the human framework 4 sequence derived from the human JK4, and the JH4 sequences for light and heavy chain, respectively. Before selecting one particular acceptor sequence, the so-called canonical loop structures of the donor antibody can be determined (see Morea, V., et al., Methods, Vol 20, Issue 3 (2000) 267-279). These canonical loop structures are determined by the type of residues present at the so-called canonical positions. These positions lie (partially) outside of the HVR regions, and should be kept functionally equivalent in the final construct in order to retain the HVR conformation of the parental (donor) antibody.
(56) The term hypervariable region or HVR as used herein refers to each of the regions of an antibody variable domain which are hypervariable in sequence (complementarity determining regions or CDRs) and/or form structurally defined loops (hypervariable loops) and/or contain the antigen-contacting residues (antigen contacts). Generally, antibodies comprise six HVRs: three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). Exemplary HVRs herein include:
(57) (a) hypervariable loops occurring at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3) (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987));
(58) (b) CDRs occurring at amino acid residues 24-34 (L1), 50-56 (L2), 89-97 (L3), 31-35b (H1), 50-65 (H2), and 95-102 (H3) (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991));
(59) (c) antigen contacts occurring at amino acid residues 27c-36 (L1), 46-55 (L2), 89-96 (L3), 30-35b (H1), 47-58 (H2), and 93-101 (H3) (MacCallum et al. J. Mol. Biol. 262: 732-745 (1996)); and
(60) (d) combinations of (a), (b), and/or (c), including HVR amino acid residues 46-56 (L2), 47-56 (L2), 48-56 (L2), 49-56 (L2), 26-35 (H1), 26-35b (H1), 49-65 (H2), 93-102 (H3), and 94-102 (H3).
(61) Unless otherwise indicated, HVR residues and other residues in the variable domain (e.g., FR residues) are numbered herein according to Kabat et al., supra.
(62) An immunoconjugate is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
(63) An individual or subject is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human.
(64) An isolated antibody is one which has been separated from a component of its natural environment. In some embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC). For review of methods for assessment of antibody purity, see, e.g., Flatman, S. et al., J. Chromatogr. B 848 (2007) 79-87.
(65) An isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
(66) Isolated nucleic acid encoding an bispecific HER3/HER2 antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
(67) The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
(68) The term Mab refers to monoclonal antibodies, whereas the term hMab refers to humanized variants of such monoclonal antibodies.
(69) A naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel. The naked antibody may be present in a pharmaceutical formulation. (Include if Prior art has immunoconjugates).
(70) Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures. For example, native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3). Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain. The light chain of an antibody may be assigned to one of two types, called kappa () and lambda (), based on the amino acid sequence of its constant domain.
(71) The term package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
(72) Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
(73) In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
100 times the fraction X/Y
where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
(74) The term pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
(75) A pharmaceutically acceptable carrier refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
(76) The term HER3, as used herein, refers to any native HER3 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed HER3 as well as any form of HER3 that results from processing in the cell. The term also encompasses naturally occurring variants of HER3, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human HER3 is shown in SEQ ID NO:3. Human HER3 (ErbB-3, ERBB3, c-erbB-3,c-erbB3, receptor tyrosine-protein kinase erbB-3, SEQ ID NO: 3) encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases which also includes HER1 (also known as EGFR), HER2, and HER4 (Kraus, M. H. et al, PNAS 86 (1989) 9193-9197; Plowman, G. D. et al, PNAS 87 (1990) 4905-4909; Kraus, M. H. et al, PNAS 90 (1993) 2900-2904). Like the prototypical epidermal growth factor receptor, the transmembrane receptor HER3 consists of an extracellular ligand-binding domain (ECD), a dimerization domain within the ECD, a transmembrane domain, an intracellular protein tyrosine kinase domain (TKD) and a C-terminal phosphorylation domain. This membrane-bound protein has a Heregulin (HRG) binding domain within the extracellular domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other HER family members which do have kinase activity. Heterodimerization leads to the activation of the receptor-mediated signaling pathway and transphosphorylation of its intracellular domain. Dimer formation between HER family members expands the signaling potential of HER3 and is a means not only for signal diversification but also signal amplification. For example the HER2/HER3 heterodimer induces one of the most important mitogenic signals via the PI3K and AKT pathway among HER family members (Sliwkowski M. X., et al, J. Biol. Chem. 269 (1994) 14661-14665; Alimandi M, et al, Oncogene. 10 (1995) 1813-1821; Hellyer, N.J., J. Biol. Chem. 276 (2001) 42153-4261; Singer, E., J. Biol. Chem. 276 (2001) 44266-44274; Schaefer, K. L., Neoplasia 8 (2006) 613-622) For an overview of HER3 and its various interactions within the HER receptor family and the NGR ligands family see e.g. G Sithanandam et al Cancer Gene Therapy (2008) 15, 413-448.
(77) Interestingly in its equilibrium state, the HER3 receptors exists in its closed confirmation, which does mean, the heterodimerization HER3 beta-hairpin motive is tethered via non-covalent interactions to the HER3 ECD domain IV (see
(78) The term HER2, as used herein, refers to any native HER2 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed HER2 as well as any form of HER2 that results from processing in the cell. The term also encompasses naturally occurring variants of HER4, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human HER2 is shown in SEQ ID NO:5. Human HER2 (also known as c-erb B2/neu protein, p185erbB2, proto-oncogene Neu, proto-oncogene c-ErbB-2, receptor tyrosine-protein kinase erbB-2, v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; SEQ ID NO:9) is a transmembrane surface-bound receptor tyrosine kinase and is normally involved in the signal transduction pathways leading to cell growth and differentiation. HER2 is a promising target for treatment of breast cancer as it was found to be overexpressed in about one-quarter of breast cancer patients (Bange et al, 2001, Nature Medicine 7:548). HER2 an oncogene and overexpression or mutation of this receptor lead to its constitutive activation. This drives the formation of various cancers, like breast, oral, pancreas and lung carcinoma (Schneider et al. 1989, Weiner et al. 1990, Hou et al. 1992, Revillion et al. 1998). HER2 is the only receptor of the HER family, which is not expressed in the tethered conformation like HER1, HER3 and HER4 are. Instead it is expressed in an open, extended conformation on the cell surface. In this conformation the -hairpin of subdomain II is accessible. The antibody Pertuzumab (Perjeta) was shown to bind immediate to the HER2 extracellular domain (ECD) -hairpin and surrounding region in subdomain II. The -hairpin is essential for the formation of dimers with other HER receptors. By binding to this epitope, Pertuzumab is able to inhibit dimer formation and therefore the activation of subsequent signaling cascades.
(79) The HER2/HER3 heterodimer induces one of the most important mitogenic signals via the PI3K and AKT pathway among HER family members (Sliwkowski M. X., et al, J. Biol. Chem. 269 (1994) 14661-14665; Alimandi M, et al, Oncogene. 10 (1995) 1813-1821; Hellyer, N.J., J. Biol. Chem. 276 (2001) 42153-4261; Singer, E., J. Biol. Chem. 276 (2001) 44266-44274; Schaefer, K. L., Neoplasia 8 (2006) 613-622). Especially the formation of HRG1 induced HER2/HER3 heterodimers plays a pivotal role in cancers with autocrine HRG loops (Gollamudi et al. 2004). Additionally, the results of current clinical studies indicate, that success of anti-HER2 antibody treatments is reduced in presence of HRG1 (McDonagh et al. 2012).
(80) The epitope of pertuzumab is the region in the extracellular domain of HER2 to which the antibody pertuzumab binds. In order to screen for antibodies which bind to the same epitope as pertuzumab, a routine cross-blocking assay such as that described in Ed. Harlow and David Lane, Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, (1988), can be performed. Alternatively, epitope mapping can be performed to assess whether the antibody binds to the pertuzumab epitope of HER2 (e.g. any one or more residues in the region from about residue 22 to about residue 584 of HER2, inclusive). The binding epitope of pertuzumab comprises residues from domain II in the extracellular domain of HER2. Pertuzumab bind to the extracellular domain of HER2 at the junction of domains I, II and III. See also Franklin, et al., Cancer Cell 5 (2004) 317-328.
(81) The term HER4, as used herein, refers to any native HER4 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses full-length, unprocessed HER4 as well as any form of HER4 that results from processing in the cell. The term also encompasses naturally occurring variants of HER4, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human HER4 is shown in SEQ ID NO:5. Human HER4 (also known as ErbB-4 ERBB4, v-erb-a erythroblastic leukemia viral oncogene homolog 4, p180erbB4 avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; SEQ ID NO:5) is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif (Plowman G D, wt al, PNAS 90:1746-50(1993); Zimonjic D B, et al, Oncogene 10:1235-7(1995); Culouscou J M, et al, J. Biol. Chem. 268:18407-10(1993)). The protein binds to and is activated by neuregulins-2 and -3, heparin-binding EGF-like growth factor and betacellulin. Ligand binding induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
(82) As used herein, treatment (and grammatical variations thereof such as treat or treating) refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some embodiments, antibodies of the invention are used to delay development of a disease or to slow the progression of a disease.
(83) The term variable region or variable domain refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). (See, e.g., Kindt, T. J. et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., N.Y. (2007), page 91) A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano, S. et al., J. Immunol. 150 (1993) 880-887; Clackson, T. et al., Nature 352 (1991) 624-628).
(84) The term vector, as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as expression vectors.
II. Compositions and Methods
(85) In one aspect, the invention is based, in part, on the finding that using the beta-hairpins of HER3 (and optionally HER4) functionally presented in a 3-dimensional orientation within SlyD scaffolds (see e.g
(86) The bispecific antibodies of the invention are useful, e.g., for the diagnosis or treatment of cancer.
(87) A. Exemplary Bispecific HER3/HER2 Antibodies
(88) The invention provides an isolated bispecific antibody that binds to human HER3 and that binds to human HER2, wherein the antibody binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide selected from the group consisting of:
(89) TABLE-US-00006 SEQIDNO:13 TtSlyD-FKBP-Her3, SEQIDNO:17 TtSlyDcas-Her3, SEQIDNO:18 TtSlyDcys-Her3, SEQIDNO:19 TgSlyDser-Her3, and SEQIDNO:20 TgSlyDcys-Her3.
(90) The invention provides an isolated bispecific antibody that binds to human HER3 and that binds to human HER2,
(91) wherein the antibody binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3).
(92) The invention provides an isolated bispecific antibody that binds to the beta-hairpin of human HER3 (SEQ ID NO: 1) and that binds to domain II of human HER2 (SEQ ID NO: 59).
(93) The invention provides an isolated bispecific antibody that binds to human HER3 and that binds to human HER2, wherein the antibody binds to human HER3 within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) and wherein the antibody binds to domain II of human HER2 (SEQ ID NO: 59).
(94) The invention provides an isolated bispecific antibody that binds to the polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) which comprises the amino acid sequence PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and which antibody binds to domain II of human HER2 (SEQ ID NO: 59).
(95) The invention provides an isolated bispecific antibody that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that binds to the same epitope on human HER2 as pertuzumab.
(96) The invention provides an isolated bispecific antibody that binds to the polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) which comprises the amino acid sequence PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and which antibody binds to the same epitope on human HER2 as pertuzumab.
(97) The invention provides an isolated bispecific antibody that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that competes for binding to human HER2 with pertuzumab.
(98) The invention provides an bispecific isolated antibody that binds to the polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) which comprises the amino acid sequence PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and which antibody competes for binding to human HER2 with pertuzumab.
(99) The invention provides an bispecific isolated antibody that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that binds to human HER2 and comprises all six heavy and light chains HVRs of pertuzumab (SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, and SEQ ID NO: 65).
(100) The invention provides an bispecific isolated antibody that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that binds to human HER2 and comprises the VH and VL of pertuzumab (SEQ ID NO: 66 and SEQ ID NO. 67)).
(101) In one embodiment of the invention the bispecific HER3/HER2 antibody as described herein binds also to human HER4 (and is then designated as multispecific HER3/HER2 antibody antibody).
(102) In one embodiment of the invention the multispecific HER3/HER2 antibody as described herein binds also to the beta-hairpin of human HER4 PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2).
(103) In one embodiment of the invention the multispecific HER3/HER2 antibody as described herein binds also to the polypeptide of SEQ ID NO: 22 (TtSlyDcys-Her4) which comprises the amino acid sequence PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2).
(104) An example antibody which binds to the beta-hairpin of human HER3 and also binds to human HER4, to the beta-hairpin of human HER4 PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2) and to the polypeptide of SEQ ID NO: 22 (TtSlyDcys-Her4) which comprises the amino acid sequence PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2) is antibody comprising the VH of SEQ ID NO: 31 (heavy chain variable domain VH, M-05-74) and the VL of SEQ ID NO: 32 (light chain variable domain VL, M-05-74).
(105) In one embodiment of the invention the bispecific HER3/HER2 antibody as described herein does not crossreact with human HER4.
(106) In one embodiment of the invention the bispecific HER3/HER2 antibody as described herein does not crossreact with the beta-hairpin of human HER4 PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2).
(107) In one embodiment of the invention the bispecific HER3/HER2 antibody as described herein does not crossreact with the polypeptide of SEQ ID NO: 22 (TtSlyDcys-Her4) which comprises the amino acid sequence PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2).
(108) An example antibody which binds to the beta-hairpin of human HER3 and does not crossreact with (does not bind to) human HER4, to the beta-hairpin of human HER4 PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2) and to the polypeptide of SEQ ID NO: 22 (TtSlyDcys-Her4) which comprises the amino acid sequence PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2) is antibody comprising the VH of SEQ ID NO: 51 (heavy chain variable domain VH, <Her3> M-08-11) and the VL of SEQ ID NO: 52 (light chain variable domain VL, <Her3> M-08-11).
(109) The invention provides an bispecific isolated antibody a) that binds to human HER3 and comprises the heavy chain HVRs of SEQ ID NO: 25 heavy chain HVR-H1, M-05-74, SEQ ID NO: 26 heavy chain HVR-H2, M-05-74, and SEQ ID NO: 27 heavy chain HVR-H3, M-05-74, and comprises the light chain heavy chain HVRs of SEQ ID NO: 28 light chain HVR-L1, M-05-74, SEQ ID NO: 29 light chain HVR-L2, M-05-74, and SEQ ID NO: 30 light chain HVR-L3, M-05-74; and b) that binds to human HER2 and comprises the heavy chain HVRs of SEQ ID NO: 60 heavy chain HVR-H1, pertuzumab, SEQ ID NO: 61 heavy chain HVR-H2 pertuzumab, SEQ ID NO: 62 heavy chain HVR-H3, pertuzumab, and comprises the light chain heavy chain HVRs of SEQ ID NO: 63 light chain HVR-L1, pertuzumab, SEQ ID NO: 64 light chain HVR-L2, pertuzumab, and SEQ ID NO: 65 light chain HVR-L3 pertuzumab.
(110) The invention provides an bispecific isolated antibody a) that binds to human HER3 and comprises i) a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:33 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:41, ii) a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:33 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:39, or iii) a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:33 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:42; and b) that binds to human HER2 and a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:66 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:67.
(111) In one embodiment of the invention the bispecific HER3/HER2 antibody as described herein wherein the bispecific antibody is bivalent.
(112) In one embodiment of the invention the bispecific HER3/HER2 antibody as described herein has one or more of the following properties (either alone or in any combination): the antibody a) binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide selected from the group consisting of:
(113) TABLE-US-00007 SEQIDNO:13 TtSlyD-FKBP-Her3, SEQIDNO:17 TtSlyDcas-Her3, SEQIDNO:18 TtSlyDcys-Her3, SEQIDNO:19 TgSlyDser-Her3, and SEQIDNO:20 TgSlyDcys-Her3; b) binds to a polypeptide selected from the group consisting of:
(114) TABLE-US-00008 SEQIDNO:13 TtSlyD-FKBP-Her3, SEQIDNO:17 TtSlyDcas-Her3, SEQIDNO:18 TtSlyDcys-Her3, SEQIDNO:19 TgSlyDser-Her3, and SEQIDNO:20 TgSlyDcys-Her3; c) inhibits the heterodimerisation of HER3/HER2 heterodimers in MCF-7 cells in a HER3/HER2 coprecipitation assay; d) shows tumor growth inhibitory activity in vivo; e) binds with an affinity of a KD value 1108 M to HER3-ECD (in one embodiment with a KD value of 1108 M to 11013 M; (in one embodiment with a KD value of 1109 M to 11013 M); f) binds with an affinity of a KD value 1108 M to HER2-ECD (in one embodiment with a KD value of 1108 M to 11013 M; (in one embodiment with a KD value of 1109 M to 11013 M.
(115) In one preferred embodiment the antibody is of IgG1 or IgG4 isotype. In one preferred embodiment the antibody comprises constant domains of human origin (human constant domains.). Typical human constant regions within the meaning of the present invention comprising the respective human constant domains have the amino acid sequences of SEQ ID NO: 53 to SEQ ID NO:58 (which are partly comprising amino acid substitutions).
(116) 1. Antibody Affinity
(117) In certain embodiments, an antibody provided herein has a dissociation constant KD of 1 M, 100 nM, 10 nM, 1 nM, 0.1 nM, 0.01 nM, or 0.001 nM (e.g. 10.sup.8 M or less, e.g. from 10.sup.8 M to 10.sup.13 M, e.g., from 10.sup.9M to 10.sup.13 M).
(118) In one preferred embodiment, KD is measured using surface plasmon resonance assays using a BIACORE) at 25 C. with immobilized antigen CM5 chips at 10 response units (RU). Briefly, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with N-ethyl-N-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 g/ml (0.2 M) before injection at a flow rate of 5 l/minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% polysorbate 20 (TWEEN-20) surfactant (PBST) at 25 C. at a flow rate of approximately 25 l/min. Association rates (k.sub.on or ka) and dissociation rates (k.sub.off or kd) are calculated using a simple one-to-one Langmuir binding model (BIACORE Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant KD is calculated as the ratio kd/ka (k.sub.off/k.sub.on.) See, e.g., Chen, Y. et al., J. Mol. Biol. 293 (1999) 865-881. If the on-rate exceeds 10.sup.6 M.sup.1 s.sup.1 by the surface plasmon resonance assay above, then the on-rate can be determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence emission intensity (excitation=295 nm; emission=340 nm, 16 nm band-pass) at 25 C. of a 20 nM anti-antigen antibody (Fab form) in PBS, pH 7.2, in the presence of increasing concentrations of antigen as measured in a spectrometer, such as a stop-flow equipped spectrophotometer (Aviv Instruments) or a 8000-series SLM-AMINCO spectrophotometer (ThermoSpectronic) with a stirred cuvette.
(119) 2. Antibody Fragments
(120) In certain embodiments, an antibody provided herein is an antibody fragment. Antibody fragments include, but are not limited to, Fab, Fab, Fab-SH, F(ab).sub.2, Fv, and scFv fragments, and other fragments described below. For a review of certain antibody fragments, see Hudson, P. J. et al., Nat. Med. 9 (2003) 129-134. For a review of scFv fragments, see, e.g., Plueckthun, A., In; The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg and Moore (eds.), Springer-Verlag, New York (1994), pp. 269-315; see also WO 93/16185; and U.S. Pat. Nos. 5,571,894 and 5,587,458. For discussion of Fab and F(ab)2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Pat. No. 5,869,046.
(121) Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 0 404 097; WO 1993/01161; Hudson, P. J. et al., Nat. Med. 9 (2003) 129-134; and Holliger, P. et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448. Triabodies and tetrabodies are also described in Hudson, P. J. et al., Nat. Med. 9 (20039 129-134).
(122) Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, Mass.; see, e.g., U.S. Pat. No. 6,248,516 B1).
(123) Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
(124) In one preferred embodiment the antibody fragment is a Fab fragment. In one preferred embodiment the antibody fragment (in case constant domains are contained in the fragmant) comprises constant domains of human origin (human constant domains.).
(125) 3. Chimeric and Humanized Antibodies
(126) In certain embodiments, an antibody provided herein is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison, S. L. et al., Proc. Natl. Acad. Sci. USA 81 (1984) 6851-6855). In one example, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. In a further example, a chimeric antibody is a class switched antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
(127) In certain embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
(128) Humanized antibodies and methods of making them are reviewed, e.g., in Almagro, J. C. and Fransson, J., Front. Biosci. 13 (2008) 1619-1633, and are further described, e.g., in Riechmann, I. et al., Nature 332 (1988) 323-329; Queen, C. et al., Proc. Natl. Acad. Sci. USA 86 (1989) 10029-10033; U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri, S. V. et al., Methods 36 (2005) 25-34 (describing SDR (a-CDR) grafting); Padlan, E. A., Mol. Immunol. 28 (1991) 489-498 (describing resurfacing); Dall'Acqua, W. F. et al., Methods 36 (2005) 43-60 (describing FR shuffling); and Osbourn, J. et al., Methods 36 (2005) 61-68 and Klimka, A. et al., Br. J. Cancer 83 (2000) 252-260 (describing the guided selection approach to FR shuffling). Morea, V., et al., Methods, Vol 20, Issue 3 (2000) 267-279) and WO2004/006955 (approach via canonical structures).
(129) 4. Human Antibodies
(130) In certain embodiments, an antibody provided herein is a human antibody. Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk, M. A. and van de Winkel, J. G., Curr. Opin. Pharmacol. 5 (2001) 368-374 and Lonberg, N., Curr. Opin. Immunol. 20 (2008) 450-459.
(131) Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, N., Nat. Biotech. 23 (2005) 1117-1125. See also, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE technology; U.S. Pat. No. 5,770,429 describing HuMab technology; U.S. Pat. No. 7,041,870 describing K-M MOUSE technology, and U.S. Patent Application Publication No. US 2007/0061900, describing VelociMouse technology). Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
(132) Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor, D., J. Immunol. 133 (1984) 3001-3005; Brodeur, B. R. et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York (1987), pp. 51-63; and Boerner, P. et al., J. Immunol. 147 (1991) 86-95) Human antibodies generated via human B-cell hybridoma technology are also described in Li, J. et al., Proc. Natl. Acad. Sci. USA 103 (2006) 3557-3562. Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, J., Xiandai Mianyixue 26 (2006) 265-268 (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers, H. P. and Brandlein, S., Histology and Histopathology 20 (2005) 927-937 and Vollmers, H. P. and Brandlein, S., Methods and Findings in Experimental and Clinical Pharmacology 27 (2005) 185-191.
(133) Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
(134) 5. Library-Derived Antibodies
(135) Antibodies of the invention may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom, H. R. et al., Methods in Molecular Biology 178 (2001) 1-37 and further described, e.g., in the McCafferty, J. et al., Nature 348 (1990) 552-554; Clackson, T. et al., Nature 352 (1991) 624-628; Marks, J. D. et al., J. Mol. Biol. 222 (1992) 581-597; Marks, J. D. and Bradbury, A., Methods in Molecular Biology 248 (2003) 161-175; Sidhu, S. S. et al., J. Mol. Biol. 338 (2004) 299-310; Lee, C. V. et al., J. Mol. Biol. 340 (2004) 1073-1093; Fellouse, F. A., Proc. Natl. Acad. Sci. USA 101 (2004) 12467-12472; and Lee, C. V. et al., J. Immunol. Methods 284 (2004) 119-132.
(136) In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter, G. et al., Ann. Rev. Immunol. 12 (1994) 433-455. Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths, A. D. et al., EMBO J. 12 (1993) 725-734. Finally, naive libraries can also be made synthetically by cloning non-rearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom, H. R. and Winter, G., J. Mol. Biol. 227 (1992) 381-388. Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
(137) Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
(138) 6. Multispecific Antibodies
(139) In certain embodiments, an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody. Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites. In certain embodiments, one of the binding specificities is for HER3/HER4 and the other is for any other antigen.
(140) Multispecific antibodies may also be used to localize cytotoxic agents to cells which express HER3 and/or HER2 (and HER4). Bispecific or multispecific antibodies can be prepared as full length antibodies or antibody fragments.
(141) Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein, C. and Cuello, A. C., Nature 305 (1983) 537-540, WO 93/08829, and Traunecker, A. et al., EMBO J. 10 (1991) 3655-3659), and knob-in-hole engineering (see, e.g., U.S. Pat. No. 5,731,168). Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004); cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No. 4,676,980, and Brennan, M. et al., Science 229 (1985) 81-83); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny, S. A. et al., J. Immunol. 148 (1992) 1547-1553; using diabody technology for making bispecific antibody fragments (see, e.g., Holliger, P. et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448); and using single-chain Fv (sFv) dimers (see, e.g. Gruber, M et al., J. Immunol. 152 (1994) 5368-5374); and preparing trispecific antibodies as described, e.g., in Tutt, A. et al., J. Immunol. 147 (1991) 60-69).
(142) Engineered antibodies with three or more functional antigen binding sites, including Octopus antibodies, are also included herein (see, e.g. US 2006/0025576).
(143) The antibody or fragment herein also includes a Dual Acting Fab or DAF comprising an antigen binding site that binds to HER3 as well as another, different antigen (see, US 2008/0069820, for example).
(144) The antibody or fragment herein also includes multispecific antibodies described in WO 2009/080251, WO 2009/080252, WO 2009/080253, WO 2009/080254, WO 2010/112193, WO 2010/115589, WO 2010/136172, WO 2010/145792, and WO 2010/145793.
(145) 7. Antibody Variants
(146) In certain embodiments, amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.
(147) a) Substitution, Insertion, and Deletion Variants
(148) In certain embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs and FRs. Conservative substitutions are shown in Table 1 under the heading of preferred substitutions. More substantial changes are provided in Table 1 under the heading of exemplary substitutions, and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
(149) TABLE-US-00009 TABLE 1 Original Exemplary Preferred Residue Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu
(150) Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
(151) Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
(152) One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
(153) Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR hotspots, i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, P. S., Methods Mol. Biol. 207 (2008) 179-196), and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom, H. R. et al. in Methods in Molecular Biology 178 (2002) 1-37. In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
(154) In certain embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may be outside of HVR hotspots or SDRs. In certain embodiments of the variant VH and VL sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
(155) A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called alanine scanning mutagenesis as described by Cunningham, B. C. and Wells, J. A., Science 244 (1989) 1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as arg, asp, his, lys, and glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
(156) Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
(157) b) Glycosylation Variants
(158) In certain embodiments, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
(159) Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright, A. and Morrison, S. L., TIBTECH 15 (1997) 26-32. The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the stem of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties.
(160) In one embodiment, antibody variants are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US 2003/0157108; US 2004/0093621. Examples of publications related to defucosylated or fucose-deficient antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO 2005/053742; WO 2002/031140; Okazaki, A. et al., J. Mol. Biol. 336 (2004) 1239-1249; Yamane-Ohnuki, N. et al., Biotech. Bioeng. 87 (2004) 614-622. Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka, J. et al., Arch. Biochem. Biophys. 249 (1986) 533-545; US 2003/0157108; and WO 2004/056312, especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki, N. et al., Biotech. Bioeng. 87 (2004) 614-622; Kanda, Y. et al., Biotechnol. Bioeng. 94 (2006) 680-688; and WO 2003/085107).
(161) Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878; U.S. Pat. No. 6,602,684; and US 2005/0123546. Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764.
(162) c) Fc Region Variants
(163) In certain embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
(164) In certain embodiments, the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express Fc(RIII only, whereas monocytes express FcgammaRI, FcgammaRII and FcgammaRIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch, J. V. and Kinet, J. P., Annu. Rev. Immunol. 9 (1991) 457-492. Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al., Proc. Natl. Acad. Sci. USA 83 (1986) 7059-7063; and Hellstrom, I. et al., Proc. Natl. Acad. Sci. USA 82 (1985) 1499-1502); U.S. Pat. No. 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166 (1987) 1351-1361). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CytoTox 96 non-radioactive cytotoxicity assay (Promega, Madison, Wis.). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes, R. et al., Proc. Natl. Acad. Sci. USA 95 (1998) 652-656. C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and
(165) WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro, H. et al., J. Immunol. Methods 202 (1996) 163-171; Cragg, M. S. et al., Blood 101 (2003) 1045-1052; and Cragg, M. S. and M. J. Glennie, Blood 103 (2004) 2738-2743). FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int. Immunol. 18 (2006: 1759-1769).
(166) Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called DANA Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
(167) Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312, and Shields, R. L. et al., J. Biol. Chem. 276 (2001) 6591-6604)
(168) In certain embodiments, an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
(169) In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie, E. E. et al., J. Immunol. 164 (2000) 4178-4184.
(170) Antibodies with increased half lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer, R. L. et al., J. Immunol. 117 (1976) 587-593, and Kim, J. K. et al., J. Immunol. 24 (1994) 2429-2434), are described in US 2005/0014934. Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
(171) See also Duncan, A. R. and Winter, G., Nature 322 (1988) 738-740; U.S. Pat. Nos. 5,648,260; 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
(172) d) Cysteine Engineered Antibody Variants
(173) In certain embodiments, it may be desirable to create cysteine engineered antibodies, e.g., thioMAbs, in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In certain embodiments, any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
(174) e) Antibody Derivatives
(175) In certain embodiments, an antibody provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
(176) In another embodiment, conjugates of an antibody and non-proteinaceous moiety that may be selectively heated by exposure to radiation are provided. In one embodiment, the non-proteinaceous moiety is a carbon nanotube (Kam, N. W. et al., Proc. Natl. Acad. Sci. USA 102 (2005) 11600-11605). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the non-proteinaceous moiety to a temperature at which cells proximal to the antibody-non-proteinaceous moiety are killed.
(177) B. Recombinant Methods and Compositions
(178) Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567. In one embodiment, isolated nucleic acid encoding an bispecific HER3/HER2 antibody described herein is provided. Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody). In a further embodiment, one or more vectors (e.g., expression vectors) comprising such nucleic acid are provided. In a further embodiment, a host cell comprising such nucleic acid is provided. In one such embodiment, a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody. In one embodiment, the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell). In one embodiment, a method of making an bispecific HER3/HER2 antibody is provided, wherein the method comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
(179) For recombinant production of an bispecific HER3/HER2 antibody, nucleic acid encoding an antibody, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
(180) Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, K. A., In: Methods in Molecular Biology, Vol. 248, Lo, B. K. C. (ed.), Humana Press, Totowa, N.J. (2003), pp. 245-254, describing expression of antibody fragments in E. coli.) After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
(181) In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been humanized, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, T. U., Nat. Biotech. 22 (2004) 1409-1414; and Li, H. et al., Nat. Biotech. 24 (2006) 210-215.
(182) Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
(183) Plant cell cultures can also be utilized as hosts. See, e.g., U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES technology for producing antibodies in transgenic plants).
(184) Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham, F. L. et al., J. Gen Virol. 36 (1977) 59-74); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, J. P., Biol. Reprod. 23 (1980) 243-252); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather, J. P. et al., Annals N.Y. Acad. Sci. 383 (1982) 44-68; MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR.sup. CHO cells (Urlaub, G. et al., Proc. Natl. Acad. Sci. USA 77 (1980) 4216-4220); and myeloma cell lines such as Y0, NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki, P. and Wu, A. M., Methods in Molecular Biology, Vol. 248, Lo, B. K. C. (ed.), Humana Press, Totowa, N.J. (2004), pp. 255-268.
(185) C. Assays
(186) Bispecific HER3/HER2 (and their parent anti-HER3 and anti-HER2) antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
(187) Disclosed is a method for selecting for an antibody that binds to human HER3 for use in generating bispecific HER3/HER2 antibodies wherein the anti-HER3 antibody binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) of human HER3; wherein
(188) a) at least one polypeptide selected from the group consisting of:
(189) TABLE-US-00010 SEQIDNO:13 TtSlyD-FKBP-Her3, SEQIDNO:17 TtSlyDcas-Her3, SEQIDNO:18 TtSlyDcys-Her3, SEQIDNO:19 TgSlyDser-Her3, and SEQIDNO:20 TgSlyDcys-Her3,
which comprises the amino acid sequence of SEQ ID NO:1;
are used (in a binding assay) to select antibodies, which show binding to the at least one polypeptide under a)
and thereby selecting an antibody that binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) (within human HER3).
(190) In one embodiment the selection method further comprises a step wherein the selected antibodies are counterscreened with the polypeptides (tested for binding to the polypeptides) selected from the group consisting of:
(191) TABLE-US-00011 SEQIDNO:14 TtSlyD-Wildtype SEQIDNO:15 TtSlyDcas SEQIDNO:16 TgSlyDIF
to confirm that the selected antibodies do not bind to the polypeptide scaffolds which are not comprising amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1).
1. Binding Assays and Other Assays
(192) In one aspect, an antibody of the invention is tested for its antigen binding activity, e.g., by known methods such as ELISA, Western blot, including surface plasmon resonance (e.g. BIACORE), etc.
(193) In another aspect, competition assays may be used to identify an antibody that competes with M-05-74 for binding to HER3 (and/or to HER4) and also to identify an antibody that competes with pertuzumab for binding to HER2. In certain embodiments, such a competing antibody binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by M-05-74. Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris, G. E. (ed.), Epitope Mapping Protocols, In: Methods in Molecular Biology, Vol. 66, Humana Press, Totowa, N.J. (1996). Further methods are described in detail in Example 4 using the CelluSpot technology.
(194) In an exemplary competition assay, immobilized HER3(/HER4), or to HER2 is incubated in a solution comprising a first labeled antibody that binds to HER3(/HER4), or to HER2, respectively (e.g., M-05-74 or pertuzumab) and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to HER3(/HER4), or to HER2. The second antibody may be present in a hybridoma supernatant. As a control, immobilized HER3 or HER4 is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to HER3(/HER4), or to HER2, excess unbound antibody is removed, and the amount of label associated with immobilized HER3(/HER4), or to HER2 is measured. If the amount of label associated with immobilized HER3(/HER4), or to HER2 is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to HER3(/HER4), or to HER2. See Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Chapter 14, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1988).
(195) 2. Activity Assays
(196) In one aspect, assays are provided for identifying bispecific HER3/HER2 antibodies thereof having biological activity. Biological activity may include, e.g., inhibition of HER3 and/or HER2 phosphorylation, inhibition of cancer cell proliferation of HER3 and/or HER2 (and/or HER4) expressing or overexpressing cancer cells, inhibition of HER3/HER2 heterodimerization, (time-dependent) internalization via FACS assay, in vivo tumor growth inhibition in xenograft animal (e.g. mouse or rat) models with xenografted HER3 and/or HER2 (and/or HER4) expressing or overexpressing cancer cells. Antibodies having such biological activity in vivo and/or in vitro are also provided.
(197) In certain embodiments, an antibody of the invention is tested for such biological activity. Exemplary vitro or in vivo assays for specified biological activities are described in Example 2e, 3, 5 to 9, and 11 or 17.
(198) D. Immunoconjugates
(199) The invention also provides immunoconjugates comprising an anti-HER3/HER4 antibody described herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
(200) In one embodiment, an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Pat. Nos. 5,208,020, 5,416,064 and EP 0 425 235 B1); an auristatin such as monomethyl auristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483, 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296; Hinman, L. M. et al., Cancer Res. 53 (1993) 3336-3342; and Lode, H. N. et al., Cancer Res. 58 (1998) 2925-2928); an anthracycline such as daunomycin or doxorubicin (see Kratz, F. et al., Curr. Med. Chem. 13 (2006) 477-523; Jeffrey, S. C. et al., Bioorg. Med. Chem. Lett. 16 (2006) 358-362; Torgov, M. Y. et al., Bioconjug. Chem. 16 (2005) 717-721; Nagy, A. et al., Proc. Natl. Acad. Sci. USA 97 (2000) 829-834; Dubowchik, G. M. et al., Bioorg. & Med. Chem. Letters 12 (2002) 1529-1532; King, H. D. et al., J. Med. Chem. 45 (20029 4336-4343; and U.S. Pat. No. 6,630,579); methotrexate; vindesine; a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel; a trichothecene; and CC1065.
(201) In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
(202) In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to a Pseudomonas exotoxin A or variants thereof. Pseudomonas exotoxin A or variants thereof are described e.g in WO2011/32022, WO2009/32954, WO2007/031741, WO2007/016150, WO2005/052006 and Liu W, et al, PNAS 109 (2012) 11782-11787.
(203) In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate. A variety of radioactive isotopes are available for the production of radioconjugates. Examples include At.sup.211, I.sup.131, I.sup.125, Y.sup.90, Re.sup.186, Re.sup.188, sm.sup.153, Bi.sup.212, P.sup.32, Pb.sup.212 and radioactive isotopes of Lu. When the radioconjugate is used for detection, it may comprise a radioactive atom for scintigraphic studies, for example TC.sup.99m or I.sup.123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as iodine-123 again, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
(204) Conjugates of an antibody and cytotoxic agent may be made a) either using recombination expression techniques (e.g for the expression of amino acid sequence based toxines fused to a Fab or Fv antibody fragment e.g. in E. coli) or b) using polypeptide coupling techniques (like sortase enzyme based coupling of amino acid sequence based toxines to a Fab or Fv antibody fragment) or c) using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta, E. S. et al., Science 238 (1987) 1098-1104. Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triamine pentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO 94/11026. The linker may be a cleavable linker facilitating release of a cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari, R. V. et al., Cancer Res. 52 (1992) 127-131; U.S. Pat. No. 5,208,020) may be used.
(205) The immunuoconjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., U.S.A).
(206) E. Methods and Compositions for Diagnostics and Detection
(207) In certain embodiments, any of the bispecific HER3/HER2 antibodies provided herein is useful for detecting the presence of HER3 and/or HER4, respectively in a biological sample. The term detecting as used herein encompasses quantitative or qualitative detection. In certain embodiments, a biological sample comprises a cell or tissue, such as tumor tissues.
(208) In one embodiment, an bispecific HER3/HER2 antibody for use in a method of diagnosis or detection is provided. In a further aspect, a method of detecting the presence of HER3 or HER2, respectively, in a biological sample is provided. In certain embodiments, the method comprises contacting the biological sample with an bispecific HER3/HER2 antibody as described herein under conditions permissive for binding of the anti-bispecific HER3/HER2 antibody to HER3 or HER2, respectively, and detecting whether a complex is formed between the anti-bispecific HER3/HER2 antibody and HER3 or HER2, respectively. Such method may be an in vitro or in vivo method. In one embodiment, an bispecific HER3/HER2 antibody is used to select subjects eligible for therapy with an the bispecific HER3/HER2 antibodies antibody, e.g. where HER3 and HER2, respectively are both biomarkers for selection of patients.
(209) Exemplary disorders that may be diagnosed using an antibody of the invention include cancer.
(210) In certain embodiments, labeled bispecific HER3/HER2 antibodies are provided. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes .sup.32P, .sup.14C, .sup.125I, .sup.3H, and .sup.131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, -galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
(211) F. Pharmaceutical Formulations
(212) Pharmaceutical formulations of an bispecific HER3/HER2 antibody as described herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed.) (1980)), in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyl dimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as poly(vinylpyrrolidone); amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Exemplary pharmaceutically acceptable carriers herein further include interstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rhuPH20 (HYLENEX, Baxter International, Inc.). Certain exemplary sHASEGPs and methods of use, including rhuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968. In one aspect, a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
(213) Exemplary lyophilized antibody formulations are described in U.S. Pat. No. 6,267,958. Aqueous antibody formulations include those described in U.S. Pat. No. 6,171,586 and WO 2006/044908, the latter formulations including a histidine-acetate buffer.
(214) The formulation herein may also contain more than one active ingredients as necessary for the particular indication being treated.
(215) Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methyl methacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed.) (1980).
(216) Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
(217) The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
G. Therapeutic Methods and Compositions
(218) Any of the bispecific HER3/HER2 antibodies or immunoconjugates of the anti-bispecific HER3/HER2 antibodies conjugated to a cytotoxic agent, provided herein may be used in therapeutic methods.
(219) In one aspect, an bispecific HER3/HER2 antibody or immunoconjugate of the anti-v antibody conjugated to a cytotoxic agent for use as a medicament is provided. In further aspects, an bispecific HER3/HER2 antibody or immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent for use in treating cancer is provided. In certain embodiments, an bispecific HER3/HER2 antibody or immunoconjugates of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent for use in a method of treatment is provided. In certain embodiments, the invention provides an bispecific HER3/HER2 antibody or immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent for use in a method of treating an individual having cancer comprising administering to the individual an effective amount of the bispecific HER3/HER2 antibody or the immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent. In further embodiments, the invention provides an bispecific HER3/HER2 antibody or immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent for use in inducing apoptosis in a cancer cell/or inhibiting cancer cell proliferation. In certain embodiments, the invention provides an bispecific HER3/HER2 antibody or immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent for use in a method of inducing apoptosis in a cancer cell/or inhibiting cancer cell proliferation in an individual comprising administering to the individual an effective of the bispecific HER3/HER2 antibody or immunoconjugate of the bispecific HER3/HER2 antibodies conjugated to a cytotoxic agent to induce apoptosis in a cancer cell/or to inhibit cancer cell proliferation. An individual according to any of the above embodiments is preferably a human.
(220) In a further aspect, the invention provides for the use of an bispecific HER3/HER2 antibody or an immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic agent in the manufacture or preparation of a medicament. In one embodiment, the medicament is for treatment of cancer. In a further embodiment, the medicament is for use in a method of treating cancer comprising administering to an individual having cancer an effective amount of the medicament. In a further embodiment, the medicament is for inducing apoptosis in a cancer cell/or inhibiting cancer cell proliferation. In a further embodiment, the medicament is for use in a method of inducing apoptosis in a cancer cell/or inhibiting cancer cell proliferation in an individual suffering from cancer comprising administering to the individual an amount effective of the medicament to induce apoptosis in a cancer cell/or to inhibit cancer cell proliferation. An individual according to any of the above embodiments may be a human.
(221) In a further aspect, the invention provides a method for treating cancer. In one embodiment, the method comprises administering to an individual having cancer an effective amount of an bispecific HER3/HER2 antibody. An individual according to any of the above embodiments may be a human.
(222) In a further aspect, the invention provides a method for inducing apoptosis in a cancer cell/or inhibiting cancer cell proliferation in an individual suffering from cancer. In one embodiment, the method comprises administering to the individual an effective amount of an bispecific HER3/HER2 antibody or an immunoconjugate of the bispecific HER3/HER2 antibody conjugated to a cytotoxic compound to induce apoptosis in a cancer cell/or to inhibit cancer cell proliferation in the individual suffering from cancer. In one embodiment, an individual is a human.
(223) In a further aspect, the invention provides pharmaceutical formulations comprising any of the bispecific HER3/HER2 antibodies provided herein, e.g., for use in any of the above therapeutic methods. In one embodiment, a pharmaceutical formulation comprises any of the bispecific HER3/HER2 antibodies provided herein and a pharmaceutically acceptable carrier.
(224) An antibody of the invention (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
(225) Antibodies of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. The antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
(226) For the prevention or treatment of disease, the appropriate dosage of an antibody of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 g/kg to 15 mg/kg (e.g. 0.5 mg/kg-10 mg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. One typical daily dosage might range from about 1 g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs. One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg. Thus, one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient. Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the antibody). An initial higher loading dose, followed by one or more lower doses may be administered. An exemplary dosing regimen comprises administering an initial loading dose of about 4 mg/kg, followed by a weekly maintenance dose of about 2 mg/kg of the antibody. However, other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
(227) It is understood that any of the above formulations or therapeutic methods may be carried out using an immunoconjugate of the invention in place of or in addition to an anti-HER3(and anti-HER4) antibody.
III. Articles of Manufacture
(228) In another aspect of the invention, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an antibody of the invention. The label or package insert indicates that the composition is used for treating the condition of choice. Moreover, the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
(229) It is understood that any of the above articles of manufacture may include an immunoconjugate of the invention in place of or in addition to an anti-HER3 (and anti-HER4) antibody.
(230) Description of the Amino Acid Sequences
(231) SEQ ID NO: 1 -Hairpin of human HER3 SEQ ID NO: 2 -Hairpin of human HER4 SEQ ID NO: 3 human HER3 SEQ ID NO: 4 human HER3 Extracellular Domain (ECD) SEQ ID NO: 5 human HER4 SEQ ID NO: 6 human HER4 Extracellular Domain (ECD) SEQ ID NO: 7 human HER1 SEQ ID NO: 8 human HER1 Extracellular Domain (ECD) SEQ ID NO: 9 human HER2 SEQ ID NO: 10 human HER2 Extracellular Domain (ECD) SEQ ID NO: 11 Human Heregulin fragment (HRG) SEQ ID NO: 12 Human Heregulin -1 fragment (as provided from Preprotech) SEQ ID NO: 13 TtSlyD-FKBP-Her3 SEQ ID NO: 14 TtSlyD-Wildtype SEQ ID NO: 15 TtSlyDcas SEQ ID NO: 16 TgSlyDIF SEQ ID NO: 17 TtSlyDcas-Her3 SEQ ID NO: 18 TtSlyDcys-Her3 SEQ ID NO: 19 TgSlyDser-Her3 SEQ ID NO: 20 TgSlyDcys-Her3 SEQ ID NO: 21 TtSlyDcas-Her4 SEQ ID NO: 22 TtSlyDcys-Her4 SEQ ID NO: 23 TgSlyDser-Her4 SEQ ID NO: 24 TgSlyDcys-Her4 SEQ ID NO: 25 heavy chain HVR-H1, M-05-74 SEQ ID NO: 26 heavy chain HVR-H2, M-05-74 SEQ ID NO: 27 heavy chain HVR-H3, M-05-74 SEQ ID NO: 28 light chain HVR-L1, M-05-74 SEQ ID NO: 29 light chain HVR-L2, M-05-74 SEQ ID NO: 30 light chain HVR-L3, M-05-74 SEQ ID NO: 31 heavy chain variable domain VH, M-05-74 SEQ ID NO: 32 light chain variable domain VL, M-05-74 SEQ ID NO: 33 humanized variant A of heavy chain variable domain VH, M-05-74_VH-A SEQ ID NO: 34 humanized variant B of heavy chain variable domain VH, M-05-74_VH-B SEQ ID NO: 35 humanized variant 3 of heavy chain variable domain VH, M-05-74_VH-C SEQ ID NO: 36 humanized variant A of heavy chain variable domain VH, M-05-74_VH-D SEQ ID NO: 37 humanized variant B of heavy chain variable domain VH, M-05-74_VH-E SEQ ID NO: 38 humanized variant A of light chain variable domain VL, M-05-74_VL-A SEQ ID NO: 39 humanized variant B of light chain variable domain VL, M-05-74_VL-B SEQ ID NO: 40 humanized variant C of light chain variable domain VL, M-05-74_VL-C SEQ ID NO: 41 humanized variant D of light chain variable domain VL, M-05-74_VL-D SEQ ID NO: 42 humanized variant E of light chain variable domain VL, M-05-74_VL-E SEQ ID NO:43 binding epitope within -hairpin of human HER3 SEQ ID NO:44 binding epitope within -hairpin of human HER4 SEQ ID NO:45 Pseudomonas exotoxin variant PE24LR8M 3_G (including a GGG linker) SEQ ID NO:46 Light chain of M-05-74 (M-05-74_LC) SEQ ID NO:47 Heavy chain of M-05-74 HC with sortase tag (M-05-74_HC) SEQ ID NO:48 Heavy chain of M-05-74 HC conjugated to Pseudomonas exotoxin variant PE24LR8M (Fab-074-PE heavy chain 1) SEQ ID NO:49 Heavy chain of M-05-74 HC conjugated to Pseudomonas exotoxin variant PE24LR8M (Fab-074-PE heavy chain 2) as direct PE24LR8M fusion SEQ ID NO: 50 soluble S. aureus sortase A SEQ ID NO: 51 heavy chain variable domain VH, <Her3> M-08-11 SEQ ID NO: 52 light chain variable domain VL, <Her3> M-08-11 SEQ ID NO: 53 human kappa light chain constant region SEQ ID NO: 54 human lambda light chain constant region SEQ ID NO: 55 human heavy chain constant region derived from IgG1 SEQ ID NO: 56 human heavy chain constant region derived from IgG1 mutated on L234A and L235A SEQ ID NO: 57 human heavy chain constant region derived from IgG1 mutated on L234A, L235A and P329G SEQ ID NO: 58 human heavy chain constant region derived from IgG4 SEQ ID NO: 59 domain II of human HER2 SEQ ID NO: 60 heavy chain HVR-H1, pertuzumab SEQ ID NO: 61 heavy chain HVR-H2 pertuzumab SEQ ID NO: 62 heavy chain HVR-H3, pertuzumab SEQ ID NO: 63 light chain HVR-L1, pertuzumab SEQ ID NO: 64 light chain HVR-L2, pertuzumab SEQ ID NO: 65 light chain HVR-L3 pertuzumab SEQ ID NO: 66 heavy chain variable domain VH, pertuzumab SEQ ID NO: 67 light chain variable domain VL, pertuzumab SEQ ID NO: 68 heavy chain 1, bispecific HER3/HER2 antibody DIBPERT SEQ ID NO: 69 light chain 1, bispecific HER3/HER2 antibody DIBPERT SEQ ID NO: 70 heavy chain 2, bispecific HER3/HER2 antibody DIBPERT SEQ ID NO: 71 light chain 2, bispecific HER3/HER2 antibody DIBPERT
(232) The following examples and figures are provided to aid the understanding of the present invention, the true scope of which is set forth in the appended claims. It is understood that modifications can be made in the procedures set forth without departing from the spirit of the invention. The disclosures of all patent and scientific literature cited herein are expressly incorporated by reference in their entirety.
In the Following Several Embodiments of the Invention are Listed
(233) 1. Use of at least one polypeptide selected from the group consisting of:
(234) TABLE-US-00012 SEQIDNO:13 TtSlyD-FKBP-Her3, SEQIDNO:17 TtSlyDcas-Her3, SEQIDNO:18 TtSlyDcys-Her3, SEQIDNO:19 TgSlyDser-Her3, and SEQIDNO:20 TgSlyDcys-Her3, which comprises the amino acid sequence of SEQ ID NO:1; in a method for selecting an antibody that binds to human HER3 for use in the generation of a bispecific HER3/HER2 antibody, wherein the HER3 antibody binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) of human HER3; and such HER3 antibody is then used to generate a bispecific HER3/HER2 antibody. 2. An isolated bispecific antibody which to human HER3 and to human HER2, wherein the antibody binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide selected from the group consisting of:
(235) TABLE-US-00013 SEQIDNO:13 TtSlyD-FKBP-Her3, SEQIDNO:17 TtSlyDcas-Her3, SEQIDNO:18 TtSlyDcys-Her3, SEQIDNO:19 TgSlyDser-Her3, and SEQIDNO:20 TgSlyDcys-Her3. 3. An isolated bispecific antibody which to human HER3 and to human HER2, wherein the antibody binds within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3). 4. An isolated bispecific antibody that binds to the beta-hairpin of human HER3 (SEQ ID NO: 1) and that binds to domain II of human HER2 (SEQ ID NO: 59). 5. An isolated bispecific antibody which to human HER3 and to human HER2, wherein the antibody binds to human HER3 within an amino acid sequence of PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) which is comprised in a polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) and wherein the antibody binds to domain II of human HER2 (SEQ ID NO: 59). 6. An isolated bispecific antibody which antibody binds to the polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) which comprises the amino acid sequence PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and which antibody binds to domain II of human HER2 (SEQ ID NO: 59). 7. An isolated bispecific antibodies that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that binds to the same epitope on human HER2 as pertuzumab. 8. An isolated bispecific antibody which antibody binds to the polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) which comprises the amino acid sequence PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and which antibody binds to the same epitope on human HER2 as pertuzumab. 9. An isolated bispecific antibodies that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that competes for binding to human HER2 with pertuzumab. 10. An isolated bispecific antibody which antibody binds to the polypeptide of SEQ ID NO: 18 (TtSlyDcys-Her3) which comprises the amino acid sequence PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and which antibody competes for binding to human HER2 with pertuzumab. 11. An isolated bispecific antibodies that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that binds to human HER2 and comprises all six heavy and light chains HVRs of pertuzumab (SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, and SEQ ID NO: 65). 12. An isolated bispecific antibodies that binds to the beta-hairpin of human HER3 PQPLVYNKLTFQLEPNPHT (SEQ ID NO:1) and that binds to human HER2 and comprises the VH and VL of pertuzumab (SEQ ID NO: 66 and SEQ ID NO. 67). 13. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments that binds also to human HER4. 14. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments that binds also to the beta-hairpin of human HER4 PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2). 15. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments that binds also to the polypeptide of SEQ ID NO: 22 (TtSlyDcys-Her4) which comprises the amino acid sequence PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2). 16. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments that does not crossreact with human HER4. 17. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments that does not crossreact with the beta-hairpin of human HER4 PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2). 18. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments that does not crossreact with the polypeptide of SEQ ID NO: 22 (TtSlyDcys-Her4) which comprises the amino acid sequence PQTFVYNPTTFQLEHNFNA (SEQ ID NO:2). 19. An isolated bispecific antibody a) that binds to human HER3 and comprises the heavy chain HVRs of SEQ ID NO: 25 heavy chain HVR-H1, M-05-74, SEQ ID NO: 26 heavy chain HVR-H2, M-05-74, and SEQ ID NO: 27 heavy chain HVR-H3, M-05-74, and comprises the light chain heavy chain HVRs of SEQ ID NO: 28 light chain HVR-L1, M-05-74, SEQ ID NO: 29 light chain HVR-L2, M-05-74, and SEQ ID NO: 30 light chain HVR-L3, M-05-74; and b) that binds to human HER2 and comprises the heavy chain HVRs of SEQ ID NO: 60 heavy chain HVR-H1, pertuzumab, SEQ ID NO: 61 heavy chain HVR-H2 pertuzumab, SEQ ID NO: 62 heavy chain HVR-H3, pertuzumab, and comprises the light chain heavy chain HVRs of SEQ ID NO: 63 light chain HVR-L1, pertuzumab, SEQ ID NO: 64 light chain HVR-L2, pertuzumab, and SEQ ID NO: 65 light chain HVR-L3 pertuzumab. 20. An isolated bispecific antibody a) that binds to human HER3 and comprises i) a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:33 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:41, ii) a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:33 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:39, or iii) a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:33 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:42; and b) that binds to human HER2 and a variable heavy chain domain VH with the amino acid sequence of SEQ ID NO:66 and a variable light chain domain VL with the amino acid sequence of SEQ ID NO:67. 21. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments wherein the bispecific antibody is bivalent. 22. An isolated nucleic acid encoding the bispecific HER3/HER2 antibody according to any one of the preceding embodiments. 23. A host cell comprising the nucleic acid of embodiment 22. 24. A method of producing the bispecific HER3/HER2 antibody according to any one of the preceding embodiments comprising culturing such host cell so that the antibody is produced. 25. The method of embodiment 24 which further comprises recovering such antibody from the host cell. 26. An immunoconjugate comprising the bispecific HER3/HER2 antibody according to any one of the preceding embodiments and a cytotoxic agent. 27. A pharmaceutical formulation comprising The bispecific HER3/HER2 antibody according to any one of the preceding embodiments and a pharmaceutically acceptable carrier 28. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments for use as a medicament. 29. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments, or the immunoconjugate comprising the bispecific HER3/HER2 antibody and a cytotoxic agent, for use in treating cancer. 30. The bispecific HER3/HER2 antibody according to any one of the preceding embodiments for use in inhibition of HER3/HER2 dimerization and/or HER2/HER2 dimerization. 31. Use of the bispecific HER3/HER2 antibody according to any one of the preceding embodiments, or an immunoconjugate comprising the bispecific HER3/HER2 antibody and a cytotoxic agent, in the manufacture of a medicament. 32. Use of embodiment 31 wherein the medicament is for treatment of cancer. 33. Use of embodiment 31 wherein the medicament is for the inhibition of HER3/HER2 dimerization and/or HER2/HER2 dimerization. 34. A method of treating an individual having cancer comprising administering to the individual an effective amount of the bispecific HER3/HER2 antibody according to any one of the preceding embodiments, or an immunoconjugate comprising the bispecific HER3/HER2 antibody and a cytotoxic agent. 35. A method of inhibiting growth of a tumor cell in an individual suffering from cancer comprising administering to the individual an effective amount of the bispecific HER3/HER2 antibody according to any one of the preceding embodiments, thereby inhibiting growth of a tumor cell in the individual.
EXAMPLES
(236) Materials & General Methods
(237) Recombinant DNA Techniques
(238) Standard methods were used to manipulate DNA as described in Sambrook, J. et al., Molecular Cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. The molecular biological reagents were used according to the manufacturer's instructions.
(239) Gene Synthesis
(240) Desired gene segments were prepared from oligonucleotides made by chemical synthesis. The 400-1600 bp long gene segments, which were flanked by singular restriction endonuclease cleavage sites, were assembled by annealing and ligating oligonucleotides including PCR amplification and subsequently cloned via the indicated restriction sites e.g. EcoRI/BlpI or BsmI/XhoI into the expression vectors described below. The DNA sequences of the subcloned gene fragments were confirmed by DNA sequencing. Gene synthesis fragments were ordered according to given specifications at Geneart (Regensburg, Germany).
(241) DNA Sequence Determination
(242) DNA sequences were determined by double strand sequencing performed at Sequiserve GmbH (Vaterstetten, Germany).
(243) DNA and Protein Sequence Analysis and Sequence Data Management
(244) Infomax's Vector NT1 Advance suite version 11.5.0 was used for sequence creation, mapping, analysis, annotation and illustration.
Example 1
(245) Preparation of Antigen and Screening ProteinsGeneration of Functional -Hairpin HER3 and -Hairpin HER4 Constructs for Selecting Antibodies Binding to the -Hairpin of HER3 and the -Hairpin of HER4
(246) To generate functional -Hairpin HER3 and HER4 constructs, the amino acid sequences of the -Hairpins of HER3 (SEQ ID NO: 1) and HER4 (SEQ ID NO: 2), were grafted into a SlyD polypeptide framework comprising a FKBP domain. In such constructs the grafted -Hairpins are freely accessible in contrast to the hidden structure in the native unactivated conformation of HER3 or HER4 (in the absence of ligand as e.g. HRG) (see
(247) All fused SlyD polypeptides can be purified and refolded by using almost identical protocols. E. coli BL21 (DE3) cells transformed with the particular expression plasmid were grown at 37 C. in LB medium containing the respective antibiotic for selective growth (Kanamycin 30 g/ml, or Ampicillin (100 g/ml)) to an OD600 of 1.5, and cytosolic overexpression was induced by adding 1 mM isopropyl--D-thiogalactoside (IPTG). Three hours after induction, cells were harvested by centrifugation (20 min at 5,000 g), frozen and stored at 20 C. For cell lysis, the frozen pellet was resuspended in chilled 50 mM sodium phosphate buffer (pH 8.0) supplemented with 7 M GdmCl and 5 mM imidazole. Thereafter the suspension was stirred for 2-10 hours on ice to complete cell lysis. After centrifugation (25,000 g, 1 h) and filtration (cellulose nitrate membrane, 8.0 m, 1.2 m, 0.2 m), the lysate was applied onto a Ni-NTA column equilibrated with the lysis buffer. In the subsequent washing step the imidazole concentration was raised to 10 mM (in 50 mM sodium phosphate buffer (pH 8.0) comprising 7 M GdmCl) and 5 mM TCEP was added in order to keep the thiol moieties in a reduced form and to prevent premature disulfide bridging. At least 15 to 20 volumes of the reducing washing buffer were applied. Thereafter, the GdmCl solution was replaced by 50 mM sodium phosphate buffer (pH 8.0) comprising 100 mM NaCl, 10 mM imidazole, and 5 mM TCEP to induce conformational refolding of the matrix-bound SlyD fusion polypeptide. In order to avoid reactivation of co-purifying proteases, a protease inhibitor cocktail (Complete EDTA-free, Roche) was added to the refolding buffer. A total of 15 to 20 column volumes of refolding buffer were applied in an overnight procedure. Thereafter, both TCEP and the Complete EDTA-free inhibitor cocktail were removed by washing with 10 column volumes 50 mM sodium phosphate buffer (pH 8.0) comprising 100 mM NaCl and 10 mM imidazole. In the last washing step, the imidazole concentration was raised to 30 mM (10 column volumes) in order to remove tenacious contaminants. The refolded polypeptide was then eluted by applying 250 mM imidazole in the same buffer. Protein-containing fractions were assessed for purity by Tricine-SDS-PAGE (Schaegger, H. and von Jagow, G., Anal. Biochem. 166 (1987) 368-379). Subsequently, the protein was subjected to size-exclusion-chromatography (Superdex HiLoad, Amersham Pharmacia) using potassium phosphate as the buffer system (50 mM potassium phosphate buffer (pH 7.0), 100 mM KCl, 0.5 mM EDTA). Finally, the protein-containing fractions were pooled and concentrated in an Amicon cell (YM10) to a concentration of 5 mg/ml. Exemplarily SDS-PAGE analysis of Ni-NTA purification of TtSlyD-FKBP-Her3 is shown in
(248) Table 2: Summary of the amino acid sequences of the developed SlyD-based epitope scaffolds (which carry the HER3 dimerization domain fragment (-Hairpin of HER3 (SEQ ID NO: 1)) as insert or the HER4 dimerization domain fragment (-Hairpin of HER4 (SEQ ID NO: 2)) as insert).
(249) TtSlyD-FKBP-Her3, TtSlyDcas-Her3, TtSlyDcys-Her3, Thermococcus gammatolerans TgSlyDser-Her3 and TgSlyDcys-Her3 carry the Her3 dimerization domain fragment (-Hairpin of HER3 (SEQ ID NO: 1)) as insert and were used as immunogens and as positive controls in ELISA screening.
(250) TtSlyD-Wildtype, TtSlyDcas, TgSlyDIF were used as negative controls in the ELISA screening (without the Her3 dimerization domain fragment (-Hairpin of HER3 (SEQ ID NO: 1)) or the Her4 dimerization domain fragment (-Hairpin of HER4 (SEQ ID NO: 2)) as insert).
(251) TtSlyDcas-Her4, TtSlyDcys-Her4, TgSlyDser-Her4 and TgSlyDcys-Her4 (which carry the Her4 dimerization domain fragment (-Hairpin of HER4 (SEQ ID NO: 2)) as insert) were used in the ELISA screening to check the developed clones for HER4 crossreactivity.
(252) As the epitope scaffolds are expressed in E. coli the N-terminal methionine residue can be present or not. (Nt=N-terminal; Ct=C-terminal)
(253) TABLE-US-00014 TABLE2 TtSlyD- Nt- FKBP- MRSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLE Her3 EALEGREEGEAFQAHVPAEKAYGAGSPQPLVYNKLTFQLEPNP HTKGSSGKDLDFQVEVVKVREATPEELLHGHAHG GGSRKHHHHHHHH-Ct TtSlyD- Nt- Wild- MRGSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGL type EEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDA EVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKD LDFQVEVVKVREATPEELLHGHAHGGGSRKHHHHHHHH-Ct TtSly Nt- Dcas MRSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLE EALEGREEGEAFQAHVPAEKAYGAGSGSSGKDLDFQVEVVKV REATPEELLHGHAHGGGSRKHHHHHHHH-Ct TgSly Nt- DIF MKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEEREY SPIGVTVGAGEIIPGIEEALLGMELGEKKEVVVPPEKGYGATG HPGIIPPHATAIFEIEVVEIKKAGEALEHHHHHHLEHHHHHH- Ct TtSly Nt- Dcas- MRSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLE Her3 EALEGREEGEAFQAHVPAEKAYGAGSPQPLVYNKLTFQLEPNP HTKGSSGKDLDFQVEVVKVREATPEELLHGHAHGGGSRKHHH HHHHH-Ct TtSly Nt- Dcys- MRGSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGL Her3 EEALEGREEGEAFQAHVPAEKAYGPCGPQPLVYNKLTFQLEPN PHTGCGKDLDFQVEVVKVREATPEELLHGHAHGGGSHHHHHH HH-Ct TgSly Nt- Dser- MKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEEREY Her3 SPIGVTVGAGEIIPGIEEALLGMELGEKKEVVVPPEKGYGMPS GPQPLVYNKLTFQLEPNPHTGSAGKTAIFEIEVVEIKKAGEAG GGSRKHHHHHHHH-Ct TgSly Nt- Dcys- MRGSKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEE Her3 REYSPIGVTVGAGEIIPGIEEALLGMELGEKKEVVVPPEKGYG MPCGPQPLVYNKLTFQLEPNPHTGCAGKTAIFEIEVVEIKKAG EAGGGSHHHHHHHH-Ct TtSly Nt- Dcas- MRSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLE Her4 EALEGREEGEAFQAHVPAEKAYGAGSPQTFVYNPTTFQLEHNF NAKGSSGKDLDFQVEVVKVREATPEELLHGHAHGGGSRKHHH HHHHH-Ct TtSly Nt- Dcys- MRGSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGL Her4 EEALEGREEGEAFQAHVPAEKAYGPCGPQTFVYNPTTFQLEHN FNAGCGKDLDFQVEVVKVREATPEELLHGHAHGGGSHHHHHH HH-Ct TgSly Nt- Dser- MKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEEREY Her4 SPIGVTVGAGEIIPGIEEALLGMELGEKKEVVV PPEKGYGMPSGPQTFVYNPTTFQLEHNFNAGSAGKTAIFEIEV VEIKKAGEAGGGSRKHHHHHHHH-Ct TgSly Nt- Dcys- MRGSKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEE Her4 REYSPIGVTVGAGEIIPGIEEALLGMELGEKKEVVVPPEKGYG MPCGPQTFVYNPTTFQLEHNFNAGCAGKTAIFEIEVVEIKKAG EAGGGSHHHHHHHH-Ct
Example 2
(254) a) Immunisation and Selection of HER3 Antibodies
(255) For the generation of antibodies against the -hairpin of HER3 and HER4, Balb/C, NMRI or SJL mice were immunized with different antigens. As antigens the following proteins were used: full length Her3 ECD, or the epitope scaffold proteins TtSlyD-FKBP12-Her3, TtSlyDcys-Her3, TtSlyDcas-Her3, TgSlyDcys-Her3 and TgSlyDser-Her3. The TtSlyD-FKBP12-Her3 variant represents the first generation epitope scaffold, used for generation of Her3 dimerization domain specific antibodies. Although the general principal of using SlyD variants as epitope scaffolds could already be demonstrated using the first generation SlyD-FKBP12 scaffold, improved variants of the scaffold with higher stability were developed. These SlyD variants are derived from Thermos thermophilus and Thermococcus gammatolerans.
(256) All mice were subjected to 3 immunizations at the time points 0, 6 and 10 weeks after start of the immunization campaign. At each time point each mouse was immunized with 100 g endotoxin free immunogen dissolved in 100 l PBS. For the first immunization the immunogen was mixed with 100 l CFA. For the second and third immunization the immunogen was mixed with IFA. The first and the third immunization were applied via the intraperitoneal route, the second immunization was applied subcutaneously. 2 and 3 days prior to the preparation of spleenocyte for antibody development using hybridoma technology, the mice were subjected to intravenous booster immunizations with 12.5 g immunogen in 100 l PBS and without adjuvant.
(257) Titer Analysis
(258) For the determination of serum titers against the respective immunogen and against the screening proteins a small amount of serum of each mouse was collected in week 11 after start of the immunization campaign. For the ELISA the immunogen or the screening scaffold proteins were immobilized on the plate surface. Her3 ECD was immobilized at a concentration of 1 g/ml and the scaffold proteins TtSlyD-FKBP12-Her3, TtSlyD-FKBP12, TtSlyDcys-Her3, TtSlyDcas-Her3, TtSlyDcas, TgSlyDcys-Her3, TgSlyDser-Her3 and TgSlyDIF were used at a concentration of 0.5 g/ml. The scaffold proteins TtSlyDcas and TgSlyDIF were used as negative controls. The sera from each mouse were diluted in PBS with 1% BSA and the dilutions were added to the plates. The sera were tested at dilutions 1:300, 1:900, 1:2700, 1:8100, 1:24300, 1:72900, 1:218700 and 1:656100. Bound antibody was detected with a HRP-labeled F(ab).sub.2 goat anti-mouse Fc (Dianova) and ABTS (Roche) as a substrate.
(259) Even on the level of serum titration it was already obvious that immunized mice developed antibodies against the Her3 -hairpin domain. In mice immunized with Her3 ECD this can be shown by titration against one of the scaffold proteins containing the dimerization -hairpin loop. The strongly reduced signal can be explained by the fact, that the majority of antibodies raised by immunization with Her3 ECD are targeting other parts within the ECD and only a small fraction is binding to the dimerization -hairpin domain. In mice immunized with Her3 dimerization loop containing scaffolds the fraction of antibodies targeting the loop can be shown by titration against Her3 ECD (positive control) and titration against an control scaffold without Her3 insertion (negative control).
(260) b) Antibody Development and ELISA Screening/Selection
(261) The use of the here described epitope scaffold technology offers in principal two strategies for the development of antibodies targeting the Her3 dimerization domain (-Hairpins of HER3 (SEQ ID NO: 1)). One strategy is to immunize with the full length Her3 ECD and to use the scaffolds to screen for the dimerization domain specific antibodies. The other strategy is the direct use of the scaffold for immunization and to use the Her3 ECD, a scaffold with another backbone or a scaffold without insertion for counter screening. Antibodies were developed with hybridoma technology by fusing primary B-cells with P3X63Ag8.653 myeloma cells. 2 days after the final booster immunization, immunized mice were sacrificed and spleen cell populations were prepared. The spleenocytes were fused with P3X63Ag8.653 by using the PEG fusion technology. The cellular batch culture from the fusion was incubated overnight at 37 C. under 5% CO.sub.2. The following day the cellular batch containing fused cells was centrifuged for 10 min at 400 g. Thereafter, the cells were suspended in hybridoma selection media supplemented with 0.1 azaserine-hypoxanthine (Sigma) and were seeded at a concentration of 2.510.sup.4 cells per well in 96 well plates. The plates were cultured for at least 1 week at 37 C. under 5% CO.sub.2. 3 days prior to ELISA analysis the selection media was changed.
(262) Primary culture supernatants were tested in ELISA against Her3 ECD and various scaffold proteins. The testing against the scaffold proteins was done to demonstrate that the selected clones are binding to the dimerization domain -hairpin of native Her3 ECD. The testing against the control scaffolds TtSlyDcas and TgSlyDIF was done to show that the selected clones are binding the inserted Her3 derived sequence and not the scaffold backbone. To check for cross reactivity the resulting clones were tested against the full length ECDs of the other members of the Her family namely, Her1, Her2 and Her4. As shown all selected clones are highly specific for Her3 and a highly specific cross reactivity to HER4 could be detected, while no cross reactivity to other members of the Her family were detected. For the ELISA the screening an antigen down format was used. Her3 ECD was immobilized at a concentration of 1 g/ml and the scaffold proteins TtSlyD-FKBP12-Her3, TtSlyD-FKBP12, TtSlyDcys-Her3, TtSlyDcas-Her3, TtSlyDcas, TgSlyDcys-Her3, TgSlyDser-Her3 and TgSlyDIF were immobilized at a concentration of 0.5 g/ml. Hybridoma Supernatant was added to the plates and incubated for 1 h at room temperature. Bound antibody was detected with a HRP-labeled F(ab).sub.2 goat anti-mouse Fc (Dianova) and ABTS (Roche) was used as a HRP-substrate.
(263) TABLE-US-00015 TABLE 3 Evaluation of the selected clones by ELISA. The clones were tested against the scaffold proteins TtSlyDcas-Her3, TtSlyDcys-Her3, TgSlyDser-Her3 and TgSlyDcys-Her3 and the full length Her3 ECD to verify their Her3 dimerization domain insert (-Hairpin of HER3 (SEQ ID NO: 1)) specificity. As negative controls the scaffold proteins TtSlyDcas and TgSlyDIF were used. Additionally, clones were tested against full length ECDs of Her1, Her2, Her3 and Her4 to verify potential cross reactivity. Clones show binding to full length Her3 ECD and are cross reactive against full length Her4 ECD. TtSlyD- TgSlyD- cas- cys- ser- cys- Her1 Her2 Her3 Her4 Clone cas Her3 Her3 IF Her3 Her3 ECD ECD ECD ECD M-05-74 0.023 3.133 3.150 0.020 3.159 3.159 0.018 0.020 3.152 3.170 M-15-02 0.040 1.763 1.522 0.040 1.980 1.785 0.024 0.025 3.153 3.192 M-15-03 0.045 1.772 1.850 0.039 1.628 1.461 0.020 0.024 3.171 3.234 M-15-04 0.040 1.847 1.457 0.033 1.833 1.500 0.067 0.064 3.175 3.186 M-15-05 0.041 1.443 1.482 0.046 1.886 1.485 0.020 0.021 3.156 3.216 M-15-08 0.041 1.569 1.707 0.040 1.746 1.532 0.019 0.023 3.195 3.181 M-15-09 0.057 1.870 1.929 0.076 1.799 1.640 0.024 0.037 3.234 3.200 M-15-11 0.044 1.714 1.636 0.056 2.005 1.693 0.029 0.031 3.103 3.218 M-16-01 0.039 1.653 1.793 0.037 1.860 1.637 0.024 0.032 3.184 3.212
c) Immunohistochemistry
(264) All selected clones were tested for reactivity and specificity in IHC. Therefore HEK293 cells were transiently transfected with plasmids coding for full length HER1, HER2, HER3 or HER4, respectively. 2 days after transfection the different cell lines now expressing HER1, HER2, HER3 or HER4 were harvested, subsequently fixed in formalin and embedded in Agarose for generation of IHC controls. After an additional fixation in formalin overnight the Agarose blocks were embedded in paraffin. Untransfected HEK293 cells were used as negative controls and treated accordingly to the transfected cells. After paraffin embedding 3 m thin sections were prepared using a microtome. The sections were mounted on glass microscopy slides and dried for 2 h. All further steps of the immunohistochemical staining procedure were carried out using a Ventana Benchmark XT. The slides were dewaxed and antigen retrieval was performed by applying heat for 1 hour. For antigen retrieval the Ventana buffer CC1 was used. The antibodies were used at a concentration of 1 g/ml. For the detection of bound antibody the Ventana UltraView detection kit was used. Results are shown in
(265) d) DNA Sequencing of Selected Anti-Her3 Hybridoma
(266) To obtain the DNA sequences of the selected hybridoma clones a 5 Race PCR was conducted. For the RT-PCR total RNA was prepared from 510.sup.6 cells by using a total RNA purification kit (Qiagen). The reverse transcription and the PCR were conducted using a 5prime RACE PCR kit (Roche). The resulting PCR fragments from heavy and light chain were purified by gel electrophoresis and subsequent gel purification. The PCR fragments were cloned using the Topo Zero-Blunt cloning kit (Invitrogen) and transformed into competent cells. Several clones from each hybridoma were submitted for sequencing to obtain a consensus sequences for the selected clones. M-05-74 M-15-02 M-15-04 were submitted for sequencing which resulted in identical VH and VL sequences for all 3 clones. M-15-03, M-15-05, M-15-08, M-15-09, M-15-11, M-16-01 were sequenced analogously and also resulted in identical VH and VL sequences for all clones.
(267) e) Time Dependent Internalization Analyses of M-05-74 Via FACS
(268) Binding and internalization of HER3 by the selected clone M-05-74 to HER3 was analyzed in FACS using the HER3 expressing tumor cell line T47D. 510.sup.5 cells were treated with 50 ng Recombinant Human Heregulin fragment (HRG) (SEQ ID NO: 11). The fragment including amino acid of SEQ ID NO: 11 was cloned in pCDNA.1 vector (Invitrogen). The HRG fragment was expressed in FreeStyle 293-F cells according to the protocol described by Invitrogen. (FreeStyle 293 Expression system Catalog no. K9000-01). Purified HRG fragment was solved in 20 mM Histidin, 140 mM NaCl; pH6.0 and stored by 80 C.
(269) Untreated () cells were used as negative controls. Shortly after Heregulin induced activation, 1 g of M-05-74 was added to the cells. The cells were incubated for 0, 5, 15, 30, 45, 60, 75, 90, 105, 120, 180 or 240 min at 37 C. After incubation the cells were immediately put on ice. The cells were washed with 3 ml FACS buffer once and then stained for 30 minutes with 1 g of a R-Phycoerythrin Goat Anti-Mouse IgG (H+L) secondary antibody. Flow cytometry was carried out using a FACSCanto flow cytometer (BD Biosciences). Results are FACS analysis of M-05-74 induced, time dependent HER3 receptor internalization in T47D cells. M-05-74 shows binding to the expressed HER3 ECD, with or without supplemented recombinant human Heregulin fragment (HRG). M-05-74 leads to Her3 receptor internalization over a 4 h time period. Results are shown in
Example 3
(270) a) Kinetic Screening/Binding Properties of HER3 Antibodies
(271) The kinetic screening was performed according to Schraeml et al. (Schraml, M. and M. Biehl, Methods Mol Biol 901 (2012) 171-181) on a Biacore 4000 instrument, mounted with a Biacore CM5 sensor. In all assay the test antibodies were captured. The system was under the control of the software version V1.1. The instrument buffer was HBS-EP (10 mM HEPES (pH 7.4), 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) P20). The system operated at 25 C. 30 g/ml Rabbit polyclonal antibody (RAM IgG, (Rabbit anti Mouse IgG with Fc gamma specificity) GE Healthcare) in 10 mM sodium acetate buffer (pH 4.5) was immobilized using EDC/NHS chemistry according to the manufacturer's instructions on the spots 1, 2, 4 and 5 in the flow cells 1, 2, 3 and 4. The sensor was saturated using 1M ethanolamine. In each flow cell, referenced signals were calculated using spots 1-2 and spots 5-4, spot 3 served as a blanc control. The antigen (human recombinant Her-3 ECD (68 kDa), and recombinant Thermus thermophilus SlyD FKBP-Her3 (15 kDa) comprising the -hairpin peptide of HER3 (SEQ ID NO:1)) was diluted at 150 nM in instrument buffer supplemented with 1 mg/ml CMD(Carboxymethyldextran, Sigma). to suppress unspecific binding. Prior to their application the hybridoma culture supernatants were diluted 1:5 in instrument buffer. The diluted mixtures were injected at a flow rate of 30 l/min for 2 min. The antibody capture level (CL) in response units was monitored. Immediately thereafter the respective antigen was injected at a flow rate of 30 l/min for 3 min association time. Thereafter, the antibody-antigen complex dissociation signal was recorded for 5 min. The sensor was regenerated by injecting a 10 mM glycine-HCl solution (pH 1.7) for 2 min at a flow rate of 30 l/min. The recorded signal shortly before the end of the injection of the antigen was denoted as binding late (BL) in response units. The recorded signal shortly before the end of the recording of the dissociation is denoted as stability late (SL) in response units. The dissociation rate constants were determined calculated The antibody-antigen complex stability in minutes was calculated with the following formula: ln(2)/60*kd. The Molar Ratio was calculated with the formula: MW (antibody)/MW (antigen) *BL (antigen)/CL (antibody).
(272) Binding Late (BL) represents the response units at the end of the analyte injection. The amount of antibody captured as a ligand on the sensor surface is measured as Capture Level (CL) in response units. Together with the information of the molecular weights of the tested analytes, the antibody and the analyte in solution, the Molar Ratio can be calculated. In case the sensor was configurated with a suitable amount of antibody ligand capture level, each antibody should be able to functionally bind at least to one analyte in solution, which is represented by a Molar Ratio of MR=1.0. Then, the Molar Ratio is also an indicator for the valence mode of analyte binding. The maximum valence can be MR=2 for an antibody binding two analytes, one with each Fab valence. In case of steric limitations or a dysfunctional analyte binding, the Molar Ratio can indicate understoichiometric binding, like it is the case when the Her-3 ECD is being bound in its closed conformation. The maximum assay deviation in the determination of the Molar Ratio is MR=0.2.
(273) Screening/Selection of Anti-HER3/HER4 Antibody M-05-74:
(274) In one experiment, the kinetic screening was driven with hybridoma primary cultures from different fusions, which were obtained from an immunization of mice with human recombinant Her-3 ECD. The aim was to select cultures with binding specificity for the Her-3 heterodimerization domain -hairpin peptide (SEQ ID NO:1). As antigens in solution human recombinant Her-3 ECD (68 kDa), and recombinant Thermus thermophilus SlyD FKBP-Her3 (15 kDa) comprising the -hairpin peptide of HER3 (SEQ ID NO:1) were used. A positive hit was classified as a primary culture supernatant with binding activity versus both antigens.
(275) The Table 4 exemplarily shows primary culture supernatants, from which M-05-74 fulfills these requirements, indicating epitope specificity for the -hairpin of HER3. Therefore this is a suitable method of screening of anti-HER3 antibodies which bind to the Her-3 hairpin of SEQ ID NO:1.
(276) TABLE-US-00016 TABLE 4 Exemplary results obtained from a kinetic screening experiment with a set of hybridoma primary cultures from fusions, wherein antibody M-05-74 was identified as binding to both HER3 ECD and the -hairpin of HER3 (SEQ ID NO: 1) within the thermo SlyD-Her3 construct. binding stability late BL late SL kd t/2 diss T CL MR Ligand Analyte [RU] [RU] [1/s] [min] [ C.] [RU] [] M-04-06 human-Her3-ECD 17 16 4.13E04 28 25 134 0.3 M-04-06 thermo SlyD-Her3 4 4 n.d. n.d. 25 134 0.3 M-04-140 human-Her3-ECD 1 1 n.d. n.d. 25 110 0.0 M-04-140 thermo SlyD-Her3 6 5 n.d. n.d. 25 112 0.5 M-05-20 human-Her3-ECD 32 33 4.98E05 232 25 623 0.1 M-05-20 thermo SlyD-Her3 9 6 n.d. n.d. 25 625 0.1 M-05-30 human-Her3-ECD 122 123 3.74E05 309 25 521 0.5 M-05-30 thermo SlyD-Her3 3 2 n.d. n.d. 25 525 0.1 M-05-44 human-Her3-ECD 55 55 3.42E05 337 25 373 0.3 M-05-44 thermo SlyD-Her3 7 6 n.d. n.d. 25 369 0.2 M-05-74 human-Her3-ECD 75 79 <1.00E05 >1155 25 318 0.5 M-05-74 thermo SlyD-Her3 33 32 1.20E04 96 25 315 1.1 M-05-82 human-Her3-ECD 0 1 n.d. n.d. 25 205 0.0 M-05-82 thermo SlyD-Her3 4 5 n.d. n.d. 25 204 0.2
(277) It has been found that M-05-74 shows a reduced Molar Ratio in its binding to the human Her-3 ECD analyte (MR=0.5), whereas in its binding to analyte Thermus thermophilus SlyD FKBP-Her3 comprising the -hairpin HER3 (SEQ ID NO:1) M-05-74 shows an improved Molar Ratio (MR=1.1), indicating a functional, stoichiometric 1:1 binding with improved epitope accessibility (compared to human Her-3 ECD).
(278) b) Kinetics of HER3 Antibodies M-05-74, M-205 and M-208 Kinetics to Investigate the Mode of Action of M-05-74 in the Absence and Presence of Heregulin (HRG)
(279) In its equilibrium state, the Her-3 ECD is in its closed confirmation, which does mean, the heterodimerization Her-3 beta-hairpin motive is tethered via non-covalent interactions to the Her-3 ECD domain IV (see
(280) A Biacore T100 instrument (GE Healthcare) was used to kinetically assess the monoclonal antibodies for their behavior to the heregulin-activated Her-3 Extracellular Domain (Her3_ECD). A CM5 series sensor was mounted into the system and was normalized in HBS-ET buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% w/v Tween 20) according to the manufacturer's instructions. The sample buffer was the system buffer supplemented with 1 mg/ml CMD (Carboxymethyldextran, Sigma #86524). The system operated at 25 C. 6500 RU RAM-Fc (relative units of Fc-fragment RamIgG, GE Healthcare) were immobilized according to the manufacturer's instructions using EDC/NHS chemistry on all four flow cells. The sensor was deactivated using 1M ethanolamine.
(281) The binding activity of the respective antibody against the analytes was kinetically tested. Antibodies were captured at 35 nM concentration by a 1 min injection at 5 l/min. The flow rate was set to 100 l/min.
(282) The analytes in solution tested were human Heregulin fragment (HRG) (SEQ ID NO:11), a 44 kDa homodimeric protein (prepared according to Example 2e), human recombinant HER2 ECD (SEQ ID NO:10) (69.6 kDa), human recombinant HER3 ECD (SEQ ID NO:4) (68 kDa), human recombinant HER4 ECD (SEQ ID NO:6), and 100 nM of the Her-3 ECD and the Her-4 ECD each incubated with a 5-fold molar excess of Heregulin for 60 min at room temperature resulting in HER3 ECD-HRG complex and HER4 ECD-HRG complex (Addition of MWs for complexes).
(283) Analytes in solution were injected at different concentration steps of 0 nM, 1.1 nM, 3.7 nM, 11.1 nM, 33.1 nM and 90 nM for 3.5 min. The dissociation was monitored for 15 min. Where possible, kinetic signatures were evaluated according to a Langmuir fit.
(284) TABLE-US-00017 TABLE 5a SPR-resolved kinetic data of M-05-74 (=M-074), M-205 and M-208 CL Analyte T k.sub.a k.sub.d K.sub.D K.sub.D BL Chi.sup.2 Antibody RU in solution C. 1/Ms 1/s M nM RU MR RU.sup.2 M-074 535 HRG 25 n.d. n.d. n.d. n.d. n.d. n.d. n.d. M-074 530 HER2_ECD 25 n.d. n.d. n.d. n.d. n.d. n.d. n.d. M-074 648 HER3-ECD 25 1.3E+04 2.8E05 2.2E09 2 70 0.2 0.1 M-074 712 HER4-ECD 25 6.7E+03 1.0E03 1.5E07 150 27 0.1 0.1 M-074 546 HER3- 25 6.3E+04 2.7E04 4.2E09 4 160 0.6 2.3 ECD-HRG M-074 719 HER4- 25 1.6E+05 8.3E04 5.2E09 5 349 0.6 0.0 ECD-HRG M-205 591 HRG 25 n.d. n.d. n.d. n.d. n.d. n.d. n.d. M-205 588 HER2_ECD 25 n.d. n.d. n.d. n.d. n.d. n.d. n.d. M-205 605 HER3-ECD 25 4.9E+04 1.0E04 2.0E09 2 235 1.0 1.3 M-205 597 HER3- 25 3.7E+04 1.2E04 3.2E09 3 164 0.4 0.3 ECD-HRG M-208 777 HRG 25 n.d. n.d. n.d. n.d. n.d. n.d. n.d. M-208 771 HER2_ECD 25 n.d. n.d. n.d. n.d. n.d. n.d. n.d. M-208 822 HER3-ECD 25 5.8E+04 5.3E05 9.1E10 1 367 1.0 9.4 M-208 795 HER3- 25 5.0E+04 1.4E04 2.8E09 3 390 1.1 17.6 ECD-HRG MR = Molar Ratio, BL = Binding Late, CL = Capture Level; n.d. = not detectable = no bindingThe Molar Ratio was calculated with the formula: MW (antibody)/MW(antigen) *BL (antigen)/CL (antibody).
(285) The antibody M-205 is a murine monoclonal antibody with binding activity versus an epitope nearby the Her-3 ECD Heregulin binding site (described as Mab205.10.2 in WO2011/076683). M-205 competes with Heregulin around its binding site on the Her-3 ECD.
(286) The antibody M-208 is a murine monoclonal antibody with binding activity versus the Her-3 ECD domain IV. M-208 binds to the Her-3 ECD independently of the Her-3 ECD conformational state.
(287) M-05-74 (=M-074 in Table 5) binds to the Her-3 ECD in its active open conformation (on the presence of ligand (e.g. heregulin HRG) with improved kinetics, due to a better accessibility of the Her-3 hairpin in its open conformation. The MR is at least two fold higher.
(288) No antibody binding (n.d.) was observed versus the negative control analytes Heregulin beta (HRG) and the extracellular HER-2 domain (HER2_ECD). The tested antibodies showed all binding to the Her3-ECD (HER3_ECD), but with strongly differing BL values.
(289) M-05-74 binds to the Her-3 ECD in its closed conformation with slower association rate constant k.sub.a=1.3E+04 1/Ms and smaller BL (70 RU) than when compared to the clones M-205 with faster k.sub.a=4.9 E+04 1/Ms and high signal amplitude at BL (235 RU) and M-208 with faster k.sub.a=5.8E+04 1/Ms and also high signal amplitude at BL (367RU). This implicates on the stoichiometry of the binding (MR), where M-205 (MR=1.0) and M-208 (MR=1.0) both show a functional 1:1 binding for the HER3-ECD, whereas M-05-74 shows a non-functional binding (MR=0.2). Here it is supposed, that this interaction of M-05-74 versus the Her-3 ECD is residual binding of a portion of structurally handicapped Her-3 ECD analyte. This is also supposed for the interaction of M-05-74 versus the Her-4 ECD, which also shows a non-functional binding with BL (27 RU) and (MR=0.1).
(290) A surprising result is the more than 4-fold increase (nearly 5 fold) of the M-05-74 association rate constant k.sub.a from the closed Her-3 ECD to the open Her-3 ECD/Heregulin complex; from k.sub.a=1.3E+04 1/Ms (Her3 ECD) to k.sub.a=6.3E+04 1/Ms (Her3-ECD-HRG). So M-05-74 binds to HER3-ECD with a ratio of the association constant (K.sub.a) in presence of Heregulin (Ka (+Heregulin)) and absence of Heregulin (Ka (-Heregulin)) of 4.0 or higher (Ka (+Heregulin))/(Ka (Heregulin)=ka (Her3-ECD-HRG)/ka (Her3-ECD)=6.3E+04 [1/Ms]/1.3E+04 [1/Ms])=4.85)). Thereby the Molar Ratio improves 3-fold, indicating now a 1:1 interaction of M-05-74 with the Her-3 ECD Heregulin complex. Thus binds M-05-74 to HER3-ECD with a ratio of the Molar Ratio MR of binding in presence of Heregulin (MR (+Heregulin)) and in absence of Heregulin (MR (Heregulin)) of 3.0 (MR (+Heregulin))/(MR (Heregulin)=0.6/0.2=3).
(291) This is also valid for the Her-4 ECD/Heregulin complex, where the Molar Ratio improves 6-fold, indicating a 1:1 interaction of M-05-74 with the Her-4 ECD Heregulin complex. Thus binds M-05-74 to HER4-ECD with a ratio of the Molar Ratio MR of binding in presence of Heregulin (MR (+Heregulin)) and in absence of Heregulin (MR (Heregulin)) of 3.0 (MR (+Heregulin))/(MR (Heregulin)=0.6/0.1=6). And furthermore surprisingly the M-05-74 association rate constant ka increases from the closed Her-4 ECD to the open Her-4 ECD/Heregulin complex from ka=6.7E+03 1/Ms (Her3_ECD) to ka=1.6E+05 more than 20-fold. So M-05-74 binds to HER4-ECD with a ratio of the association constant (Ka) in presence of Heregulin (Ka (+Heregulin)) and absence of Heregulin (Ka (Heregulin)) of 20.0 or higher (Ka (+Heregulin))/(Ka (Heregulin)=ka (Her4-ECD-HRG)/ka (Her4-ECD)=6.7E+04 [1/Ms]/1.6E+05 [1/Ms])=23.88)).
(292) As expected, the Heregulin displacer M-205, reduces its BLvalue and the Molar Ratio. The Molar Ratio is decreased 2.5-fold, from a fully functional 1:1 interaction with MR=1.0 (Her3-ECD) with 235 RU at BL into a less functional MR=0.4 (Her3-ECD-HRG) with 164 RU at BL. This indicates the loss in functionality due to the competing presence of excess Heregulin.
(293) The antibody M-208, which binds to the Her-3 ECD domain IV remains completely unaffected by the presence of Heregulin. No significiant change of the Molar Ratios MR could be detected.
(294) The
(295) Ia further experiment also HER1 ECD, T.T.SlyD-cysHer3 and T.T.SlyD-cas without the HER3 -hairpin were included in the measurementresults are shown in Table 5b, which substantially reveals the same binding properties of M-05-74.
(296) A Biacore T200 instrument (GE Healthcare) was mounted with a CM5 series sensor. The sensor was normalized in HBS-ET buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.05% w/v Tween 20) according to the manufacturer's instructions. The sample buffer was the system buffer supplemented with 1 mg/ml CMD (Carboxymethyldextran, Sigma #86524). The system operated at 25 C. 6500 RU RAM-Fc (relative units of Fc-fragment RamIgG, GE Healthcare) were immobilized according to the manufacturer's instructions using amine coupling EDC/NHS chemistry on all four flow cells. The sensor was deactivated using 1M ethanolamine. Monoclonal antibodies were captured (CL, Capture Level) on the sensor surface by a 1 min injection at 10 l/min. Concentration dependent kinetics were measured. A concentration series of the analytes HER-1-ECD, HER-2-ECD, HER-3-ECD, HER-4-ECD, T.T.SlyD-cysHer3 and T.T.SlyD-cas were injected each at 0 nM, 1.1 nM, 3.3 nM, 210 nM, 30 nM and 90 nM. Heregulin beta (HRG) was injected at 0 nM, 17 nM, 250 nM, 150 nM and 450 nM, 90 nM HER-3 ECD and 90 nM HER-4 ECD were preincubated for 2 hrs with a five-fold molar excess of HRG beta and were injected at HER concentrations steps of 0 nM, 1.1 nM, 3.3 nM, 210 nM, 30 nM and 90 nM. All analytes were injected for 5 min association time and 10 min dissociation time at 100 l/min flow rate. The sensor capture system was regenerated by a 3 min injection at 10 l/min of 10 mM glycine pH 1.7. Where possible kinetic data was evaluated using the Biacore T200 evaluation software. HER-3-ECD, HER-4-ECD and T.T.SlyD-cysHer3 kinetics were evaluated using a Langmuir fitting model. HER-3-ECD-HRG and HER-4-ECD-HRG kinetics of M-5-74, were evaluated according to a Langmuir fitting model.
(297) TABLE-US-00018 TABLE 5b SPR-resolved kinetic data of M-05-74 CL Analyte (Ab) k.sub.a kd K.sub.D RMax Chi.sup.2 T Antibody in solution RU 1/Ms 1/s M RU MR RU.sup.2 C. M-5-74 HER1-ECD 288 n.d. n.d. n.d. 1 n.d. 0 25 HER2-ECD 287 n.d. n.d. n.d. 1 n.d. 0 HER3-ECD 289 9.6E+04 1.1E04 1.1E09 19 0.1 0.05 HER4-ECD 285 1.6E+04 8.2E04 5.1E08 13 0.1 0.01 HER3- 312 1.0E+05 2.9E04 2.8E09 195 0.8 2.2 ECD-HRG HER4- 301 9.9E+04 8.1E04 8.1E09 179 0.8 1.8 ECD-HRG HRG 301 n.d. n.d. n.d. 0 n.d. 0.0 T.T.SlyD- 486 3.0E+04 2.4E04 7.8E09 88 1.9 0.02 cysHer3 T.T.SlyD- 490 n.d. n.d. n.d. 0.5 0.0 0.06 cas MR = Molar Ratio, BL = Binding Late, CL = Capture Level; n.d. = not detectable = no bindingM-05-74 binds HER-3-ECD-HRG and HER-4-ECD-HRG with 1:1 stoichiometry and inactive HER-3-ECD and HER-4-ECD with 10:1 stoichiometry. M-05-74 binds HER-3-ECD and HER-3-ECD-HRG with higher affinity than HER-4-ECD and HER-4-ECD-HRG. M-05-74 does not interact with HER-1, HER-2 and HRG. M-05-74 binds T.T.SlyD-cysHer3 with 1:2 stoichiometry and does not interact with T.T.SlyD-cas.
Example 4
(298) Epitope Mapping of Anti-HER3 Antibody M-05-74 and Mode of Action Analysis
(299) M-05-74 with a Unique Epitope (-Hairpin of HER3 and HER4)
(300) A Biacore 2000 (GE Healthcare) instrument was used to assess the accessible epitopes clone culture supernatants for their binding specificity. A CM5 sensor was mounted into the system and was normalized in HBS-ET buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% w/v Tween 20) according to the manufacturer's instructions. The sample buffer was the system buffer supplemented with 1 mg/ml CMD (Carboxymethyldextran, Sigma). The system operated at 37 C. 10000 RU RAM-Fc (relative units of Fc-fragment Rabbit Anti-Mouse IgG/Jackson Laboratories) were immobilized according to the manufacturer's instructions using EDC/NHS chemistry on all four flow cells. The sensor was deactivated using 1M ethanolamine.
(301) At a flow rate of 10 l/min the primary antibody 50 nM anti-HER3 M-05-74 was captured for 1 min on all flow cells. The flow rate was set to 30 l/min and an IgG blocking solution (50 g/ml IgG (20:2:1 IgG1-Fc, IgG2a-Fc, IgG2b), Roche) was injected for 5 minutes. The antigen Her-3 ECD was injected at 1.5 M for 3 min.
(302) Afterwards, 100 nM of each anti-HER3 secondary antibodies (a) M-05-74 b) 8B8 from WO97/35885 (named GT in the Figure) c) M-208 which binds to domainIV of HER3, and d) M-08-11; another HER3 -Hairpin binder with no HER4 ECD and HER4 -hairpin crossreactivity) was injected for 3 minutes at 30 l/min. Acidic regeneration of the sensor surface was achieved using three consecutive injections of 10 mM Glycine pH 1.7 at 30 l/min for 60 sec.
(303) The noise of the measurement is defined by the rebinding of the secondary M-05-74 injection, which re-saturates the already dissociated primary M-05-74. The experiment showed (see
(304) Nevertheless M-08-11 binds to a different epitope than M-05-74 as M-08-11 does not bind to human HER4 ECD and HER4 -hairpin. (see also below the exact epitope mapping data with the -hairpins of HER3 and HER4). The 8B8 (=GT) secondary antibody produces a significant signal in the presence of M-05-74, which is above noise. Therefore the 8B8 (=GT) antibody binds another epitope than M-05-74 and M-08-11.
(305) M-05-74 with Unique Epitope and Mode of Actions
(306) A Biacore B3000 instrument (GE Healthcare) was used to kinetically assess the clone culture M-05-74 and the antibody 8B8 (from WO 97/35885, named GT in the Figures) to the closed conformation of Her-3 ECD and the open, Heregulin-activated Her-3 ECD. A CM5 series sensor was mounted into the system and was normalized in HBS-ET buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% w/v Tween 20) according to the manufacturer's instructions. The sample buffer was the system buffer supplemented with 1 mg/ml CMD (Carboxymethyldextran). The system operated at 25 C. 10000 RU RAM-Fc (relative units of Fc-fragment Rabbit Anti-Mouse IgG/Jackson Laboratories) were immobilized according to the manufacturer's instructions using EDC/NHS chemistry on all flow cells. The sensor was deactivated using 1M ethanolamine. Analytes in solution were injected at 100 l/min at different concentration steps of 0 nM, 1.1 nM, 3.7 nM, 11.1 nM, 33.1 nM and 90 nM for 2 min. The dissociation was monitored for 5 min. Acidic regeneration of the sensor surface was achieved using three consecutive injections of 10 mM Glycine pH 1.7 at 30 l/min for 60 sec. Kinetic data were evaluated according to a Langmuir fit.
(307) TABLE-US-00019 TABLE 6 Langmuir kinetics of M-05-74 in comparison to 8B8 (GT). 8B8 with lower antigen complex stability (t/2diss) and less functionality (MR). CL Analyte in T ka t/2-diss BL Chi.sup.2 Antibody (RU) solution ( C.) (1/Ms) (min) (RU) MR (RU.sup.2) 8B8 339.3 ECD-HRG 25 3.21E+05 0.8 90 0.4 2.57 M-074 314.7 ECD-HRG 25 6.6E+04 18 199 0.8 0.773 8B8 347.3 Her-3 ECD 25 1.02E+05 5.3 13.1 0.1 0.12 M-074 318.2 Her-3 ECD 25 2.04E+04 28 36 0.2 0.122 8B8 476.1 ttSlyD-Her3 25 n.d. n.d. n.d. n.d. n.d. M-074 468 ttSlyD-Her3 25 8.75E+04 4.9 68.1 1.5 0.174 MR = Molar Ratio, BL = Binding Late, CL = Capture Level
(308) In the table above kinetic data of the antibody clone M-05-74 and the antibody 8B8 are listed. M-05-74 binds to the Heregulin-activated Her-3 ECD with high functionality MR=0.8. M-05-74 and acts as Heregulin trap. (see also Biacore sensogram Example 3b and
(309) The complex stability of the 8B8 antibody with t1/2 diss=0.8 min is weak. 8B8 binds with an, MR=0.4. No separated dissociation phases of the 8B8 antibody and the Heregulin dissociation can be identified. Heregulin completely dissociates off in the same timeframe and with the same velocity, like 8B8. 8B8 antibody does not delay the heregulin dissociation.
(310) M-05-74 functionally binds (MR=1.5) to the Thermus thermophilus SlyD FKBP-Her3 comprising th HER3 -Hairpin of SEQ ID NO:1 with KD=27 nM. Since the antibody 8B8 does not bind to the HER3 -Hairpin comprising Thermus thermophilus SlyD FKBP-Her-3 fusion polypeptide this antibody targets another epitope than M-05-74.
(311)
(312) In
(313) Peptide-Based 2D Epitope Mapping
(314) In another embodiment a peptide-based epitope mapping experiment was done to characterize the Her-3 ECD epitopes by using the CelluSpots Synthesis and Epitope Mapping technology. Epitope mappings were carried out by means of a library of overlapping, immobilized peptide fragments (length: 15 amino acids) corresponding to the sequences of human Her-1 ECD, Her-2 ECD,Her-3 ECD and Her-4 ECD peptide hairpins. In
(315) Each peptide synthesized was shifted by one amino acid, i.e. it had 14 amino acids overlap with the previous and the following peptide, respectively. For preparation of the peptide arrays the Intavis CelluSpots technology was employed. In this approach, peptides are synthesized with an automated synthesizer (Intavis MultiPep RS) on modified cellulose disks which are dissolved after synthesis. The solutions of individual peptides covalently linked to macromolecular cellulose are then spotted onto coated microscope slides. The CelluSpots synthesis was carried out stepwise utilizing 9-fluorenylmethoxycarbonyl (Fmoc) chemistry on amino-modified cellulose disks in a. 384-well synthesis plate. In each coupling cycle, the corresponding amino acids were activated with a solution of DIGHOBt in DMF. Between coupling steps un-reacted amino groups were capped with a mixture of acetic anhydride, diisopropylethyl amine and 1-hydroxybenzotriazole. Upon completion of the synthesis, the cellulose disks were transferred to a 96-well plate and treated with a mixture of trifluoroacetic acid (TEA), dichloromethane, triisoproylsilane (TIS) and water for side chain deprotection. After removal of the cleavage solution, the cellulose bound peptides are dissolved with a mixture of TFA, TFMSA, TIS and water, precipitated with diisopropyl ether and re-suspended in DMSO. The peptide solutions were subsequently spotted onto Intavis CelluSpots slides using an Intavis slide spotting robot.
(316) For epitope analysis, the slides prepared as described above were washed with ethanol and then with Tris-buffered saline (TBS; 50 mM Tris, 137 mM NaCl, 2.7 mM KCl, pH 8) before blocking for 16 h at 4 C. with 5 mL 10 Western Blocking Reagent (Roche Applied Science), 2.5 g sucrose in TBS, 0.1% Tween 20. The slide was washed with TBS and 0.1% Tween 20 and incubated afterward with 1 g/mL of the corresponding IGF1 antibodies in TBS and 0.1% Tween 20 at ambient temperature for 2 h and subsequently washed with TBS+0.1% Tween 20. For detection, the slide was incubated with anti-rabbit/anti-mouse secondary HRP-antibody (1:20000 in TBS-T) followed by incubation with chemiluminescence substrate luminol and visualized with a Lumilmager (Roche Applied Science). ELISA-positive SPOTs were quantified and through assignment of the corresponding peptide sequences the antibody binding epitopes were identified.
(317) As depicted in
(318) In
Example 5
(319) Binding of HRG to HER3-ECD in the Presence of HER3 Antibody (ELISA)
(320) A Streptavidin-coated 96-well plate was incubated at 4 C. with cell culture supernatant containing SBP-tagged HER3-ECD. On the next day the wells were washed three times with washing buffer (PBS+0.05% Tween-20) and blocked with PBS containing 1% BSA for one hour. After another three washes with washing buffer, 40 l antibody solution (in Delfia Binding Buffer) was added to each well as a 2 stock of the desired final concentrations (10.sup.3 to 10.sup.3 nM, alternatively 10.sup.4 to 10.sup.2 nM). Immediately 40 l of 20 nM Europium-labeled Heregulin-beta (PeproTech, Cat. #100-03) was added to achieve a final concentration of 10 nM. The plates were incubated on a shaker at room temperature for two hours. Following three washes with Delfia Wash Buffer, Delfia Enhancement Solution was added and incubated on a shaker for 15 minutes (light protected). Finally, the plates were measured in a Tecan Infinite F200 reader using a time-resolved fluorescence measurement protocol. The binding of M-05-74 (named M-074 in
Example 6
(321) a) Inhibition of HER3 Phosphorylation in ZR-75-1 Cells
(322) Assays were performed in ZR-75-1 cells according to the following protocol: Seed cells with 500,000 cells/well into Poly-D-Lysine coated 6-well plate in RPMI1640 medium with 10% FCS. Incubate for 24 h. Remove medium by aspirating, incubate overnight with 500 l/well RPMI 1640 with 0.5% FCS. Add antibodies in 500 l RPMI 1640 with 0.5% FCS. Incubate for 1 h. Add Heregulin-beta (PeproTech, Cat. #100-03)) (final concentration 500 ng/ml) for 10 min. To lyse the cells remove medium and add 80 l ice cold Triton-X-100 cell lysis buffer and incubate for 5 minutes on ice. After transferring the lysate into 1.5 ml reaction tube and centrifugation at 14000 rpm for 15 min at 4 C., transfer supernatant into fresh reaction tubes. Samples containing equal amounts of protein in SDS loading buffer were separated on SDS PAGE and blotted by using a semi-dry Western Blot to nitrocellulose membranes. Membranes were blocked by 1NET-buffer+0.25% gelatine for 1 h hour and pHER3 is detected by the antibody Phospho-HER3/ErbB3 (Tyr1289) (21D3), Cell Signaling, #4791 and HER3 by the antibody ErbB3 (C-17), Santa Cruz, # sc-285 respectively. After washing and detection of the signals by an POD coupled secondary antibody, bands were densometricaly scanned. Percent (%) inhibition of anti-HER3 antibodies M-05-74 on receptor phosphorylation in zr-75-1 cells is shown below in Table 7.
(323) TABLE-US-00020 TABLE 7 % Inhibition of HER3 phosphorylation in ZR-75-1 cells pHER3 % inhibition antibody [10 g/ml] Ctrl 0 M-05-74 49
b) Inhibition of HER3 Phosphorylation of the Bivalent Parent M-05-74 and the Fab Fragment of M-05-74 (Fab-74)
(324) MCF-7 cells were seeded into 24-Well-plates (1 ml RPMI, 10% FCS, 3105 cells per well) and were incubated at 37 C./5% CO2 overnight. After 24 hours the media was replaced with 1 ml media containing 0.5% FCS. After 48 hours the antibodies were added to a final concentration of 10 g/ml, 1 g/ml and 0.1 g/ml (M-05-74) and 6.66 g/ml, 0.66 g/ml and 0.066 g/ml (Fab-074). The plates were incubated at 37 C. for 50 minutes and then Heregulin-beta (PeproTech, Cat. #100-03) was added to a final concentration of 500 ng/ml. The plates were incubated for a further 10 minutes at 37 C./5% CO2. The cells were washed with PBS and lysed in 40 l Triton Lysis Buffer (1% Triton) containing Aprotinin (10 g/ml), Orthovanadate (0.4 mM), Phenylmethylsulfonyl fluoride (1 mM). 26 l of the collected lysates were transferred to reaction tubes and 14 l Sample Buffer (NuPAGE LDS Sample Buffer 4, NuPAGE Sample Reducing Agent 10) was added. The samples were incubated for 10 minutes at 70 C. and then analysed by SDS-PAGE (NuPAGE, 4-12% Bis-Tris-Mini-Gel). Electroblotting was performed using the iBlot Dry Blotting System (Invitrogen). The nitrocellulose membrane was incubated with phosphoHER3 antibody (a Phospho Her3, Cellsignaling #4791, Rabbit 1:1000) followed by incubation with HRP-conjugated secondary antibody (goat anti rabbit 1:5000, BioRad cat: 170-6515). Signal was developed using ECL Detection Reagents (Amersham RPN2209) on X-Ray film (Roche Lumi-Film Chemiluminescent Detection Film 11666657001). The anti-HER3 antibody M-05-74 (full length purified from hybridoma) and the Fab fragment of the antibody Fab-74 (obtained py papain cleavage from full length M-05-74) were investigated in eqimolar amounts. Fab fragments were generated by papain digestion of the antibody. Briefly, 1 ml of app. 2 mg/ml antibody containing solution was supplemented with 25 mM Cystein and 70 g papain (Roche). After incubation at 37 C. for 1.5 h, the digestion reaction was stopped by addition of iodoacetamide and the reaction mixture was purified by MabSelect SuRe (GE Healthcare). The Fab containing flowthrough fraction was further purified by size exclusion chromatography (Superdex 200; GE Healthcare).
(325) Percent (%) inhibition of anti-HER3 antibodies on receptor phosphorylation in MCF7 cells is summarised below and in Table 8. The antibody M-05-74 (full length from hybridoma) and the Fab fragment of this antibody Fab-74 can inhibit HER3 phosphorylation in equimolar concentrations to an comparable extent.
(326) TABLE-US-00021 TABLE 8 % Inhibition of HER3 phosphorylation in MCF-7 cells pHER3 pHER3 % inhibition % inhibition Antibody [6.66 nM] [0.66 nM] control 0 0 M-05-74 94 13 (full length from hybridoma) Fab 96 14 fragment of M-05-74 (Fab-74)
Example 7
(327) Inhibition of HER2/HER3 Heterodimers (Imunoprecipitation and Western Blot) in MCF7 Cells
(328) MCF-7 cells were seeded into 6-Well-plates (2 ml RPMI, 10% FCS, 8105 cells per well) and were grown overnight. On the next day the media was exchanged by 2 ml starving media containing 0.5% FCS. On day three the antibodies were added to a final concentration of 10 g/ml and the plates were incubated at 37 C. After 50 minutes Heregulin-beta (PeproTech, Cat. #100-03) was added to a final concentration of 500 ng/ml and the plates were incubated for another 10 minutes at 37 C. The cells were washed with PBS and lysed in 250 l Triton Lysis Buffer containing 1% Digitonin. 60 l of the collected lysates were transferred to reaction tubes and incubated with 40 l antibody-coupled Sepharose (either Herceptin or HER3-antibody #208) and 500 l Buffer containing 0.3% Digitonin. The reaction mixes were incubated on a wheel rotator overnight at 4 C. On the next day the reaction mixes were washed three times with 500 l Buffer containing 0.3% Digitonin. After the last wash the supernatant was discarded and 10 l 4 Loading Buffer was added. The tubes were incubated for 10 minutes at 70 C. and the supernatants were consequently loaded onto a gel for SDS-PAGE. After the following Semi-Dry Western Blot the membranes containing the samples immunoprecipitated with HER2 antibody were incubated with anti-HER3/HER4 antibody M-05-74 (M-074 in
Example 8
(329) Inhibition of Tumor Cell Proliferation of M-05-74 in MDA-MB-175 Cells.
(330) The anti-tumor efficacy of HER3 antibodies M-05-74 in a cell proliferation assay, using MDA-MB-175 cells (VII Human Breast Carcinoma Cells, ATCC catalog no. HTB-25), was assessed. 20,000 cells per well were seeded into sterile 96 well tissue culture plates with DMEM/F12 cell culture medium, containing 10% FCS and incubated at 37 C.1 C. with 5%1% CO.sub.2 for one day. The cells are slow growing cells with a doubling time of ca. 3 days. Anti-HER3 antibodies were added in dilution series and further incubated for 6 days. Cell viability was then assessed using the alamarBlue readout. EC50 values were calculated.
(331) TABLE-US-00022 TABLE 9 EC50 of the Inhibition of tumor cell proliferation of M-05-74 in MDA- MB-175 cells antibody EC.sub.50 [g/ml] M-05-74 5.8
Example 9
(332) In Vivo Antitumor Efficacy of Anti-HER3 Antibody M-05-74
(333) The in vivo antitumor efficacy of the anti-HER3 antibody M-05-74 (M-074) could be detected in cell based models of various tumor origin (e.g. SCCHN and pancreatic cancer) transplanted on SCID beige. As example data are shown for the SCCHN xenograft model FaDu (cell line based).
(334) Test Agents
(335) M-05-74 was provided as stock solution from Roche, Penzberg, Germany expressed and purified from hybridoma cells. Antibody buffer included histidine. Antibody solution was diluted appropriately in buffer from stock prior injections.
(336) Cell Lines and Culture Conditions
(337) FaDu human HNSCC cells were originally obtained from ATCC. The tumor cell line was routinely cultured in MEM Eagle medium supplemented with 10% fetal bovine serum, 2 mM L-glutamine, 1 mM sodium pyruvate and 0.1 mM NEAA at 37 C. in a water-saturated atmosphere at 5% CO2. Culture passage was performed with trypsin/EDTA 1 splitting every third day.
(338) Animals
(339) Female SCID beige or nude mice were purchased from breeder (e.g. Charles River, Sulzfeld, Germany) and maintained under specific-pathogen-free condition with daily cycles of 12 h light/12 h darkness according to committed guidelines (GV-Solas; Felasa; TierschG). Experimental study protocol was reviewed and approved by local government. After arrival animals were maintained in the quarantine part of the animal facility for one week to get accustomed to new environment and for observation. Continuous health monitoring was carried out on regular basis. Diet food (Provimi Kliba 3337) and water (acidified pH 2.5-3) were provided ad libitum.
(340) Animals were controlled daily for clinical symptoms and detection of adverse effects. For monitoring throughout the experiment body weight of animals was documented.
(341) Animal treatment started after animal randomisation after cell transplantation when median tumor size was about 100-150 mm3. Antibody was administered as single agent at 10 mg/kg i.p. q7d once weekly for several weeks depending of the model. The corresponding vehicle was administered on the same days.
(342) FaDu HNSCC xenograft bearing mice were treated with antibody M-05-74 from study day 10 to 24. As a result, treatment with H-74 antibody showed significant anti-tumor efficacy with nearly tumors stasis of s.c. FaDu xenografts. The Tumor Growth Inhibition (TGI) was calculated at 89%.
(343) Treatment with M-05-74 (10 mg/kg q7d3, i.p.) resulted in nearly tumor stasis of FaDu. Results are shown in
Example 10
(344) Generation of M-05-74-Fab-Pseudomonas Exotoxin Conjugate (M-05-74-PE)
(345) Expression, purification and renaturation of Fab fragment of M-05-74, PE24 variant, and Fab fragment of M-05-74 conjugated to Pseudomonas exotoxin variant PE24LR8M based on the Sequences of SEQ ID NO:45, 46, 47, 48 (or 49).
(346) Expression of Fab (e.g. for Sortase Coupling)Expression Vectors
(347) For the expression of the described Fab fragments, variants of expression plasmids for transient expression (e.g. HEK293-F) cells based either on a cDNA organization with or without a CMV-Intron A promoter or on a genomic organization with a CMV promoter were applied.
(348) Beside the antibody expression cassette the vectors contained: an origin of replication which allows replication of this plasmid in E. coli, and a -lactamase gene which confers ampicillin resistance in E. coli.
(349) The transcription unit of the antibody gene was composed of the following elements: unique restriction site(s) at the 5 end the immediate early enhancer and promoter from the human cytomegalovirus, followed by the Intron A sequence in the case of the cDNA organization, a 5-untranslated region of a human antibody gene, an immunoglobulin heavy chain signal sequence, the human antibody chain either as cDNA or as genomic organization with the immunoglobulin exon-intron organization a 3 untranslated region with a polyadenylation signal sequence, and unique restriction site(s) at the 3 end.
(350) The fusion genes comprising the antibody chains as described below were generated by PCR and/or gene synthesis and assembled by known recombinant methods and techniques by connection of the according nucleic acid segments e.g. using unique restriction sites in the respective vectors. The subcloned nucleic acid sequences were verified by DNA sequencing. For transient transfections larger quantities of the plasmids were prepared by plasmid preparation from transformed E. coli cultures (Nucleobond AX, Macherey-Nagel).
(351) Cell Culture Techniques
(352) Standard cell culture techniques were used as described in Current Protocols in Cell Biology (2000), Bonifacino, J. S., Dasso, M., Harford, J. B., Lippincott-Schwartz, J. and Yamada, K. M. (eds.), John Wiley & Sons, Inc.
(353) The Fab fragments were expressed by transient co-transfection of the expression plasmids of the heavy and the light chain in HEK29-F cells growing in suspension as described below.
(354) Transient Transfections in HEK293-F System
(355) The Fab fragments were generated by transient transfection with the respective plasmids (e.g. encoding the heavy and modified heavy chain, as well as the corresponding light and modified light chain) using the HEK293-F system (Invitrogen) according to the manufacturer's instruction. Briefly, HEK293-F cells (Invitrogen) growing in suspension either in a shake flask or in a stirred fermenter in serum-free FreeStyle 293 expression medium (Invitrogen) were transfected with a mix of the four expression plasmids and 293-Free (Novagen) or Fectin (Invitrogen). For 2 L shake flask (Corning) HEK293-F cells were seeded at a density of 1.0E*6 cells/mL in 600 mL and incubated at 120 rpm, 8% CO2. The day after the cells were transfected at a cell density of ca. 1.5E*6 cells/mL with ca. 42 mL mix of A) 20 mL Opti-MEM (Invitrogen) with 600 g total plasmid DNA (1 g/mL) encoding the heavy or modified heavy chain, respectively and the corresponding light chain in an equimolar ratio and B) 20 ml Opti-MEM+1.2 mL 293-Free (Novagen) or Fectin (2 l/mL). According to the glucose consumption glucose solution was added during the course of the fermentation. The supernatant containing the secreted antibody was harvested after 5-10 days and antibodies were either directly purified from the supernatant or the supernatant was frozen and stored.
(356) Expression of Pseudomonas Exotoxin Variant PE24-LR8M for Sortase CouplingExpression Vector
(357) For the expression of PE24-LR8M an E. coli expression plasmid was used.
(358) Beside the expression cassette for the pseudomonas exotoxin A domain III the vector contained: an origin of replication from the vector pBR322 for replication in E. coli (according to Sutcliffe, G., et al., Quant. Biol. 43 (1979) 77-90), the lacI repressor gene from E. coli (Farabaugh, P. J., Nature 274 (1978) 765-769), the URA3 gene of Saccharomyces cerevisiae coding for orotidine 5-phosphate decarboxylase (Rose, M. et al. Gene 29 (1984) 113-124) which allows plasmid selection by complementation of E. coli pyrF deletion strains (uracil auxotrophy).
(359) The transcription unit of the toxin gene was composed of the following elements: unique restriction site(s) at the 5 end, the T5 hybrid promoter (T5-PN25/03/04 hybrid promoter according to Bujard, H., et al. Methods. Enzymol. 155 (1987) 416-433 and Stueber, D., et al., Immunol. Methods IV (1990) 121-152) including a synthetic ribosomal binding site according to Stueber, D., et al. (see before), the pseudomonas exotoxin A domainIII with an N-terminal coupling tag followed by a furin site (SEQ ID NO:45 Pseudomonas exotoxin variant PE24LR8M_3G, including a GGG linker for sortase coupling), two bacteriophage-derived transcription terminators, the -T0 terminator (Schwarz, E., et al., Nature 272 (1978) 410-414) and the fd-terminator (Beck E. and Zink, B. Gene 1-3 (1981) 35-58), unique restriction site(s) at the 3 end.
Cultivation and Expression of the Pseudomonas Exotoxin A Construct Variant PE24-LR8M_3G in an E. coli Fed-Batch Process on Chemical Defined Medium
(360) For the expression of PE24-LR8M_3G_Ecoli (25 kDa) the E. coli host/vector system which enables an antibiotic-free plasmid selection by complementation of an E. coli auxotrophy (PyrF) was employed (EP 0 972 838 and U.S. Pat. No. 6,291,245).
(361) An E. coli K12 strain was transformed by electroporation with the expression plasmid. The transformed E. coli cells were first grown at 37 C. on agar plates. A colony picked from this plate was transferred to a 3 mL roller culture and grown at 37 C. to an optical density of 1-2 (measured at 578 nm). Then 1000 l culture where mixed with 1000 l sterile 86%-glycerol and immediately frozen at 80 C. for long time storage. The correct product expression of this clone was first verified in small scale shake flask experiments and analyzed with SDS-Page prior to the transfer to the 10 L fermenter.
(362) Pre Cultivation:
(363) For pre-fermentation a chemical defined medium has been used. For pre-fermentation 220 ml of medium in a 1000 ml Erlenmeyer-flask with four baffles was inoculated with 1.0 ml out of a primary seed bank ampoule. The cultivation was performed on a rotary shaker for 8 hours at 32 C. and 170 rpm until an optical density (578 nm) of 2.9 was obtained. 100 ml of the pre cultivation was used to inoculate the batch medium of the 10 L bioreactor.
(364) Fermentation:
(365) For fermentation in a 101 Biostat C, DCU3 fermenter (Sartorius, Melsungen, Germany) a chemical defined batch medium was used. All components were dissolved in deionized water. The alkaline solution for pH regulation was an aqueous 12.5% (w/v) NH.sub.3 solution supplemented with 11.25 g/l L-methionine.
(366) Starting with 4.2 l sterile batch medium plus 100 ml inoculum from the pre cultivation the batch fermentation was performed at 31 C., pH 6.90.2, 800 mbar back pressure and an initial aeration rate of 10 l/min. The relative value of dissolved oxygen (pO2) was kept at 50% throughout the fermentation by increasing the stirrer speed up to 1500 rpm. After the initially supplemented glucose was depleted, indicated by a steep increase in dissolved oxygen values, the temperature was shifted to 25 C. and 15 minutes later the fermentation entered the fed-batch mode with the start of both feeds (60 and 14 g/h respectively). The rate of feed 2 is kept constant, while the rate of feed 1 is increased stepwise with a predefined feeding profile from 60 to finally 160 g/h within 7 hours. When carbon dioxide off gas concentration leveled above 2% the aeration rate was constantly increased from 10 to 20 l/min within 5 hours. The expression of recombinant PE24-LR8M_3G_Ecoli protein was induced by the addition of 2.4 g IPTG at an optical density of approx. 120. The target protein is expressed soluble within the cytoplasm.
(367) After 24 hours of cultivation an optical density of 209 is achieved and the whole broth is cooled down to 4-8 C. The bacteria are harvested via centrifugation with a flow-through centrifuge (13,000 rpm, 13 l/h) and the obtained biomass is stored at 20 C. until further processing (cell disruption). The yield is 67.5 g dry cells per liter.
(368) Analysis of Product Formation:
(369) Samples drawn from the fermenter, one prior to induction and the others at dedicated time points after induction of protein expression are analyzed with SDS-Polyacrylamide gel electrophoresis. From every sample the same amount of cells (OD.sub.Target=10) are suspended in 5 mL PBS buffer and disrupted via sonication on ice. Then 100 L of each suspension are centrifuged (15,000 rpm, 5 minutes) and each supernatant is withdrawn and transferred to a separate vial. This is to discriminate between soluble and insoluble expressed target protein. To each supernatant (=soluble protein fraction) 100 L and to each pellet (=insoluble protein fraction) 200 L of SDS sample buffer (Laemmli, U. K., Nature 227 (1970) 680-685) are added. Samples are heated for 15 minutes at 95 C. under intense mixing to solubilize and reduce all proteins in the samples. After cooling to room temperature 5 L of each sample are transferred to a 4-20% TGX Criterion Stain Free polyacrylamide gel (Bio-Rad). Additionally 5 l molecular weight standard (Precision Plus Protein Standard, Bio-Rad) were applied.
(370) The electrophoresis was run for 60 Minutes at 200 V and thereafter the gel was transferred the GelDOC EZ Imager (Bio-Rad) and processed for 5 minutes with UV radiation. Gel images were analyzed using Image Lab analysis software (Bio-Rad). Relative quantification of protein expression was done by comparing the volume of the product bands to the volume of the 25 kDa band of the molecular weight standard.
(371) Cultivation and Expression of an Antibody Fragment Light Chain Construct (VL) and an Antibody Fragment Heavy Chain Pseudomonas Exotoxin A Variant Fusion (Fab-PE24) in an E. coli Fed-Batch Process on Chemical Defined Medium
(372) For the expression of a Fab-light chain (23.4 kDa) and a Fab-heavy chain PE24 fusion (48.7 kDa) the E. coli host/vector system which enables an antibiotic-free plasmid selection by complementation of an E. coli auxotrophy (PyrF) was employed (EP 0 972 838 and U.S. Pat. No. 6,291,245).
(373) An E. coli K12 strain was transformed by electroporation with the respective expression plasmids. The transformed E. coli cells were first grown at 37 C. on agar plates. For each transformation a colony picked from this plate was transferred to a 3 mL roller culture and grown at 37 C. to an optical density of 1-2 (measured at 578 nm). Then 1000 l culture where mixed with 1000 l sterile 86%-glycerol and immediately frozen at 80 C. for long time storage. The correct product expression of these clones was first verified in small scale shake flask experiments and analyzed with SDS-Page prior to the transfer to the 10 L fermenter.
(374) Pre-Cultivation:
(375) For pre-fermentation a chemical defined medium has been used. For pre-fermentation 220 ml of medium in a 1000 ml Erlenmeyer-flask with four baffles was inoculated with 1.0 ml out of a primary seed bank ampoule. The cultivation was performed on a rotary shaker for 9 hours at 37 C. and 170 rpm until an optical density (578 nm) of 7 to 8 was obtained. 100 ml of the pre cultivation was used to inoculate the batch medium of the 10 L bioreactor.
(376) Fermentation (RC52#003):
(377) For fermentation in a 101 Biostat C, DCU3 fermenter (Sartorius, Melsungen, Germany) a chemical defined batch medium was used. The alkaline solution for pH regulation was an aqueous 12.5% (w/v) NH.sub.3 solution supplemented with 11.25 g/l L-methionine.
(378) Starting with 4.2 l sterile batch medium plus 100 ml inoculum from the pre cultivation the batch fermentation was performed at 31 C., pH 6.90.2, 800 mbar back pressure and an initial aeration rate of 10 l/min. The relative value of dissolved oxygen (pO2) was kept at 50% throughout the fermentation by increasing the stirrer speed up to 1500 rpm. After the initially supplemented glucose was depleted, indicated by a steep increase in dissolved oxygen values, the temperature was shifted to 37 C. and 15 minutes later the fermentation entered the fed-batch mode with the start of both feeds (60 and 14 g/h respectively). The rate of feed 2 is kept constant, while the rate of feed 1 is increased stepwise with a predefined feeding profile from 60 to finally 160 g/h within 7 hours. When carbon dioxide off gas concentration leveled above 2% the aeration rate was constantly increased from 10 to 20 l/min within 5 hours. The expression of recombinant target proteins as insoluble inclusion bodies located in the cytoplasm was induced by the addition of 2.4 g IPTG at an optical density of approx. 40.
(379) After 24 hours of cultivation an optical density of 185 is achieved and the whole broth is cooled down to 4-8 C. The bacteria are harvested via centrifugation with a flow-through centrifuge (13,000 rpm, 13 l/h) and the obtained biomass is stored at 20 C. until further processing (cell disruption). The yield is between 40 and 60 g dry cells per liter.
(380) Analysis of Product Formation:
(381) Samples drawn from the fermenter, one prior to induction and the others at dedicated time points after induction of protein expression are analyzed with SDS-Polyacrylamide gel electrophoresis. From every sample the same amount of cells (OD.sub.Target=10) are suspended in 5 mL PBS buffer and disrupted via sonication on ice. Then 100 L of each suspension are centrifuged (15,000 rpm, 5 minutes) and each supernatant is withdrawn and transferred to a separate vial. This is to discriminate between soluble and insoluble expressed target protein. To each supernatant (=soluble protein fraction) 100 L and to each pellet (=insoluble protein fraction) 200 L of SDS sample buffer (Laemmli, U. K., Nature 227 (1970) 680-685) are added. Samples are heated for 15 minutes at 95 C. under intense mixing to solubilize and reduce all proteins in the samples. After cooling to room temperature 5 L of each sample are transferred to a 4-20% TGX Criterion Stain Free polyacrylamide gel (Bio-Rad). Additionally 5 l molecular weight standard (Precision Plus Protein Standard, Bio-Rad) and 3 amounts (0.3 l, 0.6 l and 0.9 l) quantification standard with known target protein concentration (0.1 g/l) were applied.
(382) The electrophoresis was run for 60 Minutes at 200 V and thereafter the gel was transferred the GelDOC EZ Imager (Bio-Rad) and processed for 5 minutes with UV radiation. Gel images were analyzed using Image Lab analysis software (Bio-Rad). With the three standards a linear regression curve was calculated with a coefficient of >0.99 and thereof the concentrations of target protein in the original sample was calculated.
(383) Purification, Sortase Coupling and Renaturation (of Fab Fragment of M-05-74, PE24 Variant, and Fab Fragment of M-05-74 Conjugated to Pseudomonas Exotoxin Variant PE24LR8M)
(384) Fab Fragment
(385) The Fab fragment was purified by affinity chromatography (Ni Sepharose High Perfomance HisTrap) according to the manufacture's description. In brief, the supernatant was loaded onto the column equilibrated in 50 mM sodium phosphate pH 8.0, 300 mM NaCl. Protein elution was performed with the same buffer at pH 7.0 with a washing step containing 4 mM imidazole followed by a gradient up to 100 mM imidazole. Fractions containing the desired Fab fragment were pooled and dialyzed against 20 mM His, 140 mM NaCl, pH 6.0.
(386) PE24 for Sortase Coupling
(387) E. coli cells expressing PE24 were lysed by high pressure homogenization (if details are required: Christian Schantz) in 20 mM Tris, 2 mM EDTA, pH 8.0+Complete protease inhibitor cocktail tablets (Roche). The lysate was filtrated and loaded onto a Q Sepharose FF (GE Healthcare) equilibrated in 20 mM Tris, pH 7.4. Protein was eluted with a gradient up to 500 mM NaCl in the same buffer. PE24 containing fractions were identified by SDS PAGE. The combined pool was concentrated and applied to a HiLoad Superdex 75 (GE Healthcare) equilibrated in 20 mM Tris, 150 mM NaCl, pH 7.4. Fractions containing PE24 were pooled according to SDS PAGE and frozen at 80 C.
(388) Sortase Coupling of Fab Fragment to PE24
(389) Fab fragment and PE24 were diafiltrated separately into 50 mM Tris, 150 mM NaCl, 5 mM CaCl.sub.2) pH7.5 using Amicon Ultra 4 centrifugal filter devices (Merck Millipore) and concentrated to 5-10 mg/ml. Both proteins and sortase were combined in a 1:1:0.8 molar ratio. After one hour incubation at 37 C. the mixture was loaded onto a Ni Sepharose High Perfomance HisTrap) equilibrated in 50 mM sodium phosphate, pH 8.0, 300 mM NaCl. Elution was performed with a gradient up to 100 mM imidazole in the same buffer pH 7.0. The flow through fractions containing the final product Fab-PE24 was concentrated and loaded onto a HiLoad Superdex 200 (GE Healthcare) in 20 mM Tris, 150 mM NaCl, pH 7.4. Fractions containing the desired coupled protein were pooled and stored at 80 C. As sortase soluble S. aureus sortase A was used (SEQ ID NO: 50). Soluble S. aureus sortase A was expressed and purified using the following expression plasmid: The sortase gene encodes an N-terminally truncated Staphylococcus aureus sortase A (60-206) molecule. The expression plasmid for the transient expression of soluble sortase in HEK293 cells comprised besides the soluble sortase expression cassette an origin of replication from the vector pUC18, which allows replication of this plasmid in E. coli, and a beta-lactamase gene which confers ampicillin resistance in E. coli. The transcription unit of the soluble sortase comprises the following functional elements: the immediate early enhancer and promoter from the human cytomegalovirus (P-CMV) including intron A, a human heavy chain immunoglobulin 5-untranslated region (5UTR), a murine immunoglobulin heavy chain signal sequence, an N-terminally truncated S. aureus sortase A encoding nucleic acid, and the bovine growth hormone polyadenylation sequence (BGH pA).
Renaturation of Fab-PE24 Derived from E. coli Inclusion Bodies
(390) Inclusion bodies of VH-PE24 and VL-C.sub.kappa were solubilized separately in 8 M guanidinium hydrochloride, 100 mM Tris-HCl, 1 mM EDTA, pH 8.0+100 mM dithiothreitol (DTT). After 12-16 hours at RT the pH of the solubilisates was adjusted to 3.0, the centrifuged solutions were dialyzed against 8 M guanidinium hydrochloride, 10 mM EDTA, pH 3.0. The protein concentration was determined by Biuret reaction, the purity of inclusion body preparations was estimated by SDS PAGE. Equimolar amounts of both chains were diluted in two steps into 0.5 M arginine, 2 mM EDTA, pH 10+1 mM GSH/1 mM GSSG, to a final concentration of 0.2-0.3 mg/ml. After 12-16 h at 4-10 C. the renaturated protein was diluted with H.sub.2O to <3 mS/cm and loaded onto a Q Sepharose FF (GE healthcare) equilibrated in 20 mM Tris/HCl, pH 7.4. Elution was performed with a gradient up to 400 mM NaCl in the same buffer. Fractions containing the correct product were identified by SDS-PAGE and analytical size exclusion chromatography (SEC). Pooled fractions were concentrated and loaded onto a HiLoad Superdex 200 (GE Healthcare) in 20 mM Tris, 150 mM NaCl, pH 7.4 or alternatively in 20 mM histidine, 140 mM NaCl, pH 6.0. Fractions were analyzed and pooled according to analytical SEC and stored at 80 C.
(391) Based on SEQ ID NO:46 and 49 the immunoconjugate of Fab fragment of M-05-74 with Pseudomonas exotoxin variant PE24LR8M (M-05-74-PE) can be expressed recombinately, purified and renaturated also as direct PE24LR8M fusion.
Example 11
(392) Cell Killing of Different Tumor Cell Lines by M-05-74-Fab-Pseudomonas Exotoxin Conjugate (M-05-74-PE)
(393) HER3 overexpressing A549 cells were seeded into a white 96-well-plate (flat, transparent bottom, 110.sup.4 cells per well) and were grown in RPMI (10% FCS) overnight. On the next day, the media was exchanged by 50 l starving media (RPMI, 0.5% FCS). After at least 4 hours, 5 l Heregulin-beta (PeproTech, Cat. #100-03) (HRG beta) was added to a final concentration of 500 ng/ml. 50 l Fab-74-PE solution was added to final concentrations of 10, 3.3, 1.1, 0.37, 0.12, 0.04, 0.014, 0.005 and 0.002 g/ml. Plates were incubated for 72 h. After 24 h and 48 h, 5 l Heregulin-beta was added again to a final concentration of 500 ng/ml. After 72 h the luminescence was measured in a Tecan Infinite F200 Reader using the CellTiter-Glo Luminescent Cell Viability Assay by Promega (Cat. # G7571). The EC50 value for M-05-74-Fab-Pseudomonas exotoxin conjugate (M-05-74-PE) in the absence of HRG beta was: 1.93 g/ml and in the presence 0.13 g/ml.
(394) TABLE-US-00023 TABLE 10 EC50 of Cell killing of A549 cells by M-05-74-Fab-Pseudomonas presence (+)/ absence () of ligand EC50 of (M- Heregulin-beta 05-74-PE) (HRG) (g/ml) half max. inhibition +HRG beta 0.13 30.3 HRG beta 1.93 19.85
Example 12a
(395) Humanized Variants of Anti-HER3 Antibody M-05-74
(396) The murine antibody M-05-7 heavy chain and light chain variable domains were used to search for similar human antibody variable domains. From the 200 results obtained for each chain about half were rejected as being from a non-human source. All of the remaining human antibodies were analyzed for key residues within the frameworks that are involved in the VH/VL interface, and for residues that are important for the CDR loop structure. As far as possible these key residues important for the VH/VL interface and canonical loop structure have been maintained in the humanized variants, however certain changes of these positions are included sometimes. The CDRs from the murine antibody chains were grafted into these human antibody frameworks. The top five grafted domains were chosen based upon the previous criteria and also on the results of a T-cell epitope in silico screen for further development. Accordingly the mouse anti-HER3 antibody M-05-74 was humanized to give the following humanized variant VH and VL domains of M-05-74:
(397) TABLE-US-00024 TABLE 11 VH and VL sequences of humanized variant antibodies of M-05-74 humanized variant of light humanized variant of VH/SEQ ID chain variable domain VL//SEQ NO: ID NO: <Her3> M-05-74_VH-A <Her3> M-05-74_VL-A SEQ ID NO: 33 SEQ ID NO: 38 <Her3> M-05-74_VH-B <Her3> M-05-74_VL-B SEQ ID NO: 34 SEQ ID NO: 39 <Her3> M-05-74_VH-C <Her3> M-05-74_VL-C SEQ ID NO: 35 SEQ ID NO: 40 <Her3> M-05-74_VH-D <Her3> M-05-74_VL_D SEQ ID NO: 36 SEQ ID NO: 41 <Her3> M-05-74_VH-E <Her3> M-05-74_VL-E SEQ ID NO: 37 SEQ ID NO: 42
(398) From the 25 theoretically possible combinations of these five VH and VL domains the most potent binders were selected as follows:
(399) In order to find a most optimized humanized variant of the <Her3> M-05-74 antibody with the favorable kinetic properties, five variants of each heavy and light chain were designed as described above. The obtained sequences were generated in all combinations (25 in total) in a scFv-ribosome display construct.
(400) The 25 scFv constructs were amplified by flanking primers to obtain linear template DNA, necessary for ribosome display. Each PCR product was purified with agarose gel-electrophoresis followed by extraction with the Qiagen MinElute Kit according to the manufacturer's instructions. The product DNA concentration was determined and 200 ng of an equimolar mixture of all linear template DNAs was the basis for the in-vitro transcription/translation at 37 C. for 60 min. The utilized kit comprised the PURExpress in-vitro protein synthesis kit (NEB), including both disulfide bond enhancers (DBE 1 & 2). Two reaction samples were processed, with the doubled reaction amount per sample. The first sample included the biotinylated and heregulin activated target (Her3-ECD) in the subsequent panning step. The second sample was the negative control, without target protein in the panning step. Both samples were treated identically. The obtained pools of ternary complexes (mRNA-ribosome-scFv variant) after transcription and translation were subjected to a pre-panning step with the employed magnetic beads (Streptavidin M-270 Dynabeads, Life Technologies) for 30 min at 4 C. to remove unspecific binding variants. The pre-panning beads were removed by centrifugation and the supernatant with the remaining ternary complexes was added to the prepared target/heregulin mixture to incubate for 30 min at 4 C. in the panning step. The target/heregulin complex was incubated in a 1:6 molar ratio for 60 min previous to the panning step to obtain the open conformation of the receptor domain and to expose the epitope of the 74 parental antibody. The final concentration of biotinylated Her3-ECD in the panning reaction was 100 nM. All employed buffers hereafter contained 300 nM heregulin.
(401) The target and all binding ternary complexes were captured via the targets biotin taq and the above mentioned streptavidin beads. Incubation time for capturing was 20 min at 4 C. Utilizing the magnetic properties of the beads the complexes can be washed by repeated incubation and removal of the wash buffer. In order to remove weak binding variants the wash pressure was increased over the washing steps. In total five washing steps with 500 uL of wash buffer (containing Heregulin) were employed (2, 4, 5, 5 & 1 min) with 2 min of capturing in the magnetic field in between. The last step was used to transfer the remaining strong binding variants in a clean new reaction tube for the elution step (10 min, 4 C., 100 uL elution buffer containing EDTA) followed by centrifugation to remove the beads. The obtained RNA in the supernatant was purified with the Qiagen RNEasy RNA purification kit according to the manufacturer's instructions. In order to ensure the origin of the later produced DNA by reverse transcription, the RNA was beforehand subjected to an DNAse digestion. The digest (Ambion DNA-free Kit) was initiated with 12 uL of purified RNA and incubated for 30 min at 37 C. Following the removal of DNase, three reverse transcription reactions per sample were initiated with 12 uL each and incubated for one hour at 37 C. 12 uL of each digested RNA sample (digested product) were used as negative control for the first PCR to proove the complete removal of DNA traces.
(402) The products of the reverse transcription reactions were pooled for each sample and used to initiate five 100 uL PCR reactions to amplify the DNA selection pools. The products were pooled and purified by gel electrophoresis (1% preparative agarose gel and analytical Agilent DNA 7500 chip with 1 uL sample volume) and the Qiagen MinElute Kit according to the manufacturer's protocols. The obtained gel image in
(403) The PCR product was amplified to produce enough DNA for cloning. The selection pool and the expression vector Her_scFv_huFc (1 ug each) were digested with MfeI-HF and NotI-HF in CutSmart buffer (all NEB) for one hour at 37 C. The selection insert and the cut vector were first purified and then ligated with NEB Quick Ligase for 30 min at room temperature. The molar ratio of cut insert to vector was 5:1 (25 ng cut insert and 50 ng cut vector). Two microliters of the ligation product were directly used to transform 50 uL of DHS (Life Technologies) competent cells. Following outgrowth, 50 uL were plated out on LB plates with ampicillin resistance (LBamp) and incubated for 16 hours at 37 C. 34 colonies were used to inoculate 5 mL LBamp media for 16 h at 37 C. The cells were harvested and the DNA isolated with the Qiagen Miniprep Kit according to the manufacturer's instructions and 300 ng plasmid DNA of each sample was sent to Sequiserve GmbH for sequencing.
(404) ResultsMost Optimized Humanized Variant of <Her3> M-05-74 Antibody
(405) The sequencing results show an enrichment of one particular variant: VH-A/VL-D. The corresponding sequence was obtained six times from the 34 samples, which clearly indicates the most potent binding properties to HER-ECD in the assay described above.
(406) Also the combinations VH-A/VH-B and VH-A/VH-E occurred twice and hence showed some superior binding properties to HER3 ECD as compared to the remaining less enriched VH/VLcombinations.
(407) Surpisingly all enriched variants included VH-A. Consequently VH-A is a key feature of all HER3 binding humanized variants of <Her3> M-05-74., especially in the preferred combinations VH-A/VL-D, VH-A/VH-B and VH-A/VH-E.
(408) The remaining 24 sequences were all different and featured minor deletions and/or a combination of point mutations. Three sequences could not perfectly be edited and were not analyzed.
(409) Each of the combinations VH-A/VL-D, VH-A/VH-B and VH-A/VH-E. is expressed in a human IgG1 isotype (with Ckappa light chain constant domain) or alternatively e.g. as fusion protein with a Pseudomonas exotoxin (immunotoxin) as described above. Binding characteristics and biological properties are determined as describe above e.g. in Example 2, 3, 5, 6, 7, 8, 9, 11 or described in Example 13 below.
Example 12b
(410) Binding of Humanized Variants of Anti-HER3 Antibody M-05-74
(411) To investigate the binding of the humanized variant VH-A/VL-D of anti-HER3 antibody M-05-74 (described in Example 12a) to the HER3-ECD and the HER4-ECD, in presence and absence of the ligand Heregulin, SPR analysis were conducted at 37 C., using a Biacore 3000 device (GE Healthcare) (Table 11).
(412) TABLE-US-00025 TABLE 11a SPR analysis of humanized variant VH-A/VL-D at 37C.: Binding of humanized DIB-74 to HER3-ECD and HER4-ECD in presence and absence of the ligand FRG, investigated using a Biacore 3000 device (GE Healthcare) t.sub./2diss K.sub.D R.sub.max Chi.sup.2 Analyte k.sub.a (M.sup.1s.sup.1) k.sub.d (s.sup.1) (min) (nM) (RU) MR (RU.sup.2) HER3-ECD 1.9E+04 4.4E04 26 23 80 0.7 0.2 HER4-ECD n. d. n. d. n. d. n. d. n. d. n. d. n. d. HER3- 1.9E+05 2.0E03 6 10 198 0.8 1.4 ECD/HRG HER4- 1.8E+05 3.8E02 0.3 211 183 0.8 0.5 ECD/HRG
(413) TABLE-US-00026 TABLE 11b Direct comparison with parent murine anti-HER3 antibody M-05-74 t.sub./2diss K.sub.D R.sub.max Chi.sup.2 Analyte k.sub.a (M.sup.1s.sup.1) k.sub.d (s.sup.1) (min) (nM) (RU) MR (RU.sup.2) HER3-ECD 2.1E+04 8.1E05 144 4 104 0.6 0.2 HER4-ECD n.d. n.d. n.d. n.d. n.d. n.d. n.d. HER3- 7.9E+04 5.7E04 20 7 225 0.7 2.6 ECD/HRG HER4- 5.8E+05 3.3E03 4 6 289 0.9 5.4 ECD/HRG
(414) The humanized variant VH-A/VL-D of anti-HER3 antibody M-05-74 preferentially bound to the ligand activated ECD complexes, due to increased epitope accessibility. It bound with an affinity of K.sub.D 10 nM to the HER3-ECD/HRG complex
(415) Surpisingly the humanized variant VH-A/VL-D of anti-HER3 antibody M-05-74 showed a strongly reduced HER4-ECD/HRG reactivity (K.sub.D 211 nM) compared to the parent antibody M-05-74 ((K.sub.D 4 nM)) while retaining its HER3-ECD/HRG reactivity (K.sub.D 10 nM compared to K.sub.D 7 nM).
Example 13
(416) In Vivo Tumor Cell Growth Inhibition by M-05-74-Fab-Pseudomonas Exotoxin Conjugate (M-05-74-PE)
(417) The human A431-B34 non-small cell lung cancer cell line cell line, which was stably transfected with an expression vector encoding human HER3, was subcutaneously inoculated into the right flank of female SCID beige mice (110.sup.7 cells per animal).
(418) On day 21 after tumor inoculation, the animals were randomized and allocated into the treatment group and one vehicle group, resulting in a median tumor volume of 110 mm.sup.3 per group. On the same day, animals were treated intravenously for 2 cycles, each cycle consisting of 3q7d (every other day), with M-05-74-Fab-Pseudomonas exotoxin conjugate (M-05-74-PE) (1.0 mg/kg). Controls received vehicle (Tris buffer). The two cycles were separated by a one week off-treatment.
(419) Primary tumor volume (TV) was calculated according to the NCI protocol (TV=(lengthwidth.sup.2)/2), where length and width are long and short diameters of tumor mass in mm (Corbett et al., 1997). Calculation was executed from staging (day 21 after tumor inoculation) until day 42 after tumor inoculation, and values were documented as medians and inter-quartile ranges (IQR) defined as differences of the third and first quartile.
(420) For calculation of percentage tumor growth inhibition (TGI) during the treatment period, every treated group was compared with its respective vehicle control. TV.sub.day z represents the tumor volume of an individual animal at a defined study day (day z) and TV.sub.day x represents the tumor volume of an individual animal at the staging day (day x).
(421) The following formula was applied:
(422)
(423) Calculations of treatment to control ratio (TCR) with confidence interval (CI) were applied using non-parametric methods. Results of median tumor volumes with inter-quartile ranges are shown in
Example 14
(424) Binding of the Antibody M-05-74 (1) to TtSlyDcys-Her3 (SEQ ID NO: 18) in Comparison with Anti-HER3 Antibody MOR09823 (2) Described in WO2012/22814.
(425) A Biacore T200 instrument (GE Healthcare) was mounted with CM5 series sensor and was normalized in HBS-ET+ buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.05% w/v Tween 20) according to the manufacturer's instructions. The sample buffer was the system buffer supplemented with 1 mg/ml CMD (Carboxymethyldextran). The system operated at 37 C. A double antibody capture system was established on the sensor surface. 6500 RU mAb<M-IgG>R was immobilized according to the manufacturer's instructions using EDC/NHS chemistry on all flow cells. The sensor was deactivated using 1M ethanolamine. Flow cell 1 served as a reference and was captured for 1 min at 10 l/min with anti-TSH IgG1 antibody. On flow cell 2 M-5-74 was captured for 1 min at 10 l/min. On flow cell 3 a murine anti-human FC pan antibody was captured 1 min at 10 l/min followed by the injection of the anti-HER3 antibody M-05-74 (1) or of anti-HER3 antibody MOR09823 antibody for 1 min at 10 l/min. The flow rate was set to 60 l/min. The analyte in solution TtSlyDcys-HER3 (SEQ ID NO: 18) was injected at concentrations of 0 nM and 150 nM for 5 min and the dissociation was monitored for 600 sec. The sensor was fully regenerated by one injection at 10 l/min for 3 min with 10 mM glycine pH 1.7 buffer.
(426)
Example 15
(427) Generation and Evaluation of HER3/HER2 Bispecific Antibody DIBPERT Binding to the Beta-Hairpin of HER3 and Domain II of HER2
(428) Material and Methods
(429) Recombinant DNA Techniques
(430) Standard methods were used to manipulate DNA as described in Sambrook, J. et al., Molecular Cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. The molecular biological reagents were used according to the manufacturer's instructions.
(431) Gene Synthesis
(432) Desired gene synthesis fragments were ordered according to given specifications at Geneart (Regensburg, Germany).
(433) The 600-1500 bp long gene segments, which were flanked by singular restriction endonuclease cleavage sites, were cloned via the indicated restriction sites into a pUC expression vector, e.g. BamHI/XbaI, BamHI/XhoI (
(434) DNA Sequence Determination
(435) DNA sequences were determined by double strand sequencing performed at Sequiserve GmbH (Vaterstetten, Germany).
(436) DNA and Protein Sequence Analysis and Sequence Data Management
(437) Infomax's Vector NT1 Advance suite version 11.5.0 was used for sequence creation, mapping, analysis, annotation and illustration.
(438) CrossMab Design
(439) The CrossMab technology (Schaefer et al. 2011) combines two heavy and light chains of different parental antibodies with different specificities into one IgG-like format. To facilitate heterodimerization of two different heavy chains, the knob-into-hole technology is applied, whereby one smaller amino acid is exchanged by a larger amino acid in one CH3 domain (knob). In the CH3 domain of the second antibody, a larger amino acid is exchanged by smaller amino acids (hole). To ensure the correct assimilation of light chains with corresponding heavy chains, the CH1 domain of one heavy chain is exchanged with the CKappa (CK) domain of the respective light chain. The end product in general is called CrossMab. Here, the M-05-74 (DIB-74) antibody light (
(440) Expression of DIBPERT
(441) For the expression of DIBPERT by HEK293F cells, plasmid DNA was obtain by QIAGEN Plasmid Plus Maxi Kit (Qiagen, Hilden, Germany), according to the manufacturer's indications. Cells were seeded with 1.0E+06 cells per ml Gibco FreeStyle 293 Expression Medium. One liter of cells was transfected with 22 pmol of each of the four plasmids (CB01_DIB-LC_VL-CK, CB02_DIB-HC_VH-CH1-CH2-CH3_knob, NN21 pUC-Exp_xMab_Pertuzu_LC, NN24 pUC-xPertuzu-SSKHC2-RSE), using the 293-Free Transfection Reagent, according to the manufacturer's instructions. Cells were incubated for seven days at 37 C., 8% CO2 and 80% air humidity, shaking at 150 rpm (LabTherm LT-XC, Khner AG, Birsfelden, Schweiz). After incubation, 50 mM PMSF (Sigma-Aldrich, Steinheim, Germany), 1 ng MgCl2 (Merck GmbH, Darmstadt, Germany) and 10 U/ml DNaseI (Roche Diagnostics GmbH, Mannheim, Germany) were added and cells were incubated for 30 minutes. The antibody containing supernatant was harvested by pelleting the cells for 30 minutes at 890g (Rotanta 460R, Andreas Hettich GmbH, Tuttlingen, Germany). Until purification, the supernatant was stored at 20 C.
(442) Purification of DIBPERT
(443) The antibody was isolated using an ktaAvant instrument (GE Healthcare, Mnchen, Germany). A protein A HiTrap MabSelect SuRe (5 ml) (GE Healthcare, Mnchen, Germany) was equilibrated with 50 mM KH.sub.2PO.sub.4, 150 mM KCl, pH 7.4 system buffer. The supernatant was filtered with 0.22 m sterile filter units beforehand and then applied onto the column with a flow rate of 0.9 ml/min overnight. Subsequently, unbound material was removed, using the system buffer at a flow rate of 2 ml/min. Then, bound antibodies were eluted from the column using 0.1 M Na-Citrate pH 3.7 at a flow rate of 1 ml/min and directly neutralized with 1 M L-Arginine buffer. Desired fractions were pooled and purified by gel permeation chromatography (GPC), thereby dialyzing the buffer into 20 mM Histidine, 140 mM NaCl, pH 6.0 storage buffer. The DIBPERT end-product quantity was analyzed by spectroscopy at 280 nm. The quality was controlled by GPC, using a TSK-Gel QC-PAK GF30 column (Tosoh Bioscience GmbH, Stuttgart, Germany) and a UltiMate 3000 Dionex instrument (Fisher Scientific GmbH, Schwerte, Germany) (
(444) To assess the purity and aggregation state of DIBPERT, an analytical GPC was conducted, using a TSK-Gel QC-PAK GF30 column (Tosoh Bioscience, Stuttgart, Germany). DIBPERT was purified with a relative GPC peak area of 96% (
Example 16
(445) Determination of HER3/HER2 Bispecific Antibody DIBPERT Kinetic Features by SPR Analyses
(446) In its equilibrium state, the HER3-ECD is in its closed confirmation, which does mean, the heterodimerization HER3 -hairpin motive is tethered via non-covalent interactions to the HER3-ECD domain IV. It is supposed, that the closed HER3 conformation can be opened via the binding of the ligand heregulin at a specific HER3 heregulin binding site. This takes place at the HER3 interface formed by the HER3-ECD domains I and domain III. By this interaction it is believed, that the HER3 receptor is activated and transferred into its open conformation. When this occurs, the HER3 -hairpin is accessible for the described antibodies. This mode of action can be simulated in vitro by a Biacore experiment.
(447) To investigate, if the kinetic features of parental antibodies DIB-74 and Pertuzumab were retained by DIBPERT, real-time data were collected, using SPR analyses, a Biacore B3000 instrument (GE Healthcare) was used to kinetically assess the monoclonal antibodies at 25 C. for their behavior to the heregulin-activated HER3 Extracellular Domain (HER3-ECD) and the constitutive open HER2-ECD. A CM5 series sensor was mounted into the system and was normalized in HBS-ET buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% w/v Tween 20) according to the manufacturer's instructions. The sample buffer was the system buffer supplemented with 1 mg/ml CMD (Carboxymethyldextran, Sigma #86524). The system operated at 25 C. 10000 RU monoclonal murine anti-human Fc antibody (MAK<h-Fc>M-R10Z8E9, Roche Diagnostics GmbH, Penzberg, Germany) were immobilized using EDC/NHS chemistry on all four flow cells. The sensor was deactivated using 1M ethanolamine.
(448) The analytes in solution tested were 270 nM human recombinant HER2-ECD (69.6 kDa) and 270 nM human recombinant HER3-ECD (68 kDa) which was incubated with a 3-fold molar excess of human Heregulin1 (HRG1) a 44 kDa homodimeric protein, for 60 min at room temperature resulting in HER3-ECD/HRG1 complex. Analytes in solution were injected at different concentration steps of 0 nM, 3.3 nM, 10 nM, 30 nM, 90 nM and 270 nM for 5 min at a flow rate of 30 l/min (
(449) For assessing the simultaneous binding capacity of DIBPERT to both HER2-ECD and the HER3-ECD/HRG1 complex, a second assay setup was used. Herein, the analytes HER2-ECD (270 nM) and HER3-ECD/HRG1 complex (270 nM HER3-ECD with a threefold surplus of HRG1) were injected subsequently, or vice versa (
(450) DIBPERT Retained the Specificity of the Parental Antibodies
(451) DIBPERT and the parental antibodies DIB-74 in the monovalent MoAb format and Pertuzumab in the bivalent IgG format, were compared, using SPR analyses. DIBPERT retained the specificities of its parental antibodies Pertuzumab and DIB-74 and bound to the HER2-ECD as well as the HER3-ECD/HRG1 complex (
(452) TABLE-US-00027 TABLE 12 Kinetic parameters of DIBxPERT and the parental antibodies DIB-MoAb and Pertuzumab, determined by SPR analyses, using a B3000 Biacore instrument (Ge Healthcare). CL R.sub.max k.sub.a k.sub.d t.sub.1/2-diss K.sub.D Ligand Analyte (RU) (RU) (1/Ms) (1/s) (min) (nM) MR PERT HER2-ECD 160 99 6.9E+04 1.2E04 100 1.7 1.3 DIBxPERT HER2-ECD 165 46 8.5E+04 1.4E04 83 1.6 0.6 DIB-MoAb HER3- 121 81 1.1E+05 2.3E04 51 2.1 0.6 ECD/HRG1 DIBxPERT HER3- 162 64 8.4E+04 3.3E04 35 3.9 0.5 ECD/HRG1 CL: Capture level in Response Units, R.sub.max: maximal binding level of the analytes, k.sub.a: association rate constant in 1/Ms, k.sub.d: dissociation rate constant in 1/s, t.sub.1/2-diss: complex half-life period in minutes, K.sub.D: equilibrium dissociation constant, MR: molar ratio.
Simultaneous Binding of DIBPERT to Soluble HER2-ECD and HER3-ECD/HRG1 Complex
(453) The simultaneous binding capacity of DIBPERT to the soluble HER2-ECD and HER3-ECD/HRG1 complex was assessed using SPR analyses (
Example 17
(454) Inhibition of Tumor Cell Proliferation of HER3/HER2 Bispecific Antibody DIBPERT in MDA-MB-175 VII Cells
(455) The anti-tumor efficacy of DIBPERT was assessed in a cell proliferation assay, using MDA-MB-175 cells (VII Human Breast Carcinoma Cells, ATCC catalog no. HTB-25). 20,000 cells per well were seeded into sterile 96 well tissue culture plates with DMEM/F12 cell culture medium, containing 10% FCS and 2 mM L-Glutamine and incubated at 37 C. with 5% CO.sub.2 for one day. The cells are slow growing cells with a doubling time of approximately 3 days. Cells were starved with 0.5% FCS containing DMEM/F12 cell culture medium, containing 2 mM L-Glutamine. DIBPERT and control antibodies were added in dilution series and further incubated for 6 days. The applied antibodies are listed in table 13. Cell viability was then assessed using the alamarBlue readout. EC.sub.50 values were calculated using means of triplicates for each antibody concentration (
(456) TABLE-US-00028 TABLE 13 Antibodies used for the inhibition of tumor cell proliferation in MDA-MB-175 VII cells in vitro. Additionally to the below mentioned single treatments, the combination treatments of DIB-74 with Pertuzumab and RG7116 with Pertuzumab were applied in vitro. Antibody Format Valence Specificity DIBxPERT CrossMab bivalent anti-HER2 subdomain II anti-HER3 -hairpin DIB-MoAb MoAb monovalent anti-HER3 -hairpin (monovalent antibody based on M-05-74) DIB-74 (M-05- Monoclonal bivalent anti-HER3 -hairpin 74) IgG Pertuzumab Monoclonal bivalent anti-HER2 subdomain IgG II RG7116 Monoclonal bivalent anti-HER3 subdomain I (<HER3> Mab IgG binding to domain I) Isotype control Polyclonal IgG bivalent no specific target
Inhibition of Tumor Cell Proliferation of DIBPERT in MDA-MB-175 VII Cells
(457) The inhibition of tumor cell proliferation of DIBPERT was examined in vitro, using MDA-MB-175 VII cells. In the MDA-MB-175 VII cell line (doubling time 3 days) the oncogenic signal arises from an autocrine HRG growth loop. Cells were incubated with the series diluted antibodies DIBPERT, DIB-MoAb, DIB-74, Pertuzumab, RG7116, the combinations of DIB-74 and Pertuzumab and of RG7116 and Pertuzumab and an Isotype control (
(458) TABLE-US-00029 TABLE 14 Inhibition of tumor cell proliferation of DIBxPERT in MDA-MB-175 VII cells. Tumor cell proliferation inhibition (%) EC50 Antibody minimum maximum (nM) DIBxPERT 14 79 1 DIB-MoAb 12 n/a n/a monovalent M- 05-74 DIB (M-05-74) 15 56 26 PERT 12 67 2 RG7116 17 58 7 Combination of 15 76 2 DIB and PERT Combination 16 76 2 RG7116 and PERT Isotype control 19 13 n/a DIB: murine DIB-74 IgG; PERT: Pertuzumab IgG; RG7116: humanized anti-HER3 subdomain I IgG; Isotype control: polyclonal human antibody; n/a: not applicable.