FRACTURE TARGETED BONE REGENERATION THROUGH PARATHYROID HORMONE RECEPTOR STIMULATION

20200317745 ยท 2020-10-08

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein includes a drug delivery system comprising at least one peptide and a targeting ligand for bone fracture and/or for bone healing. Some embodiments include a peptide delivery system comprising at least an acidic, basic, hydrophilic, hydrophobic or neutral peptide linked to an acidic peptide or nonpeptidic polyanion for use in targeting the aforementioned attached peptide to a bone fracture surface. In some embodiments, a conjugated peptide expresses an anabolic function that acts through PTH receptor 1, and various formats of targeting ligands guide the drug to raw hydroxyapatite. This system offsets some side effects caused by free anabolic drug, such as high blood calcium concentration

    Claims

    1. A compound comprising: a compound of the formula XYZ; wherein: X is at least one agent that modulates activity of parathyroid hormone receptor; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof.

    2. The compound according to claim 1, wherein: X is at least one polypeptide having at least 80% sequence identity to a full length parathyroid hormone related peptide (SEQ ID NO: 12), at least 80% sequence identity to a full length parathyroid hormone (SEQ ID NO: 13), and/or at least 80% identity to a full length abaloparatide or analogs thereof; Y is at least one polypeptide comprising at least 80% sequence identity to amino acid residues 35-40, 35-41, 35-42, 35-43, 35-44, 35-45, 35-46, and/or 35-84 of a full length parathyroid hormone related peptide or parathyroid hormone, and/or at least one Cathepsin K sensitive polypeptide; and Z is at least one polypeptide comprising 4 or more acidic amino acid residues, polyphosphate, aminohexanedioic acid or derivatives thereof, and/or alendronate or derivatives thereof.

    3. The compound according to claim 1, wherein: X is at least one polypeptide having at least 80% sequence identity to SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, and 9; Y is at least one polypeptide comprising at least 80% sequence identity to amino acid residues 35-46 and/or 41-46 of a full length parathyroid hormone related peptide; and Z is at least one polypeptide comprising 4 or more acidic amino acid residues, polyphosphate, and/or alendronate or derivatives thereof.

    4. The compound according to claim 1, wherein: X is at least one polypeptide having 80% identity to a full length abaloparatide or analogs thereof; Y is at least one polypeptide comprising at least 80% sequence identity to amino acid residues 35-46 of a full length parathyroid hormone related peptide; and Z is at least one polypeptide comprising 4 or more acidic amino acid residues, polyphosphate, and/or alendronate or derivatives thereof.

    5. The compound according to claim 1, wherein: Z is at least one polypeptide comprising 6, 7, 8, 9, and/or 10 acidic amino acid residues.

    6. The compound according to claim 1, wherein the acidic amino acid residues comprise L- or D-aspartic acid, L- or D-glutamic acid, or a combination thereof.

    7. The compound according to claim 1, wherein the acidic amino acid residues further comprises branched amino acid, and/or branched chains of amino acids.

    8. The compound according to claim 1, wherein: Y is at least one polypeptide comprising the formula of Gly-Gly-Pro-Nle, wherein Nle comprises norleucine, leucine, isoleucine, and/or an equivalent thereof.

    9. The compound according to claim 1, wherein the compound of the formula XYZ is at least one polypeptide having at least 80%, 90%, and/or 95% sequence identity to SEQ ID NO: 10 and/or SEQ ID NO: 11.

    10. The compound according to claim 1, wherein the compound of the formula XYZ is at least one polypeptide having SEQ ID NO: 10 and/or SEQ ID NO: 11.

    11. The compound according to claim 1, wherein X is at least one agonist of parathyroid hormone receptor 1.

    12. The compound according to claim 1, wherein X is at least one polypeptide having at least 80% sequence homology to the first 13 amino acids of a full length parathyroid hormone related peptide (SEQ ID NO: 12), at least 80% sequence homology to the first 13 amino acids of a full length parathyroid hormone (SEQ ID NO: 13), and/or at least 80% homology to the first 13 amino acids of SEQ ID NO:3.

    13. A method of treating a bone-related disease, the method comprising the steps of: providing a subject at least one therapeutically effective dose of a compound of claim 1 or a pharmaceutically acceptable salt or metabolite thereof.

    14. The method according to claim 13, wherein the subject comprises a human, an animal, a cell, and/or a tissue.

    15. The method according to claim 13, wherein the bone-related disease comprises osteopenia, osteoporosis, rheumatoid arthritis, hematologic, autoimmunity, transplant rejection, and/or bone fracture.

    16. The method according to claim 13, the effective dose of the compound of any one of claims 1-10 comprises from 0.001 nmol/kg/day to 1000 nmol/kg/day, from 0.01 nmol/kg/day to 1000 nmol/kg/day, from 0.1 nmol/kg/day to 1000 nmol/kg/day, from 1 nmol/kg/day to 500 nmol/kg/day, from 1 nmol/kg/day to 250 nmol/kg/day, from 1 nmol/kg/day to 100 nmol/kg/day, from 10 nmol/kg/day to 75 nmol/kg/day, and/or from 20 nmol/kg/day to 50 nmol/kg/day.

    17. The method according to claim 13, wherein the compound is administered orally, parenterally, rectally, and/or transdermally.

    18. A compound comprising: a compound of the formula XZ; wherein: X is at least one peptide; and Z is at least one bone-targeting molecule; or a pharmaceutically acceptable salt thereof, or a metabolite thereof.

    19. The compound according to claim 18, wherein Z is at least one molecule that preferentially and/or selectively targets fractured bone.

    20. The compound according to claim 18, wherein X is at least one peptide having fewer than 60, 50, 40, 30, 20, and/or 10 amino acid residues.

    21-36. (canceled)

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0074] FIG. 1. Graph illustrating bone density data collected from microCT. A selection of 100 CT frames (slices) from each fracture callus were analyzed. The stack of frames were chosen from the area of the fracture where the callus was the largest.

    [0075] FIG. 2. Graph illustrating trabecular spacing data collected from microCT. Narrower spacing is associated higher density bone and can be indicative of progressed healing. A selection of 100 CT frames (slices) from each fracture callus were analyzed.

    [0076] FIG. 3. Graph illustrating bone density data collected from microCT. A selection of 100 CT frames (slices) from each fracture callus were analyzed. The stack of frames were chosen from the area of the fracture where the callus was the largest.

    [0077] FIG. 4. Graph illustrating alkaline phosphatase (ALP) expression ratio for both targeted and non-targeted PTHrP in MC3T3E1 cells. The ALP ratio is calculated by (Treated ALP expression/Vehicle control ALP expression). The expression was standardized to GAPDH.

    [0078] FIG. 5. Graph illustrating osteopontin (OPN) expression ratio for both targeted and non-targeted PTHrP in MC3T3E1 cells. The OPN ratio is calculated by (Treated OPN expression/Vehicle control OPN expression).

    [0079] FIG. 6. Graph illustrating gene expression ratio of several key bone markers for both targeted and non-targeted PTHrP in MC3T3E1 cells. Activity markers include alkaline phosphatase (ALP), Collagen I-alpha (Col1-alpha), osteocalcin (OC), osteoprotegerin (OPG), osteopontin (OPN, and Osterix (OSX). The gene expression ratio is calculated by (Treated gene expression/Vehicle control gene expression).

    [0080] FIG. 7. Graph illustrating the effects of PTHrPD10 (targeted) or PTHrP (free) on bone volume after treatment.

    [0081] FIG. 8. Graph illustrating the effects of abaloparatide D10 (targeted), abaloparatide (not targeted) and saline on bone volume after treatment.

    [0082] FIG. 9. Graph illustrating the effects of PTHrP targeted with polyphosphate or saline on bone volume after treatment.

    [0083] FIG. 10. Graph illustrating the effects of PTHrP targeted with a single alendronate, tri-branched alendronate or free PTHrP on bone volume after treatment.

    [0084] FIG. 11. Chemical formula illustrating linear polymers of acidic amino acids of varying carbon chain length.

    [0085] FIG. 12. Chemical formula illustrating branched polymers of acidic amino acids of varying carbon chain length.

    [0086] FIG. 13. Chemical formula illustrating non-amino-acid-based bone targeting ligands. Top represents bisphosphonates. Bottom represents the polyphosphate targeting ligand.

    [0087] FIG. 14A. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy femur using various targeting ligands radiolabeled with .sup.125I.

    [0088] FIG. 14B. Bar graph illustrating the counts per minute of the fractured femur compared to the healthy femur using various targeting ligands radiolabeled with .sup.125I.

    [0089] FIG. 15. Near infrared image illustrating the targeting of LS288 conjugated to a linear polymer of 10 L-aspartic acids 10 days post osteotomy on the right femur. Some off target signal is visible along the back due to the injection site.

    [0090] FIG. 16. Near infrared image illustrating the targeting of LS288 conjugated to a linear polymer of 10 L-aspartic acids at 3 (bottom row), 6 (middle row), and 10 days (top row) post osteotomy on the right femur. In each pair of femurs, a femur on the left represents the fractured femur while a femur on the right represents the healthy femur.

    [0091] FIG. 17A. Bar graph illustrating the relative distribution of the radiolabeled conjugated peptide, PreptinD10, as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0092] FIG. 17B. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy femur using radiolabeled .sup.125I PreptinD10.

    [0093] FIG. 18A. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy (non-fractured) femur using various radiolabeled .sup.125I peptides conjugated with L-Asp10, D-Asp10, L-Glu10, or D-Glu10.

    [0094] FIG. 18B. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy (non-fractured) femur using various radiolabeled .sup.125I peptides conjugated with L-Asp20, L-Glu20, or D-Glu20.

    [0095] FIG. 18C. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy (non-fractured) femur using various radiolabeled .sup.125I peptides conjugated with branched L-Asp10, branched D-Asp10, branched L-Asp4, or branched L-Asp8.

    [0096] FIG. 19A. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy (non-fractured) femur using various conjugated peptides radiolabeled with .sup.125I.

    [0097] FIG. 19B. Bar graph illustrating the fold difference of relative counts between fractured femur and healthy (non-fractured) femur using various conjugated peptides radiolabeled with .sup.125I.

    [0098] FIG. 20A. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., Ck2.3C and PACAPC) conjugated with L-Asp10 (i.e., a liner polymer of 10 L-aspartic acids) as a percent of the total counts that was found in each of the individual organs.

    [0099] FIG. 20B. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, and PACAPC) conjugated with D-Asp10 (i.e., a liner polymer of 10 D-aspartic acids) as a percent of the total counts that was found in each of the individual organs.

    [0100] FIG. 20C. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, and F109C) conjugated with L-Asp20 (i.e., a liner polymer of 20 L-aspartic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0101] FIG. 21A. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., P4C, Ck2.3C, and CTCC) conjugated with L-Glu10 (i.e., a liner polymer of 10 L-glutamic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0102] FIG. 21B. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, and F109C) conjugated with D-Glu10 (i.e., a liner polymer of 10 D-glutamic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0103] FIG. 22A. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., P4C, Ck2.3C, F109C, and PACAPC) conjugated with L-Glu20 (i.e., a liner polymer of 20 L-glutamic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0104] FIG. 22B. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, and F109C) conjugated with D-Glu20 (i.e., a liner polymer of 20 D-glutamic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0105] FIG. 23A. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, F109C, and PACAPC) conjugated with branched L-Asp 10 (i.e., a branched polymer of 10 L-aspartic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0106] FIG. 23B. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, and CTCC) conjugated with branched D-Asp10 (i.e., a branched polymer of 10 D-aspartic acids) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0107] FIG. 24A. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., P4C, Ck2.3C, F109C, and PACAPC) conjugated with L-AAD10 (i.e., 10 L-amino adipic acid liner polymer) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0108] FIG. 24B. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, CTCC, F109C, and PACAPC) conjugated with L-SDSDD (i.e., a linear polymer having L-Ser-Asp-Ser-Asp-Asp; SEQ ID NO: 21) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0109] FIG. 24C. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, F109C, and PACAPC) conjugated with (DSS).sub.6 (i.e., DSSDSSDSSDSSDSSDSS; SEQ ID NO: 22) as a percent of the total counts that was found in each of the individual organs. The counts are standardized per gram of tissue weight.

    [0110] FIG. 25A. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I PTHrP1-39C conjugated with a mono-bisphosphonate, a tri-bisphosphonate, or a polyphosphate, radiolabeled .sup.125I PTH1-34 conjugated with E10, and radiolabeled .sup.125I PTHrP1-39 conjugated with E20. PTHrP1-39C is PTHrP1-39 with a cysteine (C) at the 40 position, to which the different targeting ligands were conjugated. The counts are standardized per gram of tissue weight.

    [0111] FIG. 25B. Bar graph illustrating the relative distribution of the radiolabeled .sup.125I Tyrosine conjugated with a mono-bisphosphonate, a branched L-Asp4 (i.e., YPegK[DDDD].sub.2; see also SEQ ID NO:68), or a branched L-Asp8 (i.e., YPegK[DDDDDDDD].sub.2; see also SEQ ID NO:69). Monobisphosphonate YC is a peptide having tyrosine and cysteine that is conjugated with a mono-bisphosphonate. The counts are standardized per gram of tissue weight.

    [0112] FIG. 26. Graph illustrating the effects of PTH1-34E10 and saline on bone volume after treatment.

    [0113] FIG. 27. Graph illustrating the effect of PTHrPD10 on bone volume after treatment.

    [0114]

    TABLE-US-00001 BRIEFDESCRIPTIONOFSEQUENCELISTING SEQIDNO:1.PTHrP1-34 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA) SEQIDNO:2.PTH1-34 (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF) SEQIDNO:3.Abaloparatide1-34with2- methylalanylatresidue29andaminatedat residue34 (AVSEHQLLHDKGKSIQDLRRRELLEKLLAKLHTA) SEQIDNO:4.PTHrP1-35 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAG) SEQIDNO:5.PTHrP1-36 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGI) SEQIDNO:6.PTHrP1-37 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIR) SEQIDNO:7.PTHrP1-38 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIRA) SEQIDNO:8.PTHrP1-39 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIRAT) SEQIDNO:9.PTHrP1-40 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIRATS) SEQIDNO:10.PTHrP1-46D10 (VSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIRATSEVSPNSDD DDDDDDDD) SEQIDNO:11.PTH1-46D10 (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAP LAPRDADDDDDDDDDD) SEQIDNO:12.PTHrP (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSK PSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPG KRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH) SEQIDNO:13.PTH (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAG SQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ) SEQIDNO:14.Heparin-bindingdomainofFGF2 (F109C) (YKRSRYTC) SEQIDNO:15.Pituitaryadenylatecyclase- activatingpolypeptide(PACAPC) (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKC) SEQIDNO:16.Chemotacticcrypticpeptide derivedfromtheCTXregionofcollagen typeIII(CTCC) (YIAGVGGEKSGGFYC) SEQIDNO:17.Caseinkinase2betachain (Ck2.3C) (RQIKIWFQNRRMKWKKIPVGESLKDLIDQC) SEQIDNO:18.Osteopontin-derivedpeptide (ODPC) (DVDVPDGRGDSLAYGC) SEQIDNO:19.P4-BMP2(P4C) (KIPKASSVPTELSAISTLYLC) SEQIDNO:20.PreptinD10 (DVSTSQAVLPDDFPRYDDDDDDDDDD) SEQIDNO:21. SDSDD SEQIDNO:22. DSSDSSDSSDSSDSSDSS SEQIDNO:23.PTH1-34E10 (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFEEEEEEEEEE) SEQIDNO:24.PTHrP1-36E10 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIEEEEEEEEEE) SEQIDNO:25.PTHrP1-39E20 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAGIRATCMalEEEE EEEEEEEEEEEEEEEE), whereinMalismaleimideinallsequences presentedherein. SEQIDNO:26.F109CconjugatedwithD10 (YKRSRYTCMalDDDDDDDDDD) SEQIDNO:27.F109CconjugatedwithD20 (YKRSRYTCMalDDDDDDDDDDDDDDDDDDDD) SEQIDNO:28.F109CconjugatedwithE10 (YKRSRYTCMalEEEEEEEEEE) SEQIDNO:29.F109CconjugatedwithE20 (YKRSRYTCMalEEEEEEEEEEEEEEEEEEEE) SEQIDNO:30.F109CconjugatedwithAAD10 (YKRSRYTCMalXXXXXXXXXX, whereinXisadipicacid) SEQIDNO:31.F109CconjugatedwithSDSDD (YKRSRYTCMalSDSDD). SEQIDNO:32.F109Cconjugatedwith(DSS)6 (YKRSRYTCMalDSSDSSDSSDSSDSSDSS) SEQIDNO:33.PACAPCconjugatedwithD10 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalDDDDD DDDDD) SEQIDNO:34.PACAPCconjugatedwithD20 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalDDDDD DDDDDDDDDDDDDDD) SEQIDNO:35.PACAPCconjugatedwithE10 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalEEEEE EEEEE) SEQIDNO:36.PACAPCconjugatedwithE20 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalEEEEE EEEEEEEEEEEEEEE) SEQIDNO:37.PACAPCconjugatedwithAAD10 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalXXXXX XXXXX,whereinXisadipicacid). SEQIDNO:38.PACAPCconjugatedwithSDSDD (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalSDS DD). SEQIDNO:39.PACAPCconjugatedwith(DSS).sub.6 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalDSSDS SDSSDSSDSSDSS) SEQIDNO:40.CTCCconjugatedwithD10 (YIAGVGGEKSGGFYCMalDDDDDDDDDD) SEQIDNO:41.CTCCconjugatedwithD20 (YIAGVGGEKSGGFYCMalDDDDDDDDDDDDDDDDDDDD) SEQIDNO:42.CTCCconjugatedwithE10 (YIAGVGGEKSGGFYCMalEEEEEEEEEE) SEQIDNO:43.CTCCconjugatedwithE20 (YIAGVGGEKSGGFYCMalEEEEEEEEEEEEEEEEEEEE) SEQIDNO:44.CTCCconjugatedwithAAD10 (YIAGVGGEKSGGFYCMalXXXXXXXXXX, whereinXisadipicacid) SEQIDNO:45.CTCCconjugatedwithSDSDD (YIAGVGGEKSGGFYCMalSDSDD). SEQIDNO:46.CTCCconjugatedwith(DSS).sub.6 (YIAGVGGEKSGGFYCMalDSSDSSDSSDSSDSSDSS) SEQIDNO:47.Ck2.3CconjugatedwithD10 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalDDDDDDDDDD) SEQIDNO:48.Ck2.3CconjugatedwithD20 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalDDDDDDDDDDDD DDDDDDDD) SEQIDNO:49.Ck2.3CconjugatedwithE10 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalEEEEEEEEEE) SEQIDNO:50.Ck2.3CconjugatedwithE20 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalEEEEEEEEEEEEEE EEEEEE) SEQIDNO:51.Ck2.3CconjugatedwithAAD10 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalXXXXXXXXXX, whereinXisadipicacid). SEQIDNO:52.Ck2.3CconjugatedwithSDSDD (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalSDSDD) SEQIDNO:53.Ck2.3Cconjugatedwith(DSS).sub.6 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalDSSDSSDSSDSS DSSDSS) SEQIDNO:54.ODPCconjugatedwithD10 (DVDVPDGRGDSLAYGCMalDDDDDDDDDD) SEQIDNO:55.ODPCconjugatedwithD20 (DVDVPDGRGDSLAYGCMalDDDDDDDDDDDDDDDDDDDD) SEQIDNO:56.ODPCconjugatedwithE10 (DVDVPDGRGDSLAYGCMalEEEEEEEEEE) SEQIDNO:57.ODPCconjugatedwithE20 (DVDVPDGRGDSLAYGCMalEEEEEEEEEEEEEEEEEEEE) SEQIDNO:58.ODPCconjugatedwithAAD10 (DVDVPDGRGDSLAYGCMalXXXXXXXXXX, whereinXisadipicacid) SEQIDNO:59.ODPCconjugatedwithSDSDD (DVDVPDGRGDSLAYGCMalSDSDD). SEQIDNO:60.ODPCconjugatedwith(DSS).sub.6 (DVDVPDGRGDSLAYGCMalDSSDSSDSSDSSDSSDSS) SEQIDNO:61.P4CconjugatedwithD10 (KIPKASSVPTELSAISTLYLCMalDDDDDDDDDD) SEQIDNO:62.P4CconjugatedwithD20 (KIPKASSVPTELSAISTLYLCMalDDDDDDDDDDDDDDDDDDDD) SEQIDNO:63.P4CconjugatedwithE10 (KIPKASSVPTELSAISTLYLCMalEEEEEEEEEE) SEQIDNO:64.P4CconjugatedwithE20 (KIPKASSVPTELSAISTLYLCMalEEEEEEEEEEEEEEEEEEEE) SEQIDNO:65.P4CconjugatedwithAAD10 (KIPKASSVPTELSAISTLYLCMalXXXXXXXXXX, whereinXisadipicacid) SEQIDNO:66.P4CconjugatedwithSDSDD (KIPKASSVPTELSAISTLYLCMalSDSDD). SEQIDNO:67.P4Cconjugatedwith(DSS).sub.6 (KIPKASSVPTELSAISTLYLCMalDSSDSSDSSDSSDSSDSS) SEQIDNO:68.BranchedD4Y (YPegKDDDDDDDD, whereinPegispolyethyleneglycol) SEQIDNO:69.BranchedD8Y (YPegKDDDDDDDDDDDDDDDD, whereinPegispolyethyleneglycol) SEQIDNO:70.F109Cconjugatedwithbranched D10 (YKRSRYTCMalK[DDDDDDDDDD].sub.2). SEQIDNO:71.PACAPCconjugatedwithbranched D10 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMal[DDDD DDDDDD].sub.2) SEQIDNO:72.CTCCconjugatedwithbranchedD10 (YIAGVGGEKSGGFYCMalK[DDDDDDDDDD].sub.2) SEQIDNO:73.Ck2.3Cconjugatedwithbranched D10 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalK[DDDDDDDDDD].sub.2) SEQIDNO:74.ODPCconjugatedwithbranchedD10 (DVDVPDGRGDSLAYGCMalK[DDDDDDDDDD].sub.2) SEQIDNO:75.P4CconjugatedwithbranchedD10 (KIPKASSVPTELSAISTLYLCMalK[DDDDDDDDDD].sub.2) SEQIDNO:76.F109Cconjugatedwithbranched E10 (YKRSRYTCMalK[EEEEEEEEEE].sub.2) SEQIDNO:77.PACAPCconjugatedwithbranched E10 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMalK[EEE EEEEEEE].sub.2) SEQIDNO:78.CTCCconjugatedwithbranchedE10 (YIAGVGGEKSGGFYCMalK[EEEEEEEEEE].sub.2) SEQIDNO:79.Ck2.3Cconjugatedwithbranched E10 (RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalK[EEEEEEEEEE].sub.2) SEQIDNO:80.ODPCconjugatedwithbranchedE10 (DVDVPDGRGDSLAYGCMalK[EEEEEEEEEE].sub.2) SEQIDNO:81.P4CconjugatedwithbranchedE10 (KIPKASSVPTELSAISTLYLCMalK[EEEEEEEEEE].sub.2)

    DETAILED DESCRIPTION

    [0115] While the concepts of the present disclosure are illustrated and described in detail in the figures and the description herein, results in the figures and their description are to be considered as exemplary and not restrictive in character; it being understood that only the illustrative embodiments are shown and described and that all changes and modifications that come within the spirit of the disclosure are desired to be protected.

    [0116] Unless defined otherwise, the scientific and technology nomenclatures have the same meaning as commonly understood by a person in the ordinary skill in the art pertaining to this disclosure.

    [0117] As used herein, unless explicitly stated otherwise or clearly implied otherwise the term about refers to a range of values plus or minus 10 percent, e.g. about 1.0 encompasses values from 0.9 to 1.1.

    [0118] The term, treating as used herein unless stated or implied otherwise, includes administering to a human or an animal patient at least one dose of a compound, treating includes preventing or lessening the likelihood and/or severity of at least one disease as well as limiting the length of an illness or the severity of an illness, treating may or may not result in a cure of the disease.

    [0119] As used herein, unless explicitly stated otherwise or clearly implied otherwise the terms therapeutically effective dose, therapeutically effective amounts, and the like, refer to a portion of a compound that has a net positive effect on health and well being of a human or other animal. Therapeutic effects may include an improvement in longevity, quality of life and the like these effects also may also include a reduced susceptibility to developing disease or deteriorating health or well being. The effects may be immediate realized after a single dose and/or treatment or they may be cumulative realized after a series of doses and/or treatments. A therapeutically effective amount in general means the amount that, when administered to a subject or animal for treating a disease, is sufficient to affect the desired degree of treatment for the disease.

    [0120] As used herein, inhibition or inhibitory activity each encompass whole or partial reduction of activity or effect of an enzyme or all and/or part of a pathway that includes an enzyme that is effected either directly or indirectly by the inhibitor or a pathway that is effected either directly or indirectly by the activity of the enzyme which is effected either directly or indirectly by the inhibitor.

    [0121] As used herein, the term pharmaceutically acceptable salt is defined as a salt wherein the desired biological activity of the inhibitor is maintained and which exhibits a minimum of undesired toxicological effects. Non-limiting examples of such a salt are (a) acid addition salts formed with inorganic acids (e.g., hydrochloric acid, hydrobromic acid, sulphuric acid, phosphoric acid, nitric acid, and the like), and salts formed with organic acids (such as e.g. acetic acid, oxalic acid, tartaric acid, succinic acid, malic acid, ascorbic acid, benzoic acid, tannic acid, palmitic acid, polyglutamic acid, naphthalene sulphonic acid, naphthalene disulphonic acid, polygalacturonic acid and the like); (b) base additional salts formed with metal cations such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, cadmium, sodium, potassium and the like, or with a cation formed from ammonia, N,N-dibenzylethylenediamine, D-glucosamine, tetraethylammonium or ethylenediamine; or (c) combinations of (a) and (b); e.g. a zinc tannate or the like.

    [0122] Pharmaceutically acceptable salts include salts of compounds of the invention that are safe and effective for use in mammals and that possess a desired therapeutic activity. Pharmaceutically acceptable salts include salts of acidic or basic groups present in compounds of the invention. Pharmaceutically acceptable acid addition salts include, but are not limited to, hydrochloride, hydrobromide, hydroiodide, nitrate, sulfate, bisulfate, phosphate, acid phosphate, isonicotinate, acetate, lactate, salicylate, citrate, tartrate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate and pamoate (i.e., 1,1-methylene-bis-(2-hydroxy-3-naphthoate)) salts. Certain compounds of the invention may form pharmaceutically acceptable salts with various amino acids. Suitable base salts include, but are not limited to, aluminum, calcium, lithium, magnesium, potassium, sodium, zinc, and diethanolamine salts. For additional information on some pharmaceutically acceptable salts that can be used to practice the invention please reviews such as Berge, et al., 66 J. PHARM. SCI. 1-19 (1977), Haynes, et al, J. Pharma. Sci., Vol. 94, No. 10, October 2005, pgs. 2111-2120 and See, e.g., P. Stahl, et al., Handbook of Pharmaceutical Salts: Properties, Selection and Use, (VCHA/Wiley-VCH, 2002); S. M. Berge, et al., Pharmaceutical Salts, Journal of Pharmaceutical Sciences, Vol. 66, No. 1, January 1977.

    [0123] Pharmaceutical formulation: The compounds of the invention and their salts may be formulated as pharmaceutical compositions for administration. Such pharmaceutical compositions and processes for making the same are known in the art for both humans and non-human mammals. See, e.g., remington: The Science and practice of pharmacy, (A. Gennaro, et al., eds., 19.sup.th ed., Mack Publishing Co., 1995). Formulations can be administered through various means, including oral administration, parenteral administration such as injection (intramuscular, subcutaneous, intravenous, intraperitoneal) or the like; transdermal administration such as dipping, spray, bathing, washing, pouring-on and spotting-on, and dusting, or the like. Additional active ingredients may be included in the formulation containing a compound of the invention or a salt thereof.

    [0124] The pharmaceutical formulations of the present invention include those suitable for oral, parenteral (including subcutaneous, intradermal, intramuscular and intravenous) and rectal administration. The formulations may be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing into association the active ingredient, i.e., the compound or salt of the present invention, with the carrier. In general, the formulations are prepared by uniformly and intimately bringing into association the active ingredient with a liquid carrier or, a finely divided solid carrier or both, and then, if necessary, forming the associated mixture into the desired formulation.

    [0125] The pharmaceutical formulations of the present invention suitable for oral administration may be presented as discrete units, such as a capsule, cachet, tablet, or lozenge, each containing a predetermined amount of the active ingredient; as a powder or granules; as a solution or a suspension in an aqueous liquid or non-aqueous liquid such as a syrup, elixir or a draught, or as an oil-in-water liquid emulsion or a water-in-oil liquid emulsion. The formulation may also be a bolus, electuary or paste.

    [0126] The pharmaceutical formulations of the present invention suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions, and may also include an antioxidant, buffer, a bacteriostat and a solution which renders the composition isotonic with the blood of the recipient, and aqueous and non-aqueous sterile suspensions which may contain, for example, a suspending agent and a thickening agent. The formulations may be presented in a single unit-dose or multi-dose containers, and may be stored in a lyophilized condition requiring the addition of a sterile liquid carrier prior to use.

    [0127] Pharmaceutically acceptable carrier: Pharmaceutically acceptable carrier, unless stated or implied otherwise, is used herein to describe any ingredient other than the active component(s) that maybe included in a formulation. The choice of carrier will to a large extent depend on factors such as the particular mode of administration, the effect of the carrier on solubility and stability, and the nature of the dosage form.

    [0128] A tablet may be made by compressing or moulding the active ingredient with the pharmaceutically acceptable carrier. Compressed tablets may be prepared by compressing in a suitable machine the active ingredient in a free-flowing form, such as a powder or granules, in admixture with, for example, a binding agent, an inert diluent, a lubricating agent, a disintegrating and/or a surface active agent. Moulded tablets may be prepared by moulding in a suitable machine a mixture of the powdered active ingredient moistened with an inert liquid diluent. The tablets may optionally be coated or scored and may be formulated so as to provide slow or controlled release of the active ingredient.

    [0129] As used herein, bone related diseases include, but are not limited to, osteopenia, osteoporosis, rheumatoid arthritis, hematologic, autoimmunity, transplant rejection, bone cancer, and/or bone fracture.

    [0130] As described herein, a therapeutic affinity index is an affinity range of a therapeutic ligand, usually expressed by IC50 of the therapeutic ligand or agonists thereof to engage a receptor mediated signaling cascade (event) to achieve the desired therapeutic effect. For example, if a ligand has a IC50 of 4 nM-15 nM to trigger a G-protein coupled receptor mediated response that achieve the ligand's therapeutic effect, then the ligand has a therapeutic affinity index of IC50 about 4 nM to about 15 nM. Therapeutic affinity index may be complicated when the therapeutic ligand has different modes of actions to achieve its different therapeutic effects. For example, if the receptor for the therapeutic ligand has two different conformations, each conformation may have a distinct therapeutic affinity index.

    [0131] As used herein, unless explicitly stated otherwise or clearly implied otherwise the terms PTHrP1-46D10, PTHrP D10, and targeted PTHrP can be used interchangeably to define the same compound.

    [0132] As used herein, unless explicitly stated otherwise or clearly implied otherwise the terms PTHrP1-34, PTHrP, free PTHrP, and non-targeted PTHrP can be used interchangeably to define the same compound.

    [0133] Osteoporosis is defined as low bone mineral density and/or poor bone microarchitecture associated with increased risk of fractures. This chronic disease mainly affects postmenopausal women, but it may also older men. This disease is increasingly being considered an age-related morbidity. The skeletal alterations observed in patient with in osteoporosis are a consequence of a relative deficit of bone formation relative to bone resorption. Osteoporosis therapies have mostly relied on antiresorptive drugs. One current, an alternative therapeutic approach for treating osteoporosis, is based on the intermittent administration of parathyroid hormone (PTH). PTH is secreted by the chiefly by cells of the parathyroid glands as a prohormone polypeptide that include 84 amino acids. An effective hormone-receptor interaction only requires the 34-N-terminal amino acids. PTH acts to increase the concentration of ionic calcium (Ca.sup.2+) in the blood. PTH essentially acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor, which is present at high levels in bone and kidney. The protein hPTH-(1-34) crystallizes as a slightly bent, long helical dimer. Analysis reveals that the extended helical conformation of hPTH-(1-34) is the likely bioactive conformation. The N-terminal fragment (1-34 of parathyroid hormone (PTH) has been crystallized and the structure has been refined to 0.9 resolution.

    [0134] Bone anabolism caused by PTH therapy is mainly accounted for by the ability of PTH to increase osteoblastogenesis and osteoblast survival. PTH and PTH-related protein (PTHrP)-an abundant local factor in bone-interact with the common PTH type 1 receptor with similar affinities in osteoblasts. Studies mainly in osteoporosis rodent models and limited data in postmenopausal women suggest that N-terminal PTHrP peptides might be considered a promising bone anabolic therapy.

    [0135] Parathyroid hormone/parathyroid hormone-related peptide receptor also known as parathyroid hormone receptor 1 (PTHR1) is a protein that in humans is encoded by the PTHR1 gene. PTHR1 functions as a receptor for parathyroid hormone (PTH) and for parathyroid hormone-related protein (PTHrP).

    [0136] PTHR1 belongs to family B G-protein-coupled receptor (GPCR) that is expressed primarily in bone, kidney and cartilage but also in other tissues including the vasculature and certain developing organs.

    [0137] N-terminal fragments consisting of the first 34 residues of PTH and PTHrP are generally thought to contain the key functional determinants of receptor interaction present in the corresponding full-length, mature polypeptide chains, which also includes 84 and 141 amino acid residues, respectively. PTH and PTHrP are distinct among the family B peptide ligands in that they include extended C-terminal segments. The biological roles of these segments remains obscure, although some functional responses have been identified, such as a capacity of fragments corresponding to the C-terminal portion of PTH to induce pro-apoptotic effects in osteocytes17 and of fragments encompassing the mid-region of PTHrP.

    [0138] Membrane binding assays developed to evaluate the affinity of ligands for PTHR1 in conformations formed upon coupling to a heterotrimeric G protein (R.sup.G conformation) or when PTHR1 is not coupled to a G protein (R.sup.0 conformation) provided the initial clues that structurally distinct PTH and PTHrP analogues can bind with altered affinities to the different receptor conformational states. Direct comparative studies of PTH(1-34) and PTHrP(1-36) demonstrated that although these two peptides maintain similar affinity for the R.sup.G state, they do not have the same affinity for the R.sup.0 state, with PTH(1-34) displaying a much higher affinity for R.sup.0 than PTHrP(1-36).

    [0139] Abaloparatide, PTHrP, and PTH share high homology in the first 13 amino acids of each protein. As long as each active anabolic drug comprises a peptide that triggers signaling by the parathyroid hormone and includes or contains a minimum homology at residues of 2, 3, 4, 6, 7, 9, 12 and 13, anabolic peptide variants can be combined with various linkers, optionally spacers and targeting ligands described in this disclosure to effect targeted delivery of bone fracture healing agent.

    [0140] The functional consequences of this altered selectivity were typically revealed in cAMP assays. PTH(1-34) and PTHrP(1-36) had similar potencies in conventional cAMP dose-response assays (in accordance with their similar affinities for the R.sup.G state and a GS-mediated mechanism of intracellular cAMP production). However, the duration of the responses induced by the two ligands (assessed using a time-course washout assay) was different, with PTH(1-34) showing a more prolonged response than PTHrP(1-36). In general, the duration of the cAMP responses observed in the cell-based studies correlate with the different affinities that PTH(1-34) and PTHrP(1-36) exhibit for the R.sup.0 state, rather than with their affinities for the R.sup.G state, as assessed in membrane assays. As the R.sup.0 state is not coupled to a G protein and, hence, is inactive with regard to cAMP signaling, it may be that although R.sup.0 complexes are fairly stable over time they can isomerizes to a functional G-protein-coupled state.

    [0141] One key structural determinant of R.sup.0 versus R.sup.G affinity that differs between PTH and PTHrP ligands can be traced to the identity of the residue at position 5; thus, replacing His5 in PTHrP(1-36) with the corresponding isoleucine of PTH markedly enhances affinity for R.sup.0 and extends the duration of the cAMP signaling response induced in target cells.

    [0142] Currently, PTH, PTHrP or their agonists are tested for either local or systematic administration to provide anabolic agent to heal any bone fracture. However these tests have revealed that there are side effects to the use of those proteins. For example, local application of PTH or PTHrP requires exposing the bone and resulted in with increased healing time, pain and discomfort, and even the possibility of infection. Alternatively, systematic application of PTH and PTHrP tend to have off target effects, including an increase in blood calcium levels. Therefore, the development of a bone anabolic agent delivery system that and may mitigate the above referenced side effects is desirous.

    [0143] A drug delivery system comprising a drug, a linker and a targeting ligand is disclosed herein. Some aspects of the present disclosure provide compounds for targeting and healing of bone fractures. These compounds may comprise at least three distinct structural/functional regions: an effective anabolic peptide or any agonist that engages parathyroid hormone receptor 1 (PTHR1) and subsequent signaling cascade that leads to the healing; a linker with or without a spacer to provide a flexible arm length for the anabolic peptide to reach the bone fracture site; and a targeting ligand which typically comprises a negatively charged oligopeptide or its equivalent to guide the compound to the fracture site and specifically bind to hydroxyapatite and/or raw bone. In one particular aspect, the drug may be the first 34 amino acids in parathyroid hormone related peptide (PTHrP). The linker can include amino acid 35-46 of PTHrP, which spaces the drug from the targeting ligand and also gives leeway to the length of the drug, as some believe that amino acid 35-40 may increase receptor binding. Finally, the targeting ligand can include aspartic acid decapeptide, although other polymers functionalized by carboxylic acid are likely to bind in a similar manner (e.g. D or L glutamic acid, D or Laspartic acid and Aminohexanedioic acid in various combinations and arrangements).

    [0144] A peptide comprising SEQ ID NO:3 (Abaloparatide 1-34) with residue 29 methyl Ala, and residue 34 aminated can serve as a potent active anabolic agent without further linker or targeting ligand to treat bone fracture.

    [0145] It is conceivable that PTH and PTHrP may have variants possessing agonistic activity of PTHR1 and be used in place of PTH or PTHrP to engage and achieve a therapeutic effect of bone fracture healing. As long as each active anabolic drug comprises a peptide that triggers signaling by the parathyroid hormone and includes or contains a minimum homology at residues of 2, 3, 4, 6, 7, 9, 12 and 13, the proposed anabolic peptide variants may be combined with various linkers, optionally spacers and targeting ligands described in this disclosure to effect targeted delivery of bone fracture healing agent. For example, conservative substitutions or modifications at residues 1, 5, 10, 11, or 14-34 for PTH or PTHrP along with any combinations of herein described linker sequence and targeting ligand are contemplated for the protection in this disclosure.

    [0146] In one aspect of the present disclosure, the targeting ligand comprises an acidic oligopeptide comprising a plurality of aspartic acid residues. The number of D or L aspartic acid residues may be from about 4 to about 10, or from about 10 to about 20 residues. The oligopeptide may be linear or it may be branched. In one illustrative embodiment, a lysine residue is used as the branch point. In another aspect of the present invention, the aspartic acid may be either L-aspartic acid, D-aspartic acid or a mixture of either enantiomer. An advantage of including the D-aspartic acid in the oligopeptide is that it may be less susceptible to proteolytic degradation as compared to an oligopeptide comprising only the naturally-occurring L-aspartic acid.

    [0147] In other aspect of the present disclosure, the acidic oligopeptide may be no more than 20 L or D-glutamic acid. In yet another aspect of the present disclosure, the acidic oligopeptide may be the combination of no more than 20 L or D-aspartic acid, or L or D-glutamic acid.

    [0148] In some aspect of the present disclosure, the targeting ligand may be polyphosphate or at least one bisphosphate. In yet other aspect of the present disclosure, the targeting ligand may be a collagen mimetic peptide. Such collagen mimetic peptide intercalates imperfect collagen fibrils at bone fracture site. In one aspect of the present disclosure, the collagen mimetic peptide may have the structure of [Gly-Pro-Hyp].sub.9-OH.

    [0149] In some aspect of the present disclosure, the targeting ligand may be aminohexanedioic acid (alpha-aminoadipic acid) or its derivatives with more than one carbon between the backbone and the acid. For example, the targeting ligand may be 2-aminomalonic acid.

    [0150] In some aspect of the present disclosure, the targeted delivery compound further comprises at least one spacer comprising PEG (polyethylene glycol).

    [0151] Between the active anabolic compound such as PTH or PTHrP or their respective agonists and the targeting ligand, there can be a flexible length of linker sequence. In some aspect of the disclosure, the linker may be any portion of the extension of PTH or PTHrP's active fragment, namely from residues 35-84 of PTH or 35-173 of PTHrP. Such extension of the active fragment is usually non-releasable and the linker sequence can be any portion of the extension or the combinations of different portions of the extension.

    [0152] In some other aspect of the disclosure, the linker can be a hydrolysable substrate sensitive to at least one abundant moiety produced in an osteoclast during bone remodeling. For example, Cathespin K is a moiety that is produced in an osteoclast during bone remodeling. A linker sequence comprising Gly-Gly-Pro-Nle (where Nle is norleucine, Leucine, isoleucine or any other equivalent with hydrophobic modification may serve as the substrate of Cathespin K. Once the targeted compound is delivered at osteoclast site, Cathespin K may hydrolyze the linker and release the active anabolic compound to work on the bone healing.

    [0153] Yet another hydrolysable linker may comprise disulfide bonds, and it may be released by glutathione at the osteoclast.

    [0154] Yet another hydrolysable linker may be a releasable ester.

    [0155] These features of the current disclosure are further demonstrated by following Examples.

    Material and Methods

    Synthesis

    [0156] Peptides were synthesized by either solid-phase peptide synthesis or by recombinant expression.

    [0157] Solid Phase Peptide Synthesis

    [0158] Briefly, in a solid phase peptide synthesis vial capable of bubbling nitrogen, 2-chlorotrityl resin (1.11 mmol/g) was loaded at 0.4 mmol/g with the first amino acid overnight in DCM and DIPEA. The resin was then capped with four 5 mL washes of DCM/MeOH/DIPEA (17:2:1), followed by three washes of DCM and DMF, respectively. Following each amino acid coupling reaction, Fmoc-groups were removed by three 10 min incubations with 20% (v/v) piperidine in DMF. The resin was then washed 3 with DMF prior to the next amino acid being added. Each amino acid was added in a 5-fold excess with HBTU/DIPEA. Upon completion of the synthesis, peptide were cleaved using 95:2.5:2.5 trifluoroacetic acid:water:triisopropylsilane. Cysteine containing peptides were cleaved using 95:2.5:2.5 and 10 fold excess TCEP trifluoroacetic acid:triisopropylsilane:water:TCEP (tris(2-carboxyethyl)phosphine).

    [0159] Recombinant Protein Expression

    [0160] Ampicillin resistant plasmids were generated containing a T7 promoter, thioredoxin coding sequence, HisTag sequence, tryptophan residue, and peptide coding sequence. Competent cells were transformed with the plasmids and plated on ampicillin containing auger plates. Single colonies were selected and expanded overnight in ampicillin (100 ug/ml) LB media at 37 C. The Competent cells were then expanded further in 11 of ampicillin (100 ug/ml) LB media for 15 hours. At 15 hour IPTG was added to reach a final concentration of 1 mM and the media was agitated at 180 rpm at 37 C for 5 hours. Cells were then pelleted and lysed by sonication in 20 mM Tris-HCL at pH8 containing 6M Guanidine HCl. Fusion protein was then isolated by elution on from a HisTag using imidazole. Fusion protein containing fractions were dialyzed and lyophilized. Proteolytic cleavage was performed using the iodosobenzoic acid method. Final peptide was purified using an anion exchange column, dialyzed, and lyophilized for further used

    [0161] Characterization

    [0162] Peptide molecular weights were confirmed using HPLC/MS.

    [0163] Murine Fracture Induction.

    [0164] All animal studies were done in accordance to Purdue's animal care and use committee protocol and were done performed as described in the literature. CD4 Swiss mice (30-35 g) acquired from Harlan laboratories were used for these experiments. A stabilized femoral fracture was performed under aseptic conditions with isoflurane anesthesia. Skin around the knee was shaved and cleaned with an alcohol pad first, then with Betadine solution. The skin incision was made medial parapetellar. The patella was then dislocated and an incision was made under the patella. A 25 gauge needle was used to ream the intramedullary canal. A 22 gauge locking nail (where both ends are flattened to produce rotational stability), was then inserted. The wound was sutured and the bone was then fractured using a three point bending device that has a built-in stop to prevent excess injury. Subcutaneous Buprenorphine (0.05-0.1 mg/kg) was administered at the time of surgery, followed by a dose every 12 h for 3-7 days post operation.

    [0165] Dosing:

    [0166] Mice were dosed subcutaneously, daily with 31 nmol/kg peptide or saline control. The first dose was administered 6 hours following fracture and continued on throughout the study, the last dose being administered the day before euthanasia.

    [0167] Bone Density Analysis

    [0168] Scanco CT 40 was used to collect CT images and data of bone. The bones were scanned while immersed in PBS to prevent dehydration. ImageJ software was used to analyze the images for bone density, total volume (TV), relative bone volume (BV/TV), trabecular thickness (Tb.Th), and trabecular spacing (Tb.Sp). Volumes of interest included the fracture callus, and both cortical and trabecular bone between the points on the cortical bone at the fracture site.

    [0169] Statistical analyses were calculated using Prism GraphPad software. Data are presented in results as meanstandard error of the mean (SEM). An unpaired student's t-test was used to determine statistical significance, with P-values less than 0.05 being considered statistically significant.

    Example 1. A PTHrP Delivery System for Targeted Bone Fracture Healing

    [0170] In this Example a fracture targeted pharmaceutical comprising a drug, a linker and a targeting ligand were synthesized.

    [0171] The sequence of the pharmaceutical is listed in SEQ ID NO:10, which comprises amino acid residues 1-46 of PTHrP followed by 10-Aspartic acids. As described above, residues 1-34 are the active portion of PTHrP, residues 35-46 are the linker portion of the proposed pharmaceutical for healing bone fracture, and the 10-Aspartic acids are the targeting ligand.

    [0172] The closed femoral fractures were produced in three groups of mice. Mice were dosed daily for 4 weeks with either targeted PTHrP (31 nmol/kg/day). PTHrP1-34 (31 nmol/kg/day) or saline. At the end of the study, mice were euthanized by CO2, femurs were harvested, and bone densities were determined by MicroCT.

    [0173] As shown in FIG. 1, the targeted version of PTHrP increased bone densities around fractures significantly higher than that of free PTHrP and Saline. This indicates that the strategy of using an effective anabolic agent linked to a targeting ligand sequence may work for bone fracture healing.

    [0174] Another way of indicating the progress of bone healing is to measure trabecular spacing data collected from microCT. As shown in FIG. 2, a selection of 100 CT frames (slices) from each fracture callus were analyzed. The stack of frames were chosen from the area of the fracture where the callus was the largest. From left to right the targeted PTHrP (PTHrP1-46 followed by 10 aspartic acids) and saline control. Targeted PTHrP has statistically tighter spacing than does the saline control.

    [0175] Comparing to the traditional single anabolic agent administration, which typically causes high calcium concentrations in blood, the instant application provides an alternative and it is superior to the need of locally applying the bone fracture healing agent. This mitigates the risk of high blood calcium level or bone exposure associated infections etc.

    [0176] It is contemplated that various conservative substitutions to the first 34 amino acids will lead to the same or better bone density recovering in the fractured mice.

    [0177] It is also contemplated that using other portions of PTHrP extension sequences beyond 1-34 may provide similar or better connection to the targeting ligand of 10 Aspartic acids.

    [0178] It is further contemplated that using any linker and targeting ligand described in the instant disclosure. For example, the linker can be variations of the native peptide of PTH sequence, or any Cathepsin K sensitive linker such as Gly-Gly-Pro-Nle where Nle is a norleucine or another hydrophobic amino acid such as leucine or isoleucine. The linker may be a disulfide linker that can be released in a reductive environment. Glutathione is usually released in certain types of injury and may reduce disulfide bonds. It is contemplated a disulfide linker may increase the potency of the anabolic agent. The linker may also be an ester that is hydrolyzed and released to increase the healing efficiency. The targeting ligands are usually acidic oligopeptide chains containing 4 or more acidic amino acid residues and they bind to hydroxyapatite and/or raw bone. These acidic amino acid residues can be any of aspartic or glutamic acid or the combination thereof. In some occasions, acidic oligopeptide may be branched with at least one Lysine to increase the drug accumulation in the fracture site. The branched chains can be multiple branches, such as 2, 3, or 4 etc.

    [0179] Another choice of targeting ligand is one or more bisphosphate, i.e. poly bisphosphate. A collagen mimetic peptide with the sequence of [Gly-Pro-Hyp].sub.9-OH.

    [0180] Yet another choice of targeting ligand is aminohexanedioic acid (alpha-aminoadipic acid) or its derivatives with more than one carbon between the backbone and the acid. For example, 2-aminomalonic acid may be used as the targeting ligand for PTHrP or its variants.

    [0181] A spacer such as PEG (polyethylene glycol) can be added into the synthesized targeted drug delivery system to reduce the probability of the targeting ligand interfering with the anabolic efficiency.

    [0182] For various different combinations of PTHrP variant-linker-targeting ligand choices, the testing of bone density recovery can be performed similarly like described in this Example. Specifically, the synthesized drug-linker-targeting ligand is compared to the PTHrP variant itself and saline for their effect on bone densities around fractures. The targeted version of PTHrP variants is expected to increase bone densities around fracture significantly higher than that of free PTHrP variant and Saline.

    Example 2. Various Different Combinations of Anabolic Drug with Linker Choices and Targeting Ligands to Make Targeted Delivery of the Drug to Bone Fracture for Healing

    [0183] In this Example, the first 34 amino acid of PTH is synthesized with a suitable linker described herein and a suitable targeting ligand. Like in Example 1, the linker may be any segment of the extension of the active PTH, including residues 35-84, or other linkers described in Example 1. The targeting ligand may be any of those described in Example 1. As shown in FIG. 3, the linker is the amino acid residues 36-46 and the targeting ligand is 10 aspartic acid. The synthesized drug-linker-targeting ligand (PTH 1-46D10, SEQ ID NO:11) may be compared to the PTH variant itself and saline for their effect on bone densities around fractures. The targeted version of PTH variants is expected to increase bone densities around fracture significantly higher than that of free PTH variant and Saline. FIG. 3 has shown targeted PTH 1-46D10 is statistically denser than saline controls.

    [0184] It is conceivable some other effective anabolic drugs can be used to replace PTH (1-34) in this Example and achieve the bone fracture healing.

    Example 3. Abaloparatide 1-34 as a Free Standing Bone Fracture Healing Agent

    [0185] In this Example, Abaloparatide 1-34 with modified residues on 29 as Methyl Ala and on 34 as aminated Ala (SEQ ID NO:3) were tested. Abaloparatide has been tested treating osteoporosis to prevent fractures. Its ability to heal actual fractures is being tested, which is a different process. Of course, having Abaloparatide 1-34 linked to the linkers and targeting ligands described in previous Examples will likely increase the bone density at the fracture site, due to the targeted delivery.

    [0186] Referring now to FIG. 1, a selection of 100 CT frames (slices) from each fracture callus were analyzed. CT frames were taken at 4 weeks. The stack of frames was chosen from the area of the fracture where the callus was the largest. From left to right the targeted PTHrP (PTHrP1-46 followed by 10 aspartic acids), free unconjugated PTHrP (PTHrP1-34), and saline control. The targeted version of PTHrP increased bone densities around fractures significantly higher than that of free PTHrP and Saline.

    [0187] Referring now to FIG. 2, narrower spacing is associated higher density bone and can be indicative of progressed healing. CT frames were taken at 4 weeks. A selection of 100 CT frames (slices) from each fracture callus was analyzed. The stack of frames was chosen from the area of the fracture where the callus was the largest. From left to right the targeted PTHrP (PTHrP1-46 followed by 10 aspartic acids) and saline control. Targeted PTHrP has statistically tighter spacing than does the saline control.

    [0188] Referring now to FIG. 3, a selection of 100 CT frames (slices) from each fracture callus were analyzed. CT frames were taken at 2 weeks. The stack of frames was chosen from the area of the fracture where the callus was the largest. From left to right the targeted PTH (PTH 1-46 followed by 10 aspartic acids) and saline control. Targeted PTH is statistically denser than saline controls.

    [0189] Referring now to FIG. 4, alkaline phosphatase (ALP) expression ratio for both targeted and non-targeted PTHrP were analyzed in MC3T3E1 cells. The ALP ratio is calculated by (Treated ALP expression/Vehicle control ALP expression). Higher expression levels are associated with greater osteoblast activity and is a key protein involved in bone mineralization. The addition of targeting ligand does not reduce the efficacy of the drug.

    [0190] Referring now to FIG. 5, osteopontin (OPN) expression ratio for both targeted and non-targeted PTHrP were analyzed in MC3T3E1 cells. The OPN ratio is calculated by (Treated OPN expression/Vehicle control OPN expression). Higher expression levels are associated with greater osteoblast activity and is a key protein involved in bone mineralization. The addition of targeting ligand does not reduce the efficacy of the drug.

    [0191] Referring now to FIG. 6, gene expression ratio of several key bone markers for both targeted and non-targeted PTHrP were analyzed in MC3T3E1 cells. Activity markers include alkaline phosphatase (ALP), Collagen I-alpha (Col1-alpha), osteocalcin (OC), osteoprotegerin (OPG), osteopontin (OPN, and Osterix (OSX). The gene expression ratio is calculated by (Treated gene expression/Vehicle control gene expression). The targeted PTHrP has activity as low as 1 pM.

    TABLE-US-00002 TABLE 1 Effects of the tested compounds on various organs in mice Mouse ID Liver Kidney Targeted Drug No significant lesions No significant lesions Targeted Drug Rare, microscopic mono- nculear aggregates (random) Targeted Drug No significant lesions No significant lesions Targeted Drug Mild to moderate multifocal No significant lesions lymphplasmcytic centrilobular inflammation Targeted Drug No significant lesions Mild lymphoplasmacytic pyelitis Control No significant lesions No significant lesions Control No significant lesions No significant lesions Control No significant lesions Mild lymphoplasmacytic pyelitis Control No significant lesions Mild neutrophilic pyelitis Control Rare, microscopic mono- No significant lesions nculear aggregates (random)

    [0192] Referring now to Table 1, mice were treated with 31 nmol/kg/day subcutaneous injections of PTHrPD10 (Targeted Drug) or saline. Swiss ND4 mice were treated for 28 days. Mice were sacrificed at the end of the study and liver and kidneys were excised. Organs were fixed in formalin and paraffin sections were made from each. A veterinary pathologist performed a randomized blind analysis on the organs. No detectable toxicity was observed. the lesion noted are minimal in significance and unassociated with obvious tissue damage (necrosis). It appears unlikely that the type of lesion would cause clinical signs or illness. They are more likely within the normal limits for these animals.

    [0193] Referring now to FIG. 7, mice were treated with 31 nmol/kg/day subcutaneous injections of PTHrPD10 (targeted) or PTHrP (free). The Swiss ND4 mice were treated for 14, 28, or 56 days. Mice were sacrificed at the end of the dosing period for each study and femurs were excised. Fracture callus densities were measured using a scanco microCT. 100 slice section at the thickest diameter each fracture callus were selected for the measurement. Targeted 2 represents mice dosed by targeted PTHrP for 2 weeks (14 days). Free 2 represents mice dosed by unmodified PTHrP for 2 weeks (14 days). Targeted 4 represents mice dosed by targeted PTHrP for 4 weeks (28 days). Free 4 represents mice dosed by unmodified PTHrP for 4 weeks (28 days). Targeted 8 represents mice dosed by targeted PTHrP for 8 weeks (56 days). Free 8 represents mice dosed by unmodified PTHrP for 8 weeks (56 days). Greater densities can be observed in the targeted PTHrP over the free PTHrP at every time point. The greatest differences between targeted and free PTHrP is at 2 weeks. Those results indicate that the targeted drug not only improves fracture healing but that it also accelerates fracture healing.

    [0194] Referring now to FIG. 8, mice were treated with 31 nmol/kg/day subcutaneous injections of abaloparatide D10 (targeted), abaloparatide (not targeted) and saline. Swiss ND4 mice were treated for 28 days. Mice were sacrificed at the end of the study and femurs were excised. Fracture callus densities were measured using a scanco microCT. 100 slice section at the thickest diameter each fracture callus were selected for the measurement. Abaloparatide has been used previously for the treatment of osteoporosis. These results indicate that Abaloparatide can also be used for treating bone fractures. These results indicate that targeted abaloparatide performs better than free abaloparatide.

    [0195] Referring now to FIG. 9, mice were treated with 31 nmol/kg/day subcutaneous injections of PTHrP targeted with polyphosphate or saline. Swiss ND4 mice were treated for 28 days. Mice were sacrificed at the end of the study and femurs were excised. Fracture callus densities were measured using a scanco microCT. 100 slice section at the thickest diameter each fracture callus were selected for the measurement. PTHrP targeted with polyphosphate increases fracture healing compared to Saline.

    [0196] Referring now to FIG. 10, mice were treated with 31 nmol/kg/day subcutaneous injections of PTHrP targeted with a single alendronate, tri-branched alendronate or free PTHrP. Swiss ND4 mice were treated for 28 days. Mice were sacrificed at the end of the study and femurs were excised. Fracture callus densities were measured using a scanco microCT. 100 slice section at the thickest diameter each fracture callus were selected for the measurement. PTHrP targeted either a single alendronate or tri-branched alendronate increases fracture healing compared to free PTHrP.

    Example 4

    [0197] Targeting ligands can include, but are not limited to, oligo acidic amino acids. Exemplary oligo acidic amino acids include, but are not limited to, a linear polymer of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, and/or 30 aspartic acids comprising L and/or D amino acids, a linear polymer of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, and/or 30 glutamic acids comprising L and/or D amino acids, a linear polymer of 10 acidic amino acids comprising L and/or D acidic amino acids, a branched polymer of aspartic acids with 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and/or 20 residues on each branch comprising L and/or D amino acids, a branched polymer of glutamic acids with 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and/or 20 residues on each branch comprising L and/or D amino acids and/or a branched polymer of acidic amino acids with 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and/or 20 residues on each branch comprising L and/or D acidic amino acids. Referring now to FIGS. 11-12, exemplary linear and branched polymers of acidic amino acids are shown. FIG. 13 provides exemplary targeting ligands that are not derived from amino acids.

    [0198] Targeting ligands are coupled with a maleimide-containing linker. The targeting ligands having a maleimide-containing linker are further conjugated with various peptides having distinct chemical properties via a cysteine maleimide coupling process. These peptides can comprise, but are not limited to, a sequence representing a heparin-binding domain of FGF2 (SEQ ID NO: 14), a sequence representing a pituitary adenylate cyclase-activating polypeptide (SEQ ID NO: 15), a sequence representing a chemotactic cryptic peptide derived from the CTX region of collagen type III (SEQ ID NO: 16), a sequence representing a casein kinase 2 beta chain (SEQ ID NO: 17), a sequence representing a osteopontin-derived peptide (SEQ ID NO: 18), and/or a sequence representing a P4-BMP2 (SEQ ID NO: 19). The conjugated peptides are iodinated via Pierce iodination reagent, where .sup.125I is covalently bound to the histidine, tyrosine and/or tryptophan residues of the conjugated peptides.

    [0199] The F109C conjugated with branched D10 has the formula,

    TABLE-US-00003 YKRSRYTCMalK[DDDDDDDDDD].sub.2 (seealsoSEQIDNO:70).

    [0200] The PACAPC conjugated with branched D10 has the formula,

    TABLE-US-00004 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMal K[DDDDDDDDDD].sub.2 (seealsoSEQIDNO:71).

    [0201] The CTCC conjugated with branched D10 has the formula,

    TABLE-US-00005 YIAGVGGEKSGGFYCMalK[DDDDDDDDDD].sub.2 (seealsoSEQIDNO:72).

    [0202] The Ck2.3C conjugated with branched D10 has the formula,

    TABLE-US-00006 RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalK[DDDDDDDDDD].sub.2 (seealsoSEQIDNO:3).

    [0203] The ODPC conjugated with branched D10 has the formula,

    TABLE-US-00007 DVDVPDGRGDSLAYGCMalK[DDDDDDDDDD].sub.2 (seealsoSEQIDNO:74).

    [0204] The P4C conjugated with branched D10 has the formula,

    TABLE-US-00008 KIPKASSVPTELSAISTLYLCMalK[DDDDDDDDDD].sub.2 (seealsoSEQIDNO:75).

    [0205] The F109C conjugated with branched E10 has the formula,

    TABLE-US-00009 YKRSRYTCMalK[EEEEEEEEEE].sub.2 (seealsoSEQIDNO:76).

    [0206] The PACAPC conjugated with branched E10 has the formula,

    TABLE-US-00010 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKCMal K[EEEEEEEEEE].sub.2 (seealsoSEQIDNO:77).

    [0207] The CTCC conjugated with branched E10 has the formula,

    TABLE-US-00011 YIAGVGGEKSGGFYCMalK[EEEEEEEEEE].sub.2 (seealsoSEQIDNO:78).

    [0208] The Ck2.3C conjugated with branched E10 has the formula,

    TABLE-US-00012 RQIKIWFQNRRMKWKKIPVGESLKDLIDQCMalK[EEEEEEEEEE].sub.2 (seealsoSEQIDNO:79).

    [0209] The ODPC conjugated with branched E10 has the formula,

    TABLE-US-00013 DVDVPDGRGDSLAYGCMalK[EEEEEEEEEE].sub.2 (seealsoSEQIDNO:80).

    [0210] The P4C conjugated with branched E10 has the formula,

    TABLE-US-00014 KIPKASSVPTELSAISTLYLCMalK[EEEEEEEEEE].sub.2 (seealsoSEQIDNO:81).

    [0211] Referring now to FIGS. 14A and 14B, adult female Swiss Weber mice were injected with 1 mCi of .sup.125I labeled conjugates 10 days post osteotomy. A cysteine tyrosine dipeptide is coupled to a maleimide linker. The cysteine tyrosine dipeptide having a maleimide linker is conjugated to each of the indicated targeting ligands. PTHrP_ASP10 represents a conjugated peptide having 1-46 of PTHrP with a linear polymer of 10 aspartic acids. Preptin_Asp10 represents a conjugated peptide having 1-16 of preptin with a linear polymer of 10 aspartic acids. A necropsy 24 hours post injections was performed and tissues were excised. The tissues were then counted via a gamma counter. The relative counts of the fractured femur over the healthy femur are displayed here as a ratio.

    [0212] Referring now to FIG. 15, adult female Swiss Weber mice were injected subcutaneously with LS288 conjugated to a linear polymer of 10 L-aspartic acids 10 days post osteotomy on the right femur. The mouse was imaged via a 1 sec 780 nm excitation beam. Emission fluorescence was collected at 810 nm for 1 second. The injection site was near the back of the mouse, and therefore, the mouse exhibits high fluorescence in the back.

    [0213] Referring now to FIG. 16, adult female Swiss Weber mice were injected subcutaneously with LS288 conjugated to a linear polymer of 10 L-aspartic acids at 3, 6, and 10 days post osteotomy on the right femur. The mouse was imaged via a 1-second 780 nm excitation beam. Emission fluorescence was collected at 810 nm for 1 second. The top row represents 10 days post fracture, the middle row represents 6 days post fracture, and the bottom row represents 3 days post fracture. The femur on the left in every group is the fractured femur compared to the healthy femur on the right. This demonstrates that fracture targeting improves during the healing process.

    [0214] Referring now to FIG. 17, adult Swiss Weber mice were injected with 0.25 mCi of radiolabeled .sup.125I PreptinD10 conjugate 10 days post osteotomy and sacrificed at the different time points. Each tissue was collected and then quantified with a gamma counter (FIG. 17A). Fold difference of relative counts between fractured femur and healthy femur using radiolabeled .sup.125I PreptinD10 were calculated at different time points (FIG. 17B).

    [0215] Referring now to FIGS. 18 and 19, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I conjugated peptides 10 days post osteotomy. 14 hours post injection each mouse was sacrificed and each of the listed organs were collected and quantified. The counts were standardized to the weight of the samples. Fold difference of relative counts between fractured femur and healthy (non-fractured) femur for each conjugated peptides were calculated.

    [0216] Referring now to FIG. 20, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, F109C, and PACAPC) conjugated with L-Asp10 (FIG. 20A), D-Asp10 (FIG. 20B), or L-Asp20 (FIG. 20C) 10 days post osteotomy. 14 hours post injection each mouse was sacrificed and each of the listed organs were collected and quantified. The counts were standardized to the weight of the samples. All of the conjugated peptides tested exhibited preferential and/or selective targeting towards to fractured bone over other organs.

    [0217] Referring now to FIG. 21, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, and F109C) conjugated with L-Glu10 (FIG. 21A) or D-Glu10 (FIG. 21B) 10 days post osteotomy. 14 hours post injection each mouse was sacrificed and each of the listed organs were collected and quantified. The counts were standardized to the weight of the samples. All of the conjugated peptides tested exhibited preferential and/or selective targeting towards to fractured bone over other organs. Higher signal observed in kidney may be due to the high abundance of glutamate transporters on the kidneys. These transporters are responsible for reabsorption of glutamic acid back into circulation, rather than actual uptake in the cell. This means that the signal will likely degrade over time as opposed to the uptake observed in the fractured femur, where the negatively charged molecules will adhere strongly to the bone (see e.g., FIG. 17). See for more details regarding absorption of glutamic acids, Hediger, M. A. Glutamate transporters in kidney and brain. Am. J. Physiol.Ren. Physiol. 277, F487-F492 (1999); Kanai, Y. & Hediger, M. A. Primary structure and functional characterization of a high-affinity glutamate transporter. Nature 360, 467-471 (1992); and Kanai, Y. & Hediger, M. A. The glutamate and neutral amino acid transporter family: physiological and pharmacological implications. Eur. J. Pharmacol. 479, 237-247 (2003).

    [0218] Referring now to FIG. 22, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, F109C, and PACAPC) conjugated with L-Glu20 (FIG. 22A) or D-Glu20 (FIG. 22B) 10 days post osteotomy. 14 hours post injection each mouse was sacrificed and each of the listed organs were collected and quantified. The counts were standardized to the weight of the samples. Most of the conjugated peptides tested exhibited preferential and/or selective targeting towards to fractured bone or kidney over other organs. Extending the glutamic polymers to 20 appeared to improve the selectivity towards fractured bone slightly but the kidney uptake is still maintained.

    [0219] Referring now to FIG. 23, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, F109C, and PACAPC) conjugated with branched L-Asp10 (FIG. 23A) or branched D-Asp10 (FIG. 23B) 10 days post osteotomy. 14 hours post injection each mouse was sacrificed and each of the listed organs were collected and quantified. The counts were standardized to the weight of the samples. All of the conjugated peptides tested exhibited preferential and/or selective targeting towards to fractured bone over other organs. Some appeared to have higher uptake in the kidneys.

    [0220] Referring now to FIG. 24, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I peptides (e.g., ODPC, P4C, Ck2.3C, CTCC, F109C, and PACAPC) conjugated with L-AAD10 (FIG. 24A), L-SDSDD (FIG. 24B), or (DSS).sub.6 (FIG. 24C) 10 days post osteotomy. 14 hours post injection each mouse was sacrificed and each of the listed organs were collected and quantified. The counts were standardized to the weight of the samples. Peptides conjugated with L-AAD10 appear to have some targeting ability towards to fractured bone. Peptides conjugated with L-SDSDD exhibited moderate targeting ability towards to fractured bone, and increased uptake in kidney was also observed. Peptides conjugated with (DSS).sub.6 do not appear to have any targeting ability towards to fractured bone.

    [0221] Referring now to FIG. 25A, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I peptides (e.g., PTHrP1-36, and PTH1-34, and PTHrP1-39) conjugated with mono-bisphosphonate, tri-bisphosphonate, polyphosphate, E10, or E20, 10 days post osteotomy. Referring now to FIG. 25B, adult female Swiss Weber mice (12 weeks old) were injected with 0.22 mCi of radiolabeled .sup.125I tyrosine conjugated with mono-bisphosphonate (Monobisphosphonate YC), branched L-Asp4 (Branched (L)D4 Y), or branched L-Asp8 (Branched (L)D8 Y), 10 days post osteotomy.

    [0222] Referring now to FIG. 26, the effects of PTH1-34E10 and saline on bone volume after treatment. Mice were treated daily with PTH1-34E10 for 2 weeks. At two week mice were sacrificed and femurs were excised for microCT analysis.

    [0223] Referring now to FIG. 27, the effects of PTHrPD10 and saline on normalized bone volume after treatment using the indicated doses. Mice were treated daily with PTHrPD10 for 4 weeks. At four week mice were sacrificed and femurs were excised for microCT analysis.

    [0224] The Glutamic acid containing targeting ligands have higher up take in the kidneys than the other targeting ligands tested with uptakes ranging from 20-50% of measured dose per gram. This uptake is likely due glutamic reuptake receptors that are expressed in the kidneys. They are more selective for fractured bone over other bone than other targeting ligands as is indicated by the ratio of fractured to non-fracture delivery ranging from 7-12 in glutamic acid targeting ligands. Extending the glutamic polymers to 20 generated a modest improvement of delivery from the 20-50% of measured dose per gram for the 10mers up to 40-70% of measured dose per gram for the 20mers. This improvement was likely due to the increased affinity the additional glutamic acids brought for the exposed hydroxyapatite at the fracture site. The extended 20mer glutamic acid targeting ligands still suffered from similar kidney uptake issues as the shorter 10mers. Changing from L to D enantiomers appears to have no consistent effect on glutamic acid targeting ligands.

    [0225] The aspartic acid targeting ligands appear to have the highest delivery of the targeting ligands with delivery accumulation ranging from 40-70% of measured dose per gram. However, the aspartic acids targeting ligands appear to be slightly less selective between fractured and non-fractured bone with ratios of fractured bone to non-fractured bone accumulation around 4-6 for L amino acid aspartic acid targeting and 6-9 for D amino acid aspartic acid targeting ligands. However, they don't suffer from as high of accumulation in kidneys as glutamic acid targeting ligands with accumulation of measured dose per gram typically remaining below 15%. Branched does not appear to perform any better than linear versions in its ability to deliver more to the fracture site.

    [0226] Extending the length to 20 from 10 improved the consistency of the targeting ligand across the different types of peptides conjugated with L-Glu20 (labelled, (L)D20), all of the peptides were delivered at 50-70% of measured dose per gram. Changing from L to D enantiomers appears to improve its stability of the aspartic acid targeting ligands and increases targeting as was evident by the higher delivery rates and better selectivity ratios.

    [0227] Peptides conjugated with AAD10 appear to have only moderate targeting abilities. It still maintains a more systemic distribution. But it was still able to maintain an improvement in its ability to deliver 2-5 times as much of the labeled compound to the fractured bone over non-fractured bone. Peptides conjugated with SDSDD appear to have only moderate targeting ability's with deliveries ranging from 20-40%. It still maintains a more systemic distribution. But it was still able to maintain an improvement in its ability to deliver 3-5 times as much of the labeled compound to the fractured bone over non-fractured bone. Peptides conjugated with (DSS).sub.6 appear to have only moderate targeting abilities towards fractured bone. It still maintains a more systemic distribution. But it was still able to maintain an improvement in its ability to deliver 2-3 times as much of the labeled compound to the fractured bone over non-fractured bone.

    [0228] While the novel technology has been illustrated and described in detail in the figures and foregoing description, the same is to be considered as illustrative and not restrictive in character, it being understood that only the preferred embodiments have been shown and described and that all changes and modifications that come within the spirit of the novel technology are desired to be protected. As well, while the novel technology was illustrated using specific examples, theoretical arguments, accounts, and illustrations, these illustrations and the accompanying discussion should by no means be interpreted as limiting the technology. All patents, patent applications, and references to texts, scientific treatises, publications, and the like referenced in this application are incorporated herein by reference in their entirety to the extent they are not inconsistent with the explicit teachings of this specification.