METHODS OF ISOLATING T CELLS HAVING ANTIGENIC SPECIFICITY FOR A P53 CANCER-SPECIFIC MUTATION
20200316121 ยท 2020-10-08
Assignee
Inventors
- Drew C. Deniger (Houston, TX, US)
- Steven A. Rosenberg (Potomac, MD)
- Parisa Malekzadeh (Norfolk, VA, US)
Cpc classification
A61K35/17
HUMAN NECESSITIES
International classification
Abstract
Disclosed are methods of isolating T cells having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising: inducing autologous APCs of the patient to present the mutated p53 amino acid sequence; co-culturing autologous T cells of the patient with the autologous APCs that present the mutated p53 amino acid sequence; and selecting the autologous T cells. Also disclosed are related methods of preparing a population of cells, populations of cells, pharmaceutical compositions, and methods of treating or preventing cancer.
Claims
1. A method of isolating T cells having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising: inducing autologous antigen presenting cells (APCs) of a patient to present at least one mutated p53 amino acid sequence; co-culturing autologous T cells of the patient with the autologous APCs that present the mutated p53 amino acid sequence; and selecting the autologous T cells that (a) were co-cultured with the autologous APCs that present the mutated p53 amino acid sequence and (b) have antigenic specificity for the mutated p53 amino acid sequence presented in the context of a major histocompatability complex (MHC) molecule expressed by the patient to provide isolated T cells having antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation.
2. The method of claim 1, wherein inducing autologous APCs of the patient to present the mutated p53 amino acid sequence comprises pulsing APCs with a peptide comprising the mutated p53 amino acid sequence or a pool of peptides, each peptide in the pool comprising a different mutated p53 amino acid sequence.
3. The method of claim 2, wherein the peptide or pool of peptides comprise(s) one or more mutated p53 peptides of SEQ ID NOs: 2-13.
4. The method of claim 1, wherein inducing autologous APCs of the patient to present the mutated p53 amino acid sequence comprises introducing a nucleotide sequence encoding the mutated p53 amino acid sequence into the APCs.
5. The method of claim 4, wherein the nucleotide sequence introduced into the autologous APCs is a tandem minigene (TMG) construct, each minigene comprising a p53 gene, each p53 gene including a cancer-specific p53 mutation that encodes a mutated p53 amino acid sequence, wherein each p53 gene in the TMG construct encodes a different mutated p53 amino acid sequence.
6. The method of claim 5, wherein the TMG construct encodes one or more mutated p53 peptides of SEQ ID NOs: 2-13.
7. The method of claim 5, wherein the TMG construct encodes the amino acid sequence of SEQ ID NO: 14.
8. The method of claim 1, wherein selecting the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence comprises selectively growing the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence.
9. The method of claim 1, wherein selecting the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence comprises selecting the T cells that express any one or more of programmed cell death 1 (PD-1), lymphocyte-activation gene 3 (LAG-3), T cell immunoglobulin and mucin domain 3 (TIM-3), 4-1BB, OX40, and CD107a.
10. The method of claim 1, wherein selecting the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence comprises selecting the T cells (i) that secrete a greater amount of one or more cytokines upon co-culture with APCs that present the mutated p53 amino acid sequence as compared to the amount of the one or more cytokines secreted by a negative control or (ii) in which at least twice as many of the numbers of T cells secrete one or more cytokines upon co-culture with APCs that present the mutated p53 amino acid sequence as compared to the numbers of negative control T cells that secrete the one or more cytokines.
11. The method of claim 10, wherein the one or more cytokines comprise interferon (IFN)-, interleukin (IL)-2, tumor necrosis factor alpha (TNF-), granulocyte/monocyte colony stimulating factor (GM-CSF), IL-4, IL-5, IL-9, IL-10, IL-17, and IL-22.
12. A method of isolating a T cell receptor (TCR), or an antigen-binding portion thereof, having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising: isolating T cells having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation according to the method of claim 1; and isolating a nucleotide sequence that encodes the TCR, or the antigen-binding portion thereof, from the selected autologous T cells, wherein the TCR, or the antigen-binding portion thereof, has antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation.
13. A method of preparing a population of cells that express a TCR, or an antigen-binding portion thereof, having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising: isolating a TCR, or an antigen-binding portion thereof, according to the method of claim 12, and introducing the nucleotide sequence encoding the isolated TCR, or the antigen-binding portion thereof, into peripheral blood mononuclear cells (PBMC) to obtain cells that express the TCR, or the antigen-binding portion thereof.
14. A method of preparing a population of T cells that have antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising: isolating T cells according to the method of claim 1, and expanding the numbers of selected autologous T cells to obtain a population of T cells that have antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation.
15. The method of claim 14, wherein expanding the numbers of thereof cells comprises culturing the selected cells with feeder PBMC, interleukin (IL)-2, and OKT3 antibody.
16. An isolated population of cells prepared according to the method of claim 13.
17. A pharmaceutical composition comprising the isolated population of cells of claim 16 and a pharmaceutically acceptable carrier.
18. A method of treating or preventing cancer in a patient, the method comprising administering the isolated population of cells of claim 16 to the patient in an amount effective to treat or prevent cancer in the patient.
19. The method according to claim 18, wherein the cancer is an epithelial cancer.
20. The method according to claim 18, wherein the cancer is cholangiocarcinoma, melanoma, colon cancer, rectal cancer, ovarian cancer, endometrial cancer, non-small cell lung cancer (NSCLC), glioblastoma, uterine cervical cancer, head and neck cancer, breast cancer, pancreatic cancer, or bladder cancer.
21. The method according to claim 18, wherein the isolated population of cells is autologous to the patient.
22. The method according to claim 18, wherein the isolated population of cells is allogeneic to the patient.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
DETAILED DESCRIPTION OF THE INVENTION
[0065] Tumor Protein P53 (also referred to as TP53 or p53) acts as a tumor suppressor by, for example, regulating cell division. The p53 protein is located in the nucleus of the cell, where it binds directly to DNA. When DNA becomes damaged, the p53 protein is involved in determining whether the DNA will be repaired or the damaged cell will undergo apoptosis. If the DNA can be repaired, p53 activates other genes to fix the damage. If the DNA cannot be repaired, the p53 protein prevents the cell from dividing and signals it to undergo apoptosis. By stopping cells with mutated or damaged DNA from dividing, p53 helps prevent the development of tumors. Wild-type (WT) full-length p53 comprises the amino acid sequence of SEQ ID NO: 1.
[0066] Mutations in the p53 protein may reduce or eliminate the p53 protein's tumor suppressor function. Alternatively or additionally, a p53 mutation may be a gain-of-function mutation by interfering with wild type p53 in a dominant negative fashion. Mutated p53 protein may be expressed in any of a variety of human cancers such as, for example, cholangiocarcinoma, melanoma, colon cancer, rectal cancer, ovarian cancer, endometrial cancer, non-small cell lung cancer (NSCLC), glioblastoma, uterine cervical cancer, head and neck cancer, breast cancer, pancreatic cancer, or bladder cancer.
[0067] An embodiment of the invention provides a method of isolating T cells having antigenic specificity for a p53 mutated amino acid sequence encoded by a cancer-specific p53 mutation. Mutations of p53 are defined herein by reference to the amino acid sequence of full-length, WT p53 (SEQ ID NO: 1). Thus, mutations of p53 are described herein by reference to the amino acid residue present at a particular position, followed by the position number, followed by the amino acid with which that residue has been replaced in the particular mutation under discussion. For example, when the positions are as defined by SEQ ID NO: 1, the term R175 refers to the arginine present at position 175 of SEQ ID NO: 1, R175H indicates that the arginine present at position 175 of SEQ ID NO: 1 is replaced by histidine, while G245S indicates that the glycine present at position 245 of SEQ ID NO: 1 has been replaced with serine. P53 has nine known splice variants. The p53 mutations described herein are conserved over all nine p53 splice variants. An alignment of the nine p53 splice variants is shown in
[0068] Embodiments of the invention may provide any one or more of many advantages. Mutated p53 is expressed by cancer cells and is not expressed by normal, noncancerous cells. Without being bound to a particular theory or mechanism, it is believed that T cells isolated by the inventive methods advantageously target the destruction of cancer cells while minimizing or eliminating the destruction of normal, non-cancerous cells, thereby reducing, for example, by minimizing or eliminating, toxicity. Moreover, T cells isolated by the inventive methods may, advantageously, successfully treat or prevent mutated p53-positive cancers that do not respond to other types of treatment such as, for example, chemotherapy, surgery, or radiation. Additionally, T cells isolated by the inventive methods may provide highly avid recognition of mutated p53, which may provide the ability to recognize unmanipulated tumor cells (e.g., tumor cells that have not been treated with interferon (IFN)-, transfected with a vector encoding one or both of mutated p53 and the applicable HLA molecule, pulsed with a p53 peptide with the p53 mutation, or a combination thereof). Roughly half of all tumors harbor a mutation in p53, about half of which will be a missense mutation and about 30% of the missense mutations occur at the following hotspot residues: R175H, Y220C, G245D, G245S, R248L, R248Q, R248W, R249S, R273C, R273L, R273H and R282W. Moreover, the same hotspot mutations in p53 (e.g., R175H, Y220C, G245D, G245S, R248L, R248Q, R248W, R249S, R273H, R273C, R273L, or R282W) occur frequently (cumulatively about 30% of the p53 missense mutations) in tumors of unrelated people. Accordingly, T cells isolated by the inventive methods may increase the number of patients who may be eligible for treatment with immunotherapy.
[0069] The inventive methods may be faster, more focused, and more specific as compared to traditional methods of isolating cancer mutation-reactive T cells. Such traditional methods involve identifying gene(s) containing a cancer-specific mutation (e.g., neoantigens) expressed by the patient prior to co-culturing the patient's autologous T cells with the patient's autologous antigen presenting cells which present peptides comprising the cancer-specific mutation encoded by the identified gene(s) as described in, for example, US 2017/0218042 and US 2017/0224800 (hereinafter, traditional screening methods). With the inventive methods, peptides and tandem minigenes (TMG) including p53 mutations can be produced, stocked and validated prior to screening a patient so that once a p53 mutation is identified in a patient's tumor, the patient's T cells can be tested independent of the knowledge of the other mutations in the patient's tumor. This may reduce the time required to carry out the method which may be particularly advantageous when evaluating terminally ill patients. For example, the duration of the inventive methods may be, e.g., about 3 to about 6 weeks shorter than traditional screening methods. The inventive methods may also provide a highly-focused study of p53 mutation responses in the absence of other competing mutations. Without being bound to a particular theory or mechanism, it is believed that pools of peptides or competing peptides in patient mutation-derived TMGs (with mutations in proteins other than p53) can interfere with the mutated p53 peptides and could mask a T cell response. Because the inventive methods focus on mutations in only one gene, p53, the inventive methods may provide increased speed and efficiency in the attempt to identify the p53 mutation-specific T cells and TCRs as compared to traditional screening methods, which involve parsing out the neoantigens in the peptide pool or TMG to determine which neoantigen generated the T cell response. The inventive methods may, advantageously, generate T cells and/or TCRs useful for autologous or allogeneic therapy. By focusing on p53 mutations, it may be possible to identify low frequency responses, which may be diluted in the high throughput of traditional screening methods, and may allow for the identification of T cells and TCRs which otherwise would have been lost in the complexity of screening dozens to hundreds of neoantigens. The inventive methods may be useful for testing T cell responses in a patient independent of the knowledge of whether the patient had the corresponding mutation or even a tumor. The inventive methods may be useful for screening patients with a defined HLA haplotype and predicted p53 mutation binding, but are not limited to screening this type of cohort.
[0070] The cancer-specific p53 mutation may be any mutation in the p53 gene which encodes a mutated p53 amino acid sequence (also referred to as a non-silent mutation) and which is expressed in a cancer cell but not in a noiinal, noncancerous cell. Non-limiting examples of cancer-specific p53 mutations include missense, nonsense, insertion, deletion, duplication, frameshift, and repeat expansion mutations. In a preferred embodiment, the p53 mutation is a missense mutation.
[0071] In an embodiment of the invention, the mutated p53 amino acid sequence comprises a human p53 amino acid sequence with a mutation at position 175, 220, 245, 248, 249, 273, or 282 of SEQ ID NO: 1. The p53 mutation may be any missense mutation. Accordingly, the mutation at position 175, 220, 245, 248, 249, 273, or 282 of SEQ ID NO: 1 may be a substitution of the native (WT) amino acid residue present at position 175, 220, 245, 248, 249, 273, or 282 of SEQ ID NO: 1 with any amino acid residue other than the native (WT) amino acid residue present at the particular position under discussion. In an embodiment of the invention, the mutated p53 amino acid sequence comprises a human p53 amino acid sequence with one of the following human p53 mutations: R17511, Y220C, G245D, G245S, R248L, R248Q, R248W, R249S, R273H, R273C, R273L, or R282W. For example, the mutated p53 amino acid sequence may comprise a mutated p53 amino acid sequence selected from the group consisting of SEQ ID NOs: 2-13.
[0072] The method may comprise inducing autologous antigen presenting cells (APCs) of a patient to present at least one mutated p53 amino acid sequence. The APCs may include any cells which present peptide fragments of proteins in association with major histocompatibility complex (MHC) molecules on their cell surface. The APCs may include, for example, any one or more of macrophages, DCs, Langerhans cells, B-lymphocytes, and T-cells. Preferably, the APCs are DCs. By using autologous APCs from the patient, the inventive methods may, advantageously, identify T cells that have antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation that is presented in the context of an MHC molecule expressed by the patient. The MHC molecule can be any MHC molecule expressed by the patient including, but not limited to, MHC Class I, MHC Class II, HLA-A, HLA-B, HLA-C, HLA-DM, HLA-DO, HLA-DP, HLA-DQ, and HLA-DR molecules. The inventive methods may, advantageously, identify mutated p53 amino acid sequences presented in the context of any MHC molecule expressed by the patient without using, for example, epitope prediction algorithms to identify MHC molecules or mutated p53 amino acid sequences, which may be useful only for a select few MHC class I alleles and may be constrained by the limited availability of reagents to select p53 mutation-reactive T cells (e.g., an incomplete set of MHC tetramers). Accordingly, in an embodiment of the invention, the inventive methods advantageously induce APCs to present the mutated p53 amino acid sequences in the context of any MHC molecule expressed by the patient and are not limited to any particular MHC molecule. Preferably, the autologous APCs are antigen-negative autologous APCs.
[0073] Inducing autologous APCs of the patient to present the at least one mutated p53 amino acid sequence may be carried out using any suitable method known in the art. In an embodiment of the invention, inducing autologous APCs of the patient to present the at least one mutated p53 amino acid sequence comprises pulsing the autologous APCs with a peptide comprising no more than one mutated p53 amino acid sequence or a pool of peptides, each peptide in the pool comprising a different mutated p53 amino acid sequence. In this regard, the autologous APCs may be cultured with a peptide or a pool of peptides comprising the mutated p53 amino acid sequence in a manner such that the APCs internalize the peptide(s) and display the mutated p53 amino acid sequence(s), bound to an MHC molecule, on the cell membrane. Methods of pulsing APCs are known in the art and are described in, e.g., Solheim (Ed.), Antigen Processing and Presentation Protocols (Methods in Molecular Biology), Human Press, (2010). The peptide(s) used to pulse the APCs may include the mutated p53 amino acid(s) encoded by the cancer-specific p53 mutation. The peptide(s) may further comprise any suitable number of contiguous amino acids from the endogenous p53 protein encoded by the p53 gene on each of the carboxyl side and the amino side of the mutated amino acid(s). The number of contiguous amino acids from the endogenous p53 protein flanking each side of the mutation is not limited and may be, for example, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, or a range defined by any two of the foregoing values. Preferably, the peptide(s) comprise(s) about 12 contiguous amino acids from the endogenous p53 protein on each side of the mutated amino acid(s). In an embodiment, the peptide or pool of peptides comprise(s) one or more of the mutated p53 peptides of SEQ ID NOs: 2-13 (Table 1).
[0074] In an embodiment of the invention, inducing autologous APCs of the patient to present the mutated p53 amino acid sequence comprises introducing a nucleotide sequence encoding the mutated p53 amino acid sequence into the APCs. The nucleotide sequence is introduced into the APCs so that the APCs express and display the mutated p53 amino acid sequence, bound to an MHC molecule, on the cell membrane. The nucleotide sequence encoding the mutated p53 amino acid may be RNA or DNA. Introducing a nucleotide sequence into APCs may be carried out in any of a variety of different ways known in the art as described in, e.g., Solheim et al. supra. Non-limiting examples of techniques that are useful for introducing a nucleotide sequence into APCs include transformation, transduction, transfection, and electroporation. In an embodiment, the method may comprise preparing more than one nucleotide sequence, each encoding a different mutated p53 amino acid sequence, and introducing each nucleotide sequence into a different population of autologous APCs. In this regard, multiple populations of autologous APCs, each population expressing and displaying a different mutated p53 amino acid sequence, may be obtained.
[0075] In an embodiment, the method may comprise introducing a nucleotide sequence encoding the more than one mutated p53 amino acid sequence. In this regard, in an embodiment of the invention, the nucleotide sequence introduced into the autologous APCs is a tandem minigene (TMG) construct, each minigene comprising a p53 gene, each p53 gene including a cancer-specific p53 mutation that encodes a different mutated p53 amino acid sequence. Each minigene may encode one p53 mutation flanked on each side of the p53 mutation by any suitable number of contiguous amino acids from the endogenous p53 protein, as described herein with respect to other aspects of the invention. The number of minigenes in the construct is not limited and may include for example, about 5, about 10, about 11, about 12, about 13, about 14, about 15, about 20, about 25, or more, or a range defined by any two of the foregoing values. In an embodiment of the invention, the TMG construct encodes one or more mutated p53 peptides of SEQ ID NOs: 2-13. For example, the TMG construct may encode the amino acid sequence of SEQ ID NO: 14. The APCs express the mutated p53 amino acid sequences encoded by the TMG construct and display the mutated p53 amino acid sequences, bound to an MHC molecule, on the cell membranes. In an embodiment, the method may comprise preparing more than one TMG construct, each construct encoding a different set of mutated p53 amino acid sequences, and introducing each TMG construct into a different population of autologous APCs. In this regard, multiple populations of autologous APCs, each population expressing and displaying mutated p53 amino acid sequences encoded by different TMG constructs, may be obtained.
[0076] The method may comprise culturing autologous T cells of the patient with the autologous APCs that present the mutated p53 amino acid sequence. The T cells can be obtained from numerous sources in the patient, including but not limited to tumor, blood, bone marrow, lymph node, the thymus, or other tissues or fluids. The T cells can include any type of T cell and can be of any developmental stage, including but not limited to, CD4+/CD8+ double positive T cells, CD4+ helper T cells, e.g., Th1 and Th2 cells, CD8+ T cells (e.g., cytotoxic T cells), tumor infiltrating cells (e.g., tumor infiltrating lymphocytes (TIL)), peripheral blood T cells, memory T cells, nave T cells, and the like. The T cells may be CD8+ T cells, CD4+ T cells, or both CD4+ and CD8+ T cells. The method may comprise co-culturing the autologous T cells and autologous APCs so that the T cells encounter the mutated p53 amino acid sequence presented by the APCs in such a manner that the autologous T cells specifically bind to and immunologically recognize a mutated p53 amino acid sequence presented by the APCs. In an embodiment of the invention, the autologous T cells are co-cultured in direct contact with the autologous APCs.
[0077] The method may comprise selecting the autologous T cells that (a) were co-cultured with the autologous APCs that present the mutated p53 amino acid sequence and (b) have antigenic specificity for the mutated p53 amino acid sequence presented in the context of a MHC molecule expressed by the patient. The phrase antigenic specificity, as used herein, means that the autologous T cells can specifically bind to and immunologically recognize the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation. The selecting may comprise identifying the T cells that have antigenic specificity for the mutated p53 amino acid sequence and separating them from T cells that do not have antigenic specificity for the mutated p53 amino acid sequence. Selecting the autologous T cells having antigenic specificity for the mutated p53 amino acid sequence may be carried out in any suitable manner. In an embodiment of the invention, the method comprises expanding the numbers of autologous T cells, e.g., by co-culturing with a T cell growth factor, such as interleukin (IL)-2 or IL-15, or as described herein with respect to other aspects of the invention, prior to selecting the autologous T cells. In an embodiment of the invention, the method does not comprise expanding the numbers of autologous T cells with a T cell growth factor, such as IL-2 or IL-15 prior to selecting the autologous T cells.
[0078] For example, upon co-culture of the autologous T cells with the APCs that present the mutated p53 amino acid sequence, T cells having antigenic specificity for the mutated p53 amino acid sequence may express any one or more of a variety of T cell activation markers which may be used to identify those T cells having antigenic specificity for the mutated p53 amino acid sequence. Such T cell activation markers may include, but are not limited to, programmed cell death 1 (PD-1), lymphocyte-activation gene 3 (LAG-3), T cell immunoglobulin and mucin domain 3 (TIM-3), 4-1BB, OX40, and CD107a. Accordingly, in an embodiment of the invention, selecting the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence comprises selecting the T cells that express any one or more of PD-1, LAG-3, TIM-3, 4-1BB, OX40, and CD107a. Cells expressing one or more T cell activation markers may be sorted on the basis of expression of the marker using any of a variety of techniques known in the art such as, for example, fluorescence-activated cell sorting (FACS) or magnetic-activated cell sorting (MACS) as described in, e.g., Turcotte et al., Clin. Cancer Res., 20(2): 331-43 (2013) and Gros et al., J. Clin. Invest., 124(5): 2246-59 (2014).
[0079] In another embodiment of the invention, selecting the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence comprises selecting the T cells (i) that secrete a greater amount of one or more cytokines upon co-culture with APCs that present the mutated p53 amino acid sequence as compared to the amount of the one or more cytokines secreted by a negative control or (ii) in which at least twice as many of the numbers of T cells secrete one or more cytokines upon co-culture with APCs that present the mutated p53 amino acid sequence as compared to the numbers of negative control T cells that secrete the one or more cytokines. The one or more cytokines may comprise any cytokine the secretion of which by a T cell is characteristic of T cell activation (e.g., a T cell receptor (TCR) expressed by the T cells specifically binding to and immunologically recognizing the mutated p53 amino acid sequence). Non-limiting examples of cytokines, the secretion of which is characteristic of T cell activation, include IFN-, IL-2, and tumor necrosis factor alpha (TNF-), granulocyte/monocyte colony stimulating factor (GM-CSF), IL-4, IL-5, IL-9, IL-10, IL-17, and IL-22.
[0080] For example, the autologous T cells may be considered to have antigenic specificity for the mutated p53 amino acid sequence if the T cells secrete at least twice as much IFN- upon co-culture with (a) antigen negative APCs pulsed with a concentration of a peptide comprising the mutated p53 amino acid sequence (e.g., about 0.05 ng/mL to about 10 g/mL, e.g., 0.05 ng/mL, 0.1 ng/mL, 0.5 ng/mL, 1 ng/mL, 5 ng/mL, 100 ng/mL, 1 g/mL, 5 g/mL, or 10 g/mL) or (b) APCs into which a nucleotide sequence encoding the mutated p53 amino acid sequence has been introduced as compared to the amount of IFN- secreted by a negative control. The negative control may be, for example, autologous T cells (e.g., derived from peripheral blood mononuclear cells (PBMC)) co-cultured with (a) antigen-negative APCs pulsed with the same concentration of an irrelevant peptide (e.g., the wild-type amino acid sequence, or some other peptide with a different sequence from the mutated p53 amino acid sequence) or (b) APCs into which a nucleotide sequence encoding an irrelevant peptide sequence has been introduced. The autologous T cells may also have antigenic specificity for the mutated p53 amino acid sequence if the T cells secrete a greater amount of IFN- upon co-culture with antigen-negative APCs pulsed with higher concentrations of a peptide comprising the mutated p53 amino acid sequence as compared to a negative control, for example, the negative control described above. IFN- secretion may be measured by methods known in the art such as, for example, enzyme-linked immunosorbent assay (ELISA).
[0081] Alternatively or additionally, the autologous T cells may be considered to have antigenic specificity for the mutated p53 amino acid sequence if at least twice as many of the numbers of T cells secrete IFN- upon co-culture with (a) antigen-negative APCs pulsed with a concentration of a peptide comprising the mutated p53 amino acid sequence or (b) APCs into which a nucleotide sequence encoding the mutated p53 amino acid sequence has been introduced as compared to the numbers of negative control T cells that secrete IFN-. The concentration of peptide and the negative control may be as described herein with respect to other aspects of the invention. The numbers of cells secreting IFN- may be measured by methods known in the art such as, for example, ELISPOT.
[0082] Alternatively or additionally, the autologous T cells may be considered to have antigenic specificity for mutated p53 if at least twice as many spots are detected by ELISPOT for the T cells upon co-culture with (a) antigen-negative, applicable HLA molecule positive target cells pulsed with a low concentration of mutated p53 peptide or (b) antigen-negative, applicable HLA molecule positive target cells into which a nucleotide sequence encoding mutated p53 has been introduced such that the target cell expresses mutated p53 as compared to the number of spots detected by ELISPOT for negative control T cells co-cultured with the same target cells. The concentration of peptide and the negative control may be as described herein with respect to other aspects of the invention.
[0083] Alternatively or additionally, the autologous T cells may be considered to have antigenic specificity for mutated p53 if greater than about 50 spots are detected by ELISPOT for the T cells expressing the TCR upon co-culture with (a) antigen-negative, applicable HLA molecule positive target cells pulsed with a low concentration of mutated p53 peptide or (b) antigen-negative, applicable HLA molecule positive target cells into which a nucleotide sequence encoding mutated p53 has been introduced such that the target cell expresses mutated p53. The concentration of peptide may be as described herein with respect to other aspects of the invention.
[0084] While T cells having antigenic specificity for the mutated p53 amino acid sequence may both (1) express any one or more T cells activation markers described herein and (2) secrete a greater amount of one or more cytokines as described herein, in an embodiment of the invention, T cells having antigenic specificity for the mutated p53 amino acid sequence may express any one or more T cell activation markers without secreting a greater amount of one or more cytokines or may secrete a greater amount of one or more cytokines without expressing any one or more T cell activation markers.
[0085] In another embodiment of the invention, selecting the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence comprises selectively growing the autologous T cells that have antigenic specificity for the mutated p53 amino acid sequence. In this regard, the method may comprise co-culturing the autologous T cells with autologous APCs in such a manner as to favor the growth of the T cells that have antigenic specificity for the mutated p53 amino acid sequence over the T cells that do not have antigenic specificity for the mutated p53 amino acid sequence. Accordingly, a population of T cells is provided that has a higher proportion of T cells that have antigenic specificity for the mutated p53 amino acid sequence as compared to T cells that do not have antigenic specificity for the mutated p53 amino acid sequence.
[0086] In an embodiment of the invention, the method further comprises obtaining multiple fragments of a tumor from the patient, separately co-culturing autologous T cells from each of the multiple fragments with the autologous APCs that present the mutated p53 amino acid sequence as described herein with respect to other aspects of the invention, and separately assessing the T cells from each of the multiple fragments for antigenic specificity for the mutated p53 amino acid sequence, as described herein with respect to other aspects of the invention.
[0087] In an embodiment of the invention in which T cells are co-cultured with autologous APCs expressing multiple mutated p53 amino acid sequences (e.g., multiple mutated p53 amino acid sequences encoded by a TMG construct or multiple mutated p53 amino acid sequences in a pool of peptides pulsed onto autologous APCs), selecting the autologous T cells may further comprise separately assessing autologous T cells for antigenic specificity for each of the multiple mutated p53 amino acid sequences. For example, the inventive method may further comprise separately inducing autologous APCs of the patient to present each mutated p53 amino acid sequence encoded by the construct (or included in the pool), as described herein with respect to other aspects of the invention (for example, by providing separate APC populations, each presenting a different mutated p53 amino acid sequence encoded by the construct (or included in the pool)). The method may further comprise separately co-culturing autologous T cells of the patient with the different populations of autologous APCs that present each mutated p53 amino acid sequence, as described herein with respect to other aspects of the invention. The method may further comprise separately selecting the autologous T cells that (a) were co-cultured with the autologous APCs that present the mutated p53 amino acid sequence and (b) have antigenic specificity for the mutated p53 amino acid sequence presented in the context of a MHC molecule expressed by the patient, as described herein with respect to other aspects of the invention. In this regard, the method may comprise determining which mutated p53 amino acid sequence encoded by a TMG construct that encodes multiple mutated p53 amino acid sequences (or included in the pool) are immunologically recognized by the autologous T cells (e.g., by process of elimination).
[0088] In an embodiment of the invention, the method further comprises expanding the numbers of selected autologous T cells to obtain a population of T cells that have antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation. Expansion of the numbers of selected cells can be accomplished by any of a number of methods as are known in the art as described in, for example, U.S. Pat. Nos. 8,034,334; 8,383,099; U.S. Patent Application Publication No. 2012/0244133; Dudley et al., J. Immunother., 26:332-42 (2003); and Riddell et al., J. Immunol. Methods, 128:189-201 (1990). In an embodiment, expansion of the numbers of T cells is carried out by culturing the T cells with OKT3 antibody, IL-2, and feeder PBMC (e.g., irradiated allogeneic PBMC). In this regard, the inventive methods may, advantageously, generate a large number of T cells having antigenic specificity for the mutated p53 amino acid sequence.
[0089] The T cells isolated by the inventive methods may be useful for preparing cells for adoptive cell therapies. In this regard, an embodiment of the invention provides a method of preparing a population of T cells that have antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising isolating T cells as described herein with respect to other aspects of the invention, and expanding the numbers of selected autologous T cells to obtain a population of T cells that have antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific mutation. Expanding the numbers of selected cells may be carried out as described herein with respect to other aspects of the invention.
[0090] Another embodiment of the invention provides a method of isolating a T cell receptor (TCR), or an antigen-binding portion thereof, having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation. The method may comprise isolating T cells having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation as described herein with respect to other aspects of the invention.
[0091] The method may further comprise isolating a nucleotide sequence that encodes the TCR, or the antigen-binding portion thereof, from the selected T cells, wherein the TCR, or the antigen-binding portion thereof, has antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation. In an embodiment of the invention, prior to isolating the nucleotide sequence that encodes the TCR, or the antigen-binding portion thereof, the numbers selected T cells that have antigenic specificity for the mutated p53 amino acid sequence may be expanded. Expanding the numbers of selected cells may be carried out as described herein with respect to other aspects of the invention. In another embodiment of the invention, the numbers of selected T cells that have antigenic specificity for the mutated p53 amino acid sequence are not expanded prior to isolating the nucleotide sequence that encodes the TCR, or the antigen-binding portion thereof. For example, the TCR, or antigen binding portion thereof, may be isolated from a single cell.
[0092] The the antigen-binding portion of the TCR, as used herein, refers to any portion comprising contiguous amino acids of the TCR of which it is a part, provided that the antigen-binding portion specifically binds to the mutated p53 amino acid sequence as described herein with respect to other aspects of the invention. The term antigen-binding portion refers to any part or fragment of the TCR, which part or fragment retains the biological activity of the TCR of which it is a part (the parent TCR). Antigen-binding portions encompass, for example, those parts of a TCR that retain the ability to specifically bind to the mutated p53 amino acid sequence, or detect, treat, or prevent cancer, to a similar extent, the same extent, or to a higher extent, as compared to the parent TCR. In reference to the parent TCR, the functional portion can comprise, for instance, about 10%, about 25%, about 30%, about 50%, about 68%, about 80%, about 90%, about 95%, or more, of the parent TCR.
[0093] The antigen-binding portion can comprise an antigen-binding portion of either or both of the and chains of the TCR, such as a portion comprising one or more of the complementarity determining region (CDR)1, CDR2, and CDR3 of the variable region(s) of the chain and/or chain of the TCR. In an embodiment of the invention, the antigen-binding portion can comprise the amino acid sequence of the CDR1 of the chain (CDR1), the CDR2 of the chain (CDR2), the CDR3 of the chain (CDR3), the CDR1 of the chain (CDR1), the CDR2 of the chain (CDR2), the CDR3 of the chain (CDR3), or any combination thereof. Preferably, the antigen-binding portion comprises the amino acid sequences of CDR1, CDR2, and CDR3; the amino acid sequences of CDR1, CDR2, and CDR3; or the amino acid sequences of all of CDR1, CDR2, CDR3, CDR1, CDR2, and CDR3 of the TCR.
[0094] In an embodiment of the invention, the antigen-binding portion can comprise, for instance, the variable region of the TCR comprising a combination of the CDR regions set forth above. In this regard, the antigen-binding portion can comprise the amino acid sequence of the variable region of the chain (V), the amino acid sequence of the variable region of the chain (V), or the amino acid sequences of both of the V and V of the TCR.
[0095] In an embodiment of the invention, the antigen-binding portion may comprise a combination of a variable region and a constant region. In this regard, the antigen-binding portion can comprise the entire length of the or chain, or both of the and chains, of the TCR.
[0096] Isolating the nucleotide sequence that encodes the TCR, or the antigen-binding portion thereof, from the selected T cells may be carried out in any suitable manner known in the art. For example, the method may comprise isolating RNA from the selected T cells and sequencing the TCR, or the antigen-binding portion thereof, using established molecular cloning techniques and reagents such as, for example, 5 Rapid Amplification of cDNA Ends (RACE) polymerase chain reaction (PCR) using TCR- and - chain constant primers. Alternatively or additionally, techniques and systems useful for isolating a TCR nucleic acid sequence may include, for example, single-cell reverse transcription polymerase chain reaction (RT-PCR), bioinfomatic reconstruction, limiting dilution cloning, the FLUIDIGM system (Fluidigm Corporation, South San Francisco, Calif.), deep sequencing of TCR and TCR chains with frequency pairing, PAIRSEQ method of identifying TCR and chain pairs from Adaptive Biotechnologies (Seattle, Wash.), and combinations thereof.
[0097] In an embodiment of the invention, the method may comprise cloning the nucleotide sequence that encodes the TCR, or the antigen-binding portion thereof, into a recombinant expression vector using established molecular cloning techniques as described in, e.g., Green et al. (Eds.), Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 4th Ed. (2012). For purposes herein, the term recombinant expression vector means a genetically-modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell. The vectors may not be naturally-occurring as a whole. However, parts of the vectors can be naturally-occurring. The recombinant expression vectors can comprise any type of nucleotides, including, but not limited to DNA (e.g., complementary DCA (cDNA)) and RNA, which can be single-stranded or double-stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides. The recombinant expression vectors can comprise naturally-occurring, non-naturally-occurring internucleotide linkages, or both types of linkages. Preferably, the non-naturally occurring or altered nucleotides or internucleotide linkages does not hinder the transcription or replication of the vector.
[0098] The recombinant expression vector can be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host cell. Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. The vector can be selected from the group consisting of transposon/transposase, the pUC series (Fermentas Life Sciences), the pBluescript series (Stratagene, LaJolla, Calif.), the pET series (Novagen, Madison, Wis.), the pGEX series (Pharmacia Biotech, Uppsala, Sweden), and the pEX series (Clontech, Palo Alto, Calif.). Bacteriophage vectors, such as GT10, GT11, ZapII (Stratagene), EMBL4, and NM1149, also can be used. Examples of plant expression vectors include pBI01, pBI101.2, pBI101.3, pBI121 and pBIN19 (Clontech). Examples of animal expression vectors include pEUK-Cl, pMAM and pMAMneo (Clontech). Preferably, the recombinant expression vector is a viral vector, e.g., a retroviral vector.
[0099] The TCR, or the antigen-binding portion thereof, isolated by the inventive methods may be useful for preparing cells for adoptive cell therapies. In this regard, an embodiment of the invention provides a method of preparing a population of cells that express a TCR, or an antigen-binding portion thereof, having antigenic specificity for a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, the method comprising isolating a TCR, or an antigen-binding portion thereof, as described herein with respect to other aspects of the invention, and introducing the nucleotide sequence encoding the isolated TCR, or the antigen-binding portion thereof, into host cells to obtain cells that express the TCR, or the antigen-binding portion thereof.
[0100] Introducing the nucleotide sequence (e.g., a recombinant expression vector) encoding the isolated TCR, or the antigen-binding portion thereof, into host cells may be carried out in any of a variety of different ways known in the art as described in, e.g., Green et al. supra. Non-limiting examples of techniques that are useful for introducing a nucleotide sequence into host cells include transfoimation, transduction, transfection, transposition, and electroporation.
[0101] The host cell into which the nucleotide sequence encoding the TCR, or antigen binding portion thereof, is introduced may be any type of cell that can contain the recombinant expression vector. The host cell can be a eukaryotic cell, e.g., plant, animal, fungi, or algae, or can be a prokaryotic cell, e.g., bacteria or protozoa. The host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human. The host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension. Suitable host cells are known in the art and include, for instance, DH5 E. coli cells, Chinese hamster ovarian cells, monkey VERO cells, COS cells, HEK293 cells, and the like. For purposes of amplifying or replicating the recombinant expression vector, the host cell is preferably a prokaryotic cell, e.g., a DH5a cell. For purposes of producing the TCR, or antigen binding portion thereof, the host cell is preferably a mammalian cell. Most preferably, the host cell is a human cell. While the host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage, the host cell preferably is a PBL or a PBMC. More preferably, the host cell is a T cell.
[0102] In an embodiment of the invention, the PBMC include T cells. The T cells may be any type of T cell. Without being bound to a particular theory or mechanism, it is believed that less differentiated, younger T cells may be associated with any one or more of greater in vivo persistence, proliferation, and antitumor activity as compared to more differentiated, older T cells. Accordingly, the inventive methods may, advantageously, identify and isolate a TCR, or an antigen-binding portion thereof, that has antigenic specificity for the mutated p53 amino acid sequence and introduce the TCR, or an antigen-binding portion thereof, into younger T cells that may provide any one or more of greater in vivo persistence, proliferation, and antitumor activity as compared to older T cells (e.g., effector cells in a patient's tumor).
[0103] In an embodiment of the invention, the inventive methods identify and isolate TCRs, or the antigen-binding portions thereof, that have antigenic specificity against a mutated p53 amino acid sequence that is encoded by a recurrent (also referred to as hot-spot) cancer-specific p53 mutation. In this regard, the method may comprise introducing the nucleotide sequence encoding the isolated TCR, or the antigen-binding portion thereof, into host cells that are allogeneic to the patient. For example, the method may comprise introducing the nucleotide sequence encoding the isolated TCR, or the antigen-binding portion thereof, into the host cells from another patient whose tumors express the same p53 mutation in the context of the same MHC molecule.
[0104] In an embodiment of the invention, the method further comprises expanding the numbers of host cells that express the TCR, or the antigen-binding portion thereof. The numbers of host cells may be expanded, for example, as described herein with respect to other aspects of the invention. In this regard, the inventive methods may, advantageously, generate a large number of T cells having antigenic specificity for the mutated p53 amino acid sequence.
[0105] Another embodiment of the invention provides an isolated population of cells prepared according to any of the methods described herein with respect to other aspects of the invention. The population of cells can be a heterogeneous population comprising the T cells having antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation in addition to at least one other cell, e.g., a PBMC which does not have antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation, or a cell other than a T cell, e.g., a B cell, a macrophage, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cells, a muscle cell, a brain cell, etc. Alternatively, the population of cells can be a substantially homogeneous population, in which the population comprises mainly of (e.g., consisting essentially of) T cells having antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation. The population also can be a clonal population of cells, in which all cells of the population are clones of a single T cell, such that all cells of the population have antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation. In one embodiment of the invention, the population of cells is a clonal population comprising T cell having antigenic specificity for the mutated p53 amino acid sequence encoded by the cancer-specific p53 mutation, as described herein. In an embodiment of the invention, about 1% to about 100%, for example, about 1%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%, or a range defined by any two of the foregoing values, of the population of cells comprises T cells that have antigenic specificity for the mutated p53 amino acid sequence. Without being bound to a particular theory or mechanism, it is believed that populations of cells that comprise a high proportion of T cells that have antigenic specificity for the mutated p53 amino acid sequence advantageously may have a lower proportion of irrelevant cells that may hinder the function of the T cell, e.g., the ability of the T cell to target the destruction of cancer cells and/or treat or prevent cancer.
[0106] The inventive populations of cells can be formulated into a composition, such as a pharmaceutical composition. In this regard, the invention provides a pharmaceutical composition comprising any of the inventive populations of cells and a pharmaceutically acceptable carrier. The inventive pharmaceutical composition can comprise an inventive population of cells in combination with another pharmaceutically active agent(s) or drug(s), such as a chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
[0107] Preferably, the carrier is a pharmaceutically acceptable carrier. With respect to pharmaceutical compositions, the carrier can be any of those conventionally used for the particular inventive population of cells under consideration. Such pharmaceutically acceptable carriers are well-known to those skilled in the art and are readily available to the public. It is preferred that the pharmaceutically acceptable carrier be one which has no detrimental side effects or toxicity under the conditions of use.
[0108] The choice of carrier will be determined in part by the particular inventive population of cells, as well as by the particular method used to administer the inventive population of cells. Accordingly, there are a variety of suitable formulations of the pharmaceutical composition of the invention. Suitable formulations may include any of those for parenteral, subcutaneous, intravenous, intramuscular, intraarterial, intratumoral, intrathecal, or interperitoneal administration. More than one route can be used to administer the inventive population of cells, and in certain instances, a particular route can provide a more immediate and more effective response than another route.
[0109] Preferably, the inventive population of cells is administered by injection, e.g., intravenously. When the inventive population of cells is to be administered, the pharmaceutically acceptable carrier for the cells for injection may include any isotonic carrier such as, for example, normal saline (about 0.90% w/v of NaCl in water, about 300 mOsm/L NaCl in water, or about 9.0 g NaCl per liter of water), NORMOSOL R electrolyte solution (Abbott, Chicago, Ill.), PLASMA-LYTE A (Baxter, Deerfield, Ill.), about 5% dextrose in water, or Ringer's lactate. In an embodiment, the pharmaceutically acceptable carrier is supplemented with human serum albumin.
[0110] It is contemplated that the inventive populations of cells and pharmaceutical compositions can be used in methods of treating or preventing cancer. Without being bound to a particular theory or mechanism, the inventive T cells are believed to bind specifically to a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, such that a TCR expressed by the cell is able to mediate an immune response against a target cell expressing the mutated p53 amino acid sequence. In this regard, an embodiment of the invention provides a method of treating or preventing cancer in a mammal, comprising administering to the mammal any of the pharmaceutical compositions or populations of cells described herein, in an amount effective to treat or prevent cancer in the mammal.
[0111] The terms treat, and prevent as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment or prevention. Rather, there are varying degrees of treatment or prevention of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. In this respect, the inventive methods can provide any amount of any level of treatment or prevention of cancer in a mammal. Furthermore, the treatment or prevention provided by the inventive method can include treatment or prevention of one or more conditions or symptoms of the cancer being treated or prevented. For example, treatment or prevention can include promoting the regression of a tumor. Also, for purposes herein, prevention can encompass delaying the onset of the cancer, or a symptom or condition thereof.
[0112] For purposes of the invention, the amount or dose of the inventive population of cells or pharmaceutical composition administered (e.g., numbers of cells when the inventive population of cells is administered) should be sufficient to effect, e.g., a therapeutic or prophylactic response, in the mammal over a reasonable time frame. For example, the dose of the inventive population of cells or pharmaceutical composition should be sufficient to bind to a mutated p53 amino acid sequence encoded by a cancer-specific p53 mutation, or detect, treat or prevent cancer in a period of from about 2 hours or longer, e.g., 12 to 24 or more hours, from the time of administration. In certain embodiments, the time period could be even longer. The dose will be determined by the efficacy of the particular inventive population of cells or pharmaceutical composition administered and the condition of the mammal (e.g., human), as well as the body weight of the mammal (e.g., human) to be treated.
[0113] Many assays for determining an administered dose are known in the art. For purposes of the invention, an assay, which comprises comparing the extent to which target cells are lysed or IFN- is secreted by T cells upon administration of a given dose of such T cells to a mammal among a set of mammals of which is each given a different dose of the T cells, could be used to determine a starting dose to be administered to a mammal. The extent to which target cells are lysed or IFN- is secreted upon administration of a certain dose can be assayed by methods known in the art.
[0114] The dose of the inventive population of cells or pharmaceutical composition also will be determined by the existence, nature and extent of any adverse side effects that might accompany the administration of a particular inventive population of cells or pharmaceutical composition. Typically, the attending physician will decide the dosage of the inventive population of cells or pharmaceutical composition with which to treat each individual patient, taking into consideration a variety of factors, such as age, body weight, general health, diet, sex, inventive population of cells or pharmaceutical composition to be administered, route of administration, and the severity of the condition being treated.
[0115] In an embodiment in which the inventive population of cells is to be administered, the number of cells administered per infusion may vary, for example, in the range of one million to 100 billion cells; however, amounts below or above this exemplary range are within the scope of the invention. For example, the daily dose of inventive host cells can be about 1 million to about 150 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, about 60 billion cells, about 80 billion cells, about 100 billion cells, about 120 billion cells, about 130 billion cells, about 150 billion cells, or a range defined by any two of the foregoing values), preferably about 10 million to about 130 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, about 100 billion cells, about 110 billion cells, about 120 billion cells, about 130 billion cells, or a range defined by any two of the foregoing values), more preferably about 100 million cells to about 130 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, about 100 billion cells, about 110 billion cells, about 120 billion cells, about 130 billion cells, or a range defined by any two of the foregoing values).
[0116] For purposes of the inventive methods, wherein populations of cells are administered, the cells can be cells that are allogeneic or autologous to the mammal. Preferably, the cells are autologous to the mammal.
[0117] Another embodiment of the invention provides any of the isolated population of cells or pharmaceutical compositions described herein for use in treating or preventing cancer in a mammal.
[0118] With respect to the inventive methods, the cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vagina, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, colocrectal cancer, endometrial cancer, esophageal cancer, uterine cervical cancer, gastrointestinal carcinoid tumor, glioma, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, liver cancer, lung cancer, malignant mesothelioma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, cancer of the oropharynx, ovarian cancer, cancer of the penis, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, stomach cancer, testicular cancer, thyroid cancer, cancer of the uterus, ureter cancer, and urinary bladder cancer. In a preferred embodiment, the cancer is a cancer which expresses mutated p53. The cancer may express p53 with a mutation at one or more of positions 175, 220, 245, 248, 249, 273, or 282 of SEQ ID NO: 1. The cancer may express p53 with one or more of the following human p53 mutations: R175H, Y220C, G245D, G245S, R248L, R248Q, R248W, R249S, R273H, R273C, R273L, or R282W. Preferably, the cancer is an epithelial cancer or cholangiocarcinoma, melanoma, colon cancer, rectal cancer, ovarian cancer, endometrial cancer, non-small cell lung cancer (NSCLC), glioblastoma, uterine cervical cancer, head and neck cancer, breast cancer, pancreatic cancer, or bladder cancer.
[0119] The mammal referred to in the inventive methods can be any mammal. As used herein, the term mammal refers to any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, and mammals of the order Logomorpha, such as rabbits. It is preferred that the mammals are from the order Carnivora, including Felines (cats) and Canines (dogs). Preferably, the mammals are from the order Artiodactyla, including Bovines (cows) and Swines (pigs) or of the order Perssodactyla, including Equines (horses). Preferably, the mammals are of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). A more preferred mammal is the human.
[0120] The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.
EXAMPLES
[0121] The amino acid sequences set forth in Tables 1-3 were employed in the experiments described in the following Examples.
TABLE-US-00001 TABLE1 SEQ Name Sequence IDNO: 2 LP-p53-R175H-MUT YKQSQHMTEVVRHCPHHERCSDSDG 3 LP-p53-R273H-MUT SGNLLGRNSFEVHVCACPGRDRRTE 4 LP-p53-R248L-MUT YMCNSSCMGGMNLRPILTIITLEDS 5 LP-p53-R282W-MUT FEVRVCACPGRDWRTEEENLRKKGE 6 LP-p53-R273C-MUT SGNLLGRNSFEVCVCACPGRDRRTE 7 LP-p53-G245S-MUT HYNYMCNSSCMGSMNRRPILTIITL 8 LP-p53-R248Q-MUT YMCNSSCMGGMNQRPILTIITLEDS 9 LP-p53-G245D-MUT HYNYMCNSSCMGDMNRRPILTIITL 10 LP-p53-R273L-MUT SGNLLGRNSFEVLVCACPGRDRRTE 11 LP-p53-R248W-MUT YMCNSSCMGGMNWRPILTIITLEDS 12 LP-p53-Y220C-MUT DRNTFRHSVVVPCEPPEVGSDCTTI 13 LP-p53-R249S-MUT MCNSSCMGGMNRSPILTIITLEDSS
[0122] The wild-type versions of the peptides of Table 1 are set forth in Table 2.
TABLE-US-00002 TABLE2 SEQIDNO: Name Sequence 15 LP-p53-R175-WT YKQSQHMTEVVRRCPHHERCSDSDG 16 LP-p53-R273-WT SGNLLGRNSFEVRVCACPGRDRRTE 17 LP-p53-R248-WT YMCNSSCMGGMNRRPILTIITLEDS 18 LP-p53-R282-WT FEVRVCACPGRDRRTEEENLRKKGE 19 LP-p53-G245-WT HYNYMCNSSCMGGMNRRPILTIITL 20 LP-p53-Y220-WT DRNTFRHSVVVPYEPPEVGSDCTTI 21 LP-p53-R249-WT MCNSSCMGGMNRRPILTIITLEDSS
TABLE-US-00003 TABLE3 SEQ ID NO: Name Sequence 14 TMG-p53- YKQSQHMTEVVRHCPHHERCSDSDGSGNLLGRNSFEV MUT HVCACPGRDRRTEYMCNSSCMGGMNLRPILTIITLEDSF EVRVCACPGRDWRTEEENLRKKGESGNLLGRNSFEVC VCACPGRDRRTEHYNYMCNSSCMGSMNRRPILTIITLY MCNSSCMGGMNQRPILTIITLEDSHYNYMCNSSCMGD MNRRPILTIITLSGNLLGRNSFEVLVCACPGRDRRTEYM CNSSCMGGMNWRPILTIITLEDSDRNTFRHSVVVPCEPP EVGSDCTTIMCNSSCMGGMNRSPILTIITLEDSS 22 TMG-p53- YKQSQHMTEVVRRCPHHERCSDSDGSGNLLGRNSFEV WT RVCACPGRDRRTEYMCNSSCMGGMNRRPILTIITLEDSF EVRVCACPGRDRRTEEENLRKKGESGNLLGRNSFEVRV CACPGRDRRTEHYNYMCNSSCMGGMNRRPILTIITLYM CNSSCMGGMNRRPILTIITLEDSHYNYMCNSSCMGGMN RRPILTIITLSGNLLGRNSFEVRVCACPGRDRRTEYMCNS SCMGGMNRRPILTIITLEDSDRNTFRHSVVVPYEPPEVGS DCTTIMCNSSCMGGMNRRPILTIITLEDSS
Example 1
[0123] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4141 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening). This example also demonstrates the isolation and specific reactivity of a TCR from patient 4141.
[0124] Experiments were carried out as described for
[0125] Autologous APCs were transfected with TMG encoding irrelevant mutations, WT p53 sequence, or mutated p53 sequence including R175H. Media alone and PMA and ionomycin were negative and positive controls, respectively. The following day, TIL from patient 4141 (fragment culture 12) were co-cultured overnight at 37 C. with TMG-transfected APCs. Secretion of IFN- was evaluated by ELISPOT. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells).fwdarw.CD4-CD8+. The results are shown in
[0126] Cos7 cells (2.510.sup.4 per well) were plated on wells of flat-bottom 96 well plates. The following day, cells were co-transfected with individual HLA alleles from patient 4141 and either no extra gene, WT TP53 TMG, or mutated TP53 TMG containing the p53-R175H sequence. TIL with specificity to p53-R175H from Patient 4141 (fragment culture 12) were co-cultured the following day with transfected Cos7 cells and were incubated overnight at 37 C. Secretion of IFN- was evaluated by ELISPOT. The results are shown in
[0127] T cells expressing mock (no TCR) or 4141-TCR1a2 were co-cultured with T2 tumor cells (expressing HLA-A*02:01). T2 cells were pulsed for 2 hours at 37 C. with peptide vehicle (DMSO) or purified (>95% by HPLC) peptides composed of WT p53-R175 peptide HMTEVVRRC (SEQ ID NO: 532) or mutated p53-R175H peptide HMTEVVRHC (SEQ ID NO: 530). Media alone and PMA and Ionomycin were negative and positive controls, respectively. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated by ELISA. The results are shown in
[0128] T cells expressing 4141-TCRla2 were co-cultured overnight at 37 C. with Saos2 cells (p53-NULL and HLA-A*02:01+), which were either unmanipulated or made to overexpress full length p53-R175H protein. Inhibitors of secretion (monensin and brefeldin A) were added to co-cultures to trap cytokines within T cells. After 6 hours of co-culture, cells were fixed and permeabilized then stained for IL-2, CD107a, IFN- and tumor necrosis factor-alpha (TNF). Flow cytometry was used to analyze co-cultures based on a lymphocyte gate. The results are shown in
[0129] The sequence of TCR 4141-TCR1a2, which was isolated from Patient 4141, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 467), the second underlined region is the CDR2alpha (SEQ ID NO: 468), the third underlined region is the CDR3alpha (SEQ ID NO: 469), the fourth underlined region is the CDR1beta (SEQ ID NO: 470), the fifth underlined region is the CDR2beta (SEQ ID NO: 471), and the sixth underlined region is the CDR3beta (SEQ ID NO: 472). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 473) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 474) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 475) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 476) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0130] Cancer reactive T cells were identified as described below. The TCR was isolated as described below.
TABLE-US-00004 TCRname:4141-TCR1a2 Recognitionofp53mutation:R175H Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4141 infusionbagTILwithp53mutTMGandsorted CD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCRthen TATOPOcloningkit(ThermoFisher Scientific,Waltham,MA)foralphachain TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:587) MASIRAVFIFLWLQLDLVNGENVEQHPSTLSVQEGDSAVIKCTYSDSA SNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHI TETQPEDSAVYFCAASKSAIMVVLQTSSSLELALCLLSSQVNIQNPEP AVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAM DSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSSRAKRSGSGATNFSL LKQAGDVEENPGPMHPQLLGYVVLCLLGAGPLEAQVTQNPRYLITVTG KKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGY KVSRKEKRNFPLILESPSPNQTSLYFCASSIQQGADTQYFGPGTRLTV LEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWV NGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQ FHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATI LYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0131] The statistics for 4141-TCR1a2 from patient 4141 are set forth in Table 4 below.
TABLE-US-00005 TABLE 4 Parameter # Frequency Total wells 96 100% CDR3alpha Unknown (TA TOPO cloning) Not applicable CDR3beta 58 60.4%
Example 2
[0132] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4130 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening).
[0133] Experiments were carried out as described for
Example 3
[0134] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4259 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening). This example also demonstrates the isolation and specific reactivity of a TCR isolated from patient 4259.
[0135] Experiments were carried out as described for
[0136] TIL fragments (n=18) from patient 4259 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-Y220 sequence or mutated p53-Y220C sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0137] TIL fragment culture (no. 6) from patient 4259 was co-cultured with autologous APCs either (1) electroporated with TMG composed of irrelevant, WT p53, or mutated p53 sequence or (2) pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of WT p53-Y220 sequence or mutated p53-Y220C sequence. Co-cultures were performed overnight at 37 C. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0138] Autologous APCs were pulsed with decreasing concentrations of 25-amino acid peptides corresponding to the WT p53-Y220 or mutated p53-Y220C sequence for 2 hours at 37 C. TIL fragment culture (no. 6) from patient 4259 was co-cultured with peptide-pulsed APCs. Expression of 4-1BB was assayed by flow cytometry after gating lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0139] Autologous antigen presenting cells were pulsed with DMSO, WT p53-Y220 peptide RNTFRHSVVVPYE (SEQ ID NO: 533) or mutated p53-Y220C peptide RNTFRHSVVVPCE (SEQ ID NO: 534) for 2 hours at 37 C. Excess peptide was washed away. TIL from patient 4259 (fragment culture 6) with specificity to p53-Y220C was co-cultured overnight at 37 C. with peptide-pulsed APCs. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0140] Cos7 cells (2.510.sup.4 per well) were plated on wells of flat-bottom 96 well plates. The following day, cells were co-transfected with individual HLA alleles from patient 4259. The next day, DMSO or the p53-Y220C peptide RNTFRHSVVVPCE (SEQ ID NO: 534) were pulsed for 2 hours on transfected Cos7 cells. Excess peptide was washed away. TIL fragment culture no. 6 from Patient 4259 was added (10.sup.5 cells/well). Co-cultures were incubated overnight at 37 C. Expression of 4-1BB was assayed by flow cytometry after gating lymphocytes.fwdarw.live.fwdarw.CD3+ (T cells).fwdarw.CD8-CD4+. The results are shown in
[0141] APCs autologous to Patient 4259 were pulsed with 25-amino acid peptides corresponding to the WT p53-Y220 or mutated p53-Y220C sequence for 2 hours at 37 C. Excess peptide was washed away. T cells expressing 4259-F6-TCR were co-cultured overnight at 37 C. with peptide-pulsed APCs. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The introduced TCR was measured by mouse TCRbeta (mTCR). The results are shown in Table 5.
TABLE-US-00006 TABLE 5 WT p53-Y220 Mut p53-Y220C 4-1BB+/mTCR+ 0.27 5.22 4-1BB/mTCR 68.5 73.7 4-1BB+/mTCR 0.18 1.59 4-1BB/mTCR+ 31.0 19.5
[0142] A tumor cell (TC) line was established from a xenografted tumor fragment resected from Patient 4259 and then serially passaged through immunocompromised mice (TC #4259). TC #4259 was co-cultured with T cells (10.sup.5) expressing mock (no TCR) or p53-Y220C-specific TCR (4259-F6-TCR) overnight at 37 C. The TC #4259 cells were either incubated with nothing, W6/32 pan-HLA Class-I specific blocking antibody, IVA12 pan-HLA Class-II specific blocking antibody or mutated p53-Y220C peptide RNTFRHSVVVPCE (SEQ ID NO: 534) for 2 hours at 37 C. The antibodies were kept in the co-culture at 5 g/mL final concentration. The peptide was incubated at 10 g/mL and excess peptide was washed after incubation. Media alone (no TC) and PMA and Ionomycin were negative and positive controls, respectively. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0143] The sequence of TCR 4259-F6-TCR, which was isolated from Patient 4259, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 477), the second underlined region is the CDR2alpha (SEQ ID NO: 478), the third underlined region is the CDR3alpha (SEQ ID NO: 479), the fourth underlined region is the CDR1beta (SEQ ID NO: 480), the fifth underlined region is the CDR2beta (SEQ ID NO: 481), and the sixth underlined region is the CDR3beta (SEQ ID NO: 482). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 483) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 484) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 485) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 486) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0144] Cancer reactive T cells were identified as described below. The TCR was isolated as described below.
TABLE-US-00007 TCRname:4259-F6-TCR Recognitionofp53mutation:Y220C Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4259-F6 withp53-Y220CpeptideandsortedCD4+41BB+ Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:81.1% (observed36timesof44pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:588) MASLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRG SQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDS QPSDSATYLCAWNSGGSNYKLTFGKGTLLTVNPNIQNPEPAVYQLKDPRS QDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSN QTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLR ILLLKVAGFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHL GLLCCGAFSLLWAGPVNAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYW YRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPS QTSVYFCASSYSQAWGQPQHFGDGTRLSILEDLRNVTPPKVSLFEPSKAE IANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSY CLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAE AWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKR KNS
[0145] The statistics for 4259-F6-TCR from patient 4259 are set forth in Table 6 below.
TABLE-US-00008 TABLE 6 Parameter # Frequency Total wells 96 100% CDR3alpha 41 42.7% CDR3beta 47 49.0% 4259-F6-TCR pairs 36 37.5% Total paired TCRs 44 45.8%
Example 4
[0146] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4127 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening).
[0147] Experiments were carried out as described for
[0148] T cells expressing the 4127-TCR1 specific for p53-G245S were co-cultured with allogeneic (DRB3*01:01:01 or DRB3*02:02:01) APCs which were (1) electroporated with TMGs composed of irrelevant, WT p53 or mutated p53 sequences or (2) pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-G245 sequence or mutated p53-G245S sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
Example 5
[0149] T cells from 27 patients were screened by (i) inducing autologous antigen presenting cells (APCs) of a patient to present at least one mutated p53 amino acid sequence; (ii) co-culturing autologous T cells of the patient with the autologous APCs that present the mutated p53 amino acid sequence; and (iii) selecting the autologous T cells that (a) were co-cultured with the autologous APCs that present the mutated p53 amino acid sequence. A summary of responses to p53 hostpot mutations by T cells using the screening method is provided in Table 7.
TABLE-US-00009 TABLE 7 % reactive of Mutation # Pt % Pt # tested # reactive screened R175H 7 19% 6 4 66.7% Y220C 3 8% 3 2 66.7% G245D 1 3% 1 0 0.0% G245S 2 6% 1 1 100.0% R248L 0 0% 0 0 Not applicable R248Q 6 17% 6 3 50.0% R248W 6 17% 5 3 60.0% R249S 0 0% 0 0 Not applicable R273C 2 6% 1 0 0.0% R273H 5 14% 5 1 20.0% R273L 0 0% 0 0 Not applicable R282W 4 11% 3 2 66.7% Total 36 100% 31 16 51.6%
Example 6
[0150] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4273 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening). This example also demonstrates the isolation of two anti-mutated p53 TCRs from patient 4273.
[0151] Experiments were carried out as described for
[0152] TIL fragments (F1-F24, n=24) from patient 4273 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of WT p53-R248 sequence or mutated p53-R248W sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0153] For patient 4273, F15 was the most reactive fragment and the responses by F15 to the LP and TMG were comparable and primarily by CD4 T cells. So 4273-F15 was co-cultured with APCs pulsed with the R248W LP, and the following day we sorted CD4+41BB+ T cells as single cells into wells a 96 well PCR plate at one cell per well. The PCR plate has an RT-PCR solution in each well, which amplifies the TCR alpha and beta CDR3 regions in the same solution. The wells of the plate are then split into two 96 well PCR plates and a second PCR round is performed to amplify either the CDR3 alpha or the CDR3 beta as separate reactions. The PCR products from each well (total of 192 PCR products mapped to each wellalpha or beta) are sequenced by Sanger sequencing. The nucleotide sequence is inputted into IMGT/V-QUEST (imgt.org/IMGT_vquest/vquest?livret=0&Option=humanTcR), IgBlast (ncbi.nlm.nih.gov/igblast/igblast.cgi?CMD=Web&SEARCH TYPE=TCR&LINK LOC=igt ab) and translated by Expasy (web.expasy.org/translate/). The variable family is determined and fused to the CDR3 and junction (J or DJ) from the translated sequence. The variable sequence is fused to the murine constant sequence and the reconstructed TCRalpha and TCRbeta are linked by furin-felxible-P2A (RAKR-SGSG-ATNFSLLKQAGDVEENPGP) (SEQ ID NO: 26). Then the sequence is synthesized into DNA de novo and cloned into an expression vector (gamma-retrovirus or SLEEPING BEAUTY (SB) transposon (University of Minnesota, Minneapolis, Minn.)). T cells are then made to express the TCR using the standard viral transduction or non-viral transposition protocols and T cells expressing murinized TCRs (as detected by mouse TCR beta constant chain) are tested against the putative peptide.
[0154] Autologous APCs were transfected with TMG encoding irrelevant mutations, WT p53 sequences or mutated p53 sequences including p53-R248W. Media alone and PMA and lonomycin were negative and positive controls, respectively. TIL from patient 4273 (fragment cultures 8 and 15) were co-cultured overnight at 37 C. with TMG transfected APCs. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0155] Autologous APCs were pulsed with 25 amino acid peptides corresponding to the WT or mutated p53-R248W neoepitope for 2 hours at 37 C. TIL from patient 4273 (fragment culture 15) with specificity to p53-R248W were co-cultured overnight at 37 C. with peptide-pulsed APCs. DMSO was peptide vehicle. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0156] Autologous APCs were pulsed with 15 amino acid peptides from the p53-R248W neoepitope overlapping 14 amino acids. TIL from patient 4273 (fragment culture 15) with specificity to p53-R248W were co-cultured overnight at 37 C. with peptide-pulsed APCs. DMSO was peptide vehicle, media alone (T cells only) and PMA and ionomycin were controls. The 25 amino acid peptides (wt p53-R248 and mutated p53-R248W) were additional controls for the 15 amino acid peptides. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells).fwdarw.CD4+CD8. The results are shown in
[0157] Cos7 cells (2.510.sup.4 per well) were plated on wells of flat-bottom 96 well plates. The following day, cells were co-transfected with individual HLA alleles from patient 4273 and either WT or mutated TP53 TMG with or without the p53-R248W neoantigen, respectively. The following day, TIL with specificity to p53-R248W from Patient 4273 (fragment culture 15) were co-cultured with transfected Cos7 cells overnight at 37 C. Secretion of IFN- was evaluated by ELISA. The results are shown in
[0158] T cells expressing mock (no TCR) or 4273-TCR1a2 were co-cultured with autologous APCs which were pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-R248 sequence or mutated p53-R248W sequence. Media alone and PMA and lonomycin were negative and positive controls, respectively. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated by ELISPOT. The results are shown in
[0159] The sequence of TCR 4273-TP53-R248W-TCR1a1, which was isolated from Patient 4273, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 437), the second underlined region is the CDR2alpha (SEQ ID NO: 438), the third underlined region is the CDR3alpha (SEQ ID NO: 439), the fourth underlined region is the CDR1beta (SEQ ID NO: 440), the fifth underlined region is the CDR2beta (SEQ ID NO: 441), and the sixth underlined region is the CDR3beta (SEQ ID NO: 442). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 443) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 444) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 445) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 446) includes the sequence starting immediately after the linker and ending with the carboxyl ter
TABLE-US-00010 TCRname:4273-TP53-R248W-TCR1a1 Recognitionofp53mutation:R248W Method:p53hotspotmutationuniversal screening (SEQIDNO:563) MASLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGS QSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQP SDSATYLCAVTLCGGYNKLIFGAGTRLAVHPNIQNPEPAVYQLKDPRSQDS TLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSF TCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLK VAGFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHNQVLCCV VLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQ GLRLIYYSQIVNDFQKGDIVEGYSVSREKKESFPLTVTSAQKNPTAFYLCA SSSRDYEQYFGPGTRLTVTEDLRNVTPPKVSLFEPSKAEIANKQKATLVCL ARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFW HNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASY QQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0160] The sequence of TCR 4273-TP53-R248W-TCR1a2, which was isolated from Patient 4273, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 447), the second underlined region is the CDR2alpha (SEQ ID NO: 448), the third underlined region is the CDR3alpha (SEQ ID NO: 449), the fourth underlined region is the CDR1beta (SEQ ID NO: 450), the fifth underlined region is the CDR2beta (SEQ ID NO: 451), and the sixth underlined region is the CDR3beta (SEQ ID NO: 452). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 453) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 454) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 455) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 456) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
TABLE-US-00011 TCRname:4273-TP53-R248W-TCR1a2 Recognitionofp53mutation:R248W Method:p53hotspotmutationuniversal screening (SEQIDNO:564) MASLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGS QSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQP SDSATYLCAVTLSGGYNKLIFGAGTRLAVHPNIQNPEPAVYQLKDPRSQDS TLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSF TCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLK VAGFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHNQVLCCV VLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQ GLRLIYYSQIVNDFQKGDIVEGYSVSREKKESFPLTVTSAQKNPTAFYLCA SSSRDYEQYFGPGTRLTVTEDLRNVTPPKVSLFEPSKAEIANKQKATLVCL ARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFW HNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASY QQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0161] The statistics for the TCRs of Patient 4273 are set forth in Table 8 below. In Table 8, 96 total wells sorted with 41BB+ T cells after co-culture with mutated p53 protein (TMG or peptide). 77 wells had productive pairs (meaning had (1) a sequence and (2) no stop codons in the sequence) for a pairing frequency of 80.2%. 43 of those pairs were the CDR3A/CDR3B combination to make 4273-TP53-R248W-TCR1a1 (55.8% of the productive pairs). 30 of those pairs were the CDR3A/CDR3B combination to make 4273-TP53-R248W-TCR1a2 (39% of the productive pairs). Overall, the CDR3A and CDR3B for 4273-TP53-R248W-TCR1a1 were found 50 and 83 times, respectively, out of 96 wells. Overall, the CDR3A and CDR3B for 4273-TP53-R248W-TCR1a2 were found 33 and 83 times, respectively, out of 96 wells.
TABLE-US-00012 TABLE8 4273-TP53- 4273-TP53- R248W- R248W- TCRname TCR1a1 TCR1a2 CDR3a CAVTLCGGYNKLIF CAVTLSGGYNKLIF (SEQIDNO: (SEQIDNO: 439) 449) CDR3b CASSSRDYEQYF CASSSRDYEQYF (SEQIDNO: (SEQIDNO: 442) 452) totalwells 96 totalCDR3a/CDR3b 77 pairs %paired 80.21% #timesCDR3a 50 33 #timesCDR3b 83 83 pairedCDR3a/CDR3b 43 30 %ofpairedCDR3a/ 55.84% 38.96% CDR3bpairs
Example 7
[0162] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4149. This example also demonstrates the isolation of one anti-mutated p53 TCR from patient 4149.
[0163] Experiments were carried out as described for
[0164] A TCR (4149-TCRa2b1 or 4149-TCRa2b2) was transposed into autologous PBL from patient 4149 and co-cultured with autologous APCs which were (1) electroporated with TMG composed of irrelevant, WT p53, or mutated p53 sequence or (2) pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of WT p53-Y220 sequence or mutated p53-Y220C sequence. Combination of PMA and ionomycin was positive control. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0165] The percentage of CD4+4-1BB+ cells by TCRAD deep sequencing and TCRB deep sequencing was also performed. The results are shown in Table 9.
TABLE-US-00013 TABLE 9 CDR3 CDR3 (% of CD4+41BB+ (% of CD4+41BB+ by TCRAD by TCRB TCR name deep sequencing) deep sequencing) 4149-TCR-a2b1 20% 66% 4149-TCR-a2b2 20% 18%
[0166] Mapping of putative p53.sup.Y220C minimal epitope recognized by 4149-F11: Autologous DC cells were peptide pulsed (10 g/mL) and rested overnight in granulocyte-macrophage colony-stimulating factor (GM-CSF) and IL-4. TIL were rested for 2-3 days in 500 CU/mL IL-2. 210.sup.4 TIL and 10.sup.5 target cells were co-cultured overnight at 37 C. IFN- was measured by ELISPOT. The results are shown in Table 10. 4-1BB expression was measured by FACS with the gate lymphocytes\PI(neg)CD3+\CD3+CD4+. The results are shown in
TABLE-US-00014 TABLE10 ELISPOT Result Positive (+)or negative Pep- ()for SEQ tide IFN- ID No. production Peptide NO: 0 Vehicle Not appli- cable 1 + DRNTFRHSVVVPCEP 508 2 + RNTFRHSVVVPCEPP 509 3 + NTFRHSVVVPCEPPE 510 4 + TFRHSVVVPCEPPEV 511 5 +(weak) FRHSVVVPCEPPEVG 512 6 RHSVVVPCEPPEVGS 513 7 HSVVVPCEPPEVGSD 514 8 SVVVPCEPPEVGSDC 515 9 VVVPCEPPEVGSDCT 516 10 VVPCEPPEVGSDCTT 517 11 VPCEPPEVGSDCTTI 518
[0167] Cos? cells (2.510.sup.4 per well) were plated on wells of flat-bottom 96 well plates. After 20 hours, cells were co-transfected with individual HLA alleles with or without TMGs. After 20 hours, autologous DC cells were transfected with TMG in parallel. All HLA Class-II alleles were co-transfected into one set of wells with or without TMG. Cells not transfected with TMG were pulsed with p53-Y220C 15-mer peptide for 2-3 hours at 37 C. at 10 g/mL. After washing, 4149-TCRa2b2-transposed T cells (10.sup.5) at day+14 of second REP were added to wells and co-cultured overnight at 37 C. IFN- secretion was measured by ELISA. The results are shown in
TABLE-US-00015 TABLE11 HLA Peptide Affinity,nM Rank DRB3*02:02 NTFRHSVVVPCEPPE 433.8 17 (SEQIDNO:510)
[0168] DRB3*02 expression was detected in 1367 of 3719 (37%) of DRB_typed patients in the NCI HLA database and in 5 of 9 (56%) endometrial and ovarian cancer patients at NCI-SB. The reported frequency of the DRB3*02 allele is very high.
[0169] The sequence of TCR 4149TCRa2b2, which was isolated from Patient 4149, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 57), the second underlined region is the CDR2alpha (SEQ ID NO: 58), the third underlined region is the CDR3alpha (SEQ ID NO: 59), the fourth underlined region is the CDR1beta (SEQ ID NO: 60), the fifth underlined region is the CDR2beta (SEQ ID NO: 61), and the sixth underlined region is the CDR3beta (SEQ ID NO: 62). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 63) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 64) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 65) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 66) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0170] Cancer reactive T cells were identified using the screening method set forth below. The p53 reactive cells for this patient were identified by the method described in U.S. Application No. 2017/0224800 (Tran method).
TABLE-US-00016 TCRname:4149TCRa2b2 Recognitionofp53mutation:Y220C Screeningmethod:Usedtovalidatethep53 hotspotmutationuniversalscreening(the latterisgiven) Co-culturetoidentifyTCR:Co-culture4149-F11TIL fragmentwithp53-Y220Clongpeptide,sortedCD4+ 41BB+Tcells MethodtoidentifyTCR:Frequencypairing.CD4+ 41BB+sortedTcellswereexpandedinREPand theresultingTcellculturewassubjectedtoTCRAD (alpha)andTCRB(beta)deepsequencingbyAdaptive Biotechnologies.IpairedthetoptwoTCRalphas withthetoptwoTCRbetasinamatrixof4total TCRs.ThesecondTCRalphaandsecondTCRbetawas thereactiveTCRhenceTCRa2b2nomenclature. AbundanceofTCRamongstallTCRs:asbelow TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:565) MASAPISMLAMLFTLSGLRAQSVAQPEDQVNVAEGNPLTVKCTYSVSGNPY LFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALV SDSALYFCAVRVWDYKLSFGAGTTVTVRANIQNPEPAVYQLKDPRSQDSTL CLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTC QDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVA GFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHNQVLCCVVL CFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGL RLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS ISAGGDGYTFGSGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCL ARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFW HNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASY QQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0171] The statistics for TCR 4149TCRa2b2 of Patient 4149 are set forth in Table 12 below.
TABLE-US-00017 TABLE12 Rankof unique, productive CDR3 CDR3 CDR3s CDR3Counts Frequency Alpha: 2of4,308 648,707of 19.6% CAVRVWDYKLSF 3,309,400 (SEQIDNO:59) Beta: 2of3,176 104,325of 18.0% CASSISAGGDGYTF 578,948 (SEQIDNO:62)
Example 8
[0172] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4213 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening). This example also demonstrates the isolation of twelve anti-mutated p53 TCRs from patient 4213.
[0173] Experiments were carried out as described for
[0174] TIL fragments (F2 and F24) from patient 4213 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of the mutated p53-R248Q sequence. Co-cultures were performed overnight at 37 C. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0175] CD4+ T cells came from patient 4213's peripheral blood lymphocytes. The CD4+ T cell culture was co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of the mutated p53-R248Q sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated by ELISPOT. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0176] The sequence of 4213-F2-TCR1, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 317), the second underlined region is the CDR2alpha (SEQ ID NO: 318), the third underlined region is the CDR3alpha (SEQ ID NO: 319), the fourth underlined region is the CDR1beta (SEQ ID NO: 320), the fifth underlined region is the CDR2beta (SEQ ID NO: 321), and the sixth underlined region is the CDR3beta (SEQ ID NO: 322). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 323) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 324) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 325) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 326) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0177] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00018 TCRname:4213-F2-TCR1 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:Co-culture4213-F2with R248Qlongpeptide,sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:8.3% (observed2timesof24pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:566) MAMLLGASVLILWLQPDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCDY TNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLH IVPSQPGDSAVYFCAANTGNQFYFGTGTSLTVIPNIQNPEPAVYQLKDPRS QDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQ TSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRIL LLKVAGFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLL CWAALCLLGAELTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQI LGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAV YLCASSHLAGEFYNEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANK QKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSR LRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRAD CGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0178] The statistics for TCR 4213-F2-TCR1 of Patient 4213 are set forth in Table 13 below.
TABLE-US-00019 TABLE 13 Parameter # Frequency Total wells 96 100% CDR3alpha 3 3.1% CDR3beta 8 8.3% 4213-F2-TCR1 pairs 2 2.1% Total paired TCRs 24 25.0%
[0179] The sequence of 4213-F2-TCR2, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ 1D NO: 327), the second underlined region is the CDR2alpha (SEQ ID NO: 328), the third underlined region is the CDR3alpha (SEQ ID NO: 329), the fourth underlined region is the CDR1beta (SEQ ID NO: 330), the fifth underlined region is the CDR2beta (SEQ ID NO: 331), and the sixth underlined region is the CDR3beta (SEQ ID NO: 332). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 333) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 334) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 335) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 336) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0180] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00020 TCRname:4213-F2-TCR2 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:Co-culture4213-F2with R248Qlongpeptide,sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:12.5% (observed3timesof24pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:567) MAGAFLLYVSMKMGGTAGQSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSW YQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSAS YFCAFAYGQNFVFGPGTRLSVLPNIQNPEPAVYQLKDPRSQDSTLCLFTDF DSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKE TNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLM TLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHFRLLCCVAFCLLGAG PVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQY YNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSPLGDSG NTIYFGEGSWLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFF PDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFWHNPRN HFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVL SATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0181] The statistics for TCR 4213-F2-TCR2 of Patient 4213 are set forth in Table 14 below.
TABLE-US-00021 TABLE 14 Parameter # Frequency Total wells 96 100% CDR3alpha 4 4.2% CDR3beta 4 4.2% 4213-F2-TCR2 pairs 3 3.1% Total paired TCRs 24 25.0%
[0182] The sequence of 4213-F2-TCR3, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 337), the second underlined region is the CDR2alpha (SEQ ID NO: 338), the third underlined region is the CDR3alpha (SEQ ID NO: 339), the fourth underlined region is the CDR1beta (SEQ ID NO: 340), the fifth underlined region is the CDR2beta (SEQ ID NO: 341), and the sixth underlined region is the CDR3beta (SEQ ID NO: 342). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 343) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 344) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 345) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 346) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0183] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00022 TCRname:4213-F2-TCR3 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:Co-culture4213-F2with R248Qlongpeptide,sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:70.8% (observed17timesof24pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:568) MATLLGVSLVILWLQLARVNSQQGEEDPQALSIQEGENATMNCSYKTSINN LQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAA DTASYFCATDAWNNDMRFGAGTRLTVKPNIQNPEPAVYQLKDPRSQDSTLC LFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQ DIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAG FNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHIGLLCCVAFS LLWASPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLR LIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE SQGNTEAFFGQGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLA RGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFWH NPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQ QGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0184] The statistics for TCR 4213-F2-TCR3 of Patient 4213 are set forth in Table 15 below.
TABLE-US-00023 TABLE 15 Parameter # Frequency Total wells 96 100% CDR3alpha 19 19.8% CDR3beta 42 43.8% 4213-F2-TCR3 pairs 17 17.7% Total paired TCRs 24 25.0%
[0185] The sequence of 4213-F24-TCRa1, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 347), the second underlined region is the CDR2alpha (SEQ ID NO: 348), the third underlined region is the CDR3alpha (SEQ ID NO: 349), the fourth underlined region is the CDR1beta (SEQ ID NO: 350), the fifth underlined region is the CDR2beta (SEQ ID NO: 351), and the sixth underlined region is the CDR3beta (SEQ ID NO: 352). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 353) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 354) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 355) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 356) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0186] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00024 TCRname:4213-F24-TCRa1 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:Co-culture4213-F24 withR248Qlongpeptide,sortedCD8+41BB+T cells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:15.9% (observed7timesof44pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:569) MAKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYTVSPF SNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQ LSDSASYICVVSSYKIIFGTGTRLHVFPNIQNPEPAVYQLKDPRSQDSTLC LFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQ DIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAG FNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLFWVAFC LLGAYHTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQRLGQGLE FLIYFQGNSAPDKSGLPSDRFSAERTGESVSTLTIQRTQQEDSAVYLCASS PIQGENSPLHFGNGTRLTVTEDLRNVTPPKVSLFEPSKAEIANKQKATLVC LARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATF WHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSAS YQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0187] The statistics for TCR 4213-F24-TCRa1 of Patient 4213 are set forth in Table 16 below.
TABLE-US-00025 TABLE 16 Parameter # Frequency Total wells 96 100% CDR3alpha 7 7.3% CDR3beta 80 83.3% 4213-F24-TCRa1 pairs 7 7.3% Total paired TCRs 44 45.8%
[0188] The sequence of 4213-F24-TCRa2, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 357), the second underlined region is the CDR2alpha (SEQ ID NO: 358), the third underlined region is the CDR3alpha (SEQ ID NO: 359), the fourth underlined region is the CDR1beta (SEQ ID NO: 360), the fifth underlined region is the CDR2beta (SEQ ID NO: 361), and the sixth underlined region is the CDR3beta (SEQ ID NO: 362). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 363) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 364) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 365) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 366) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0189] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00026 TCRname:4213-F24-TCRa2 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:Co-culture4213-F24 withR248Qlongpeptide,sortedCD8+41BB+T cells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:84.1% (observed37timesof44pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:570) MAKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYTVSPF SNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQ LSDSASYICVVSSYKLIFGTGTRLQVFPNIQNPEPAVYQLKDPRSQDSTLC LFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQ DIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAG FNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLFWVAFC LLGAYHTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQRLGQGLE FLIYFQGNSAPDKSGLPSDRFSAERTGESVSTLTIQRTQQEDSAVYLCASS PIQGENSPLHFGNGTRLTVTEDLRNVTPPKVSLFEPSKAEIANKQKATLVC LARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATF WHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSAS YQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0190] The statistics for TCR 4213-F24-TCRa2 of Patient 4213 are set forth in Table 17 below.
TABLE-US-00027 TABLE 17 Parameter # Frequency Total wells 96 100% CDR3alpha 39 40.6% CDR3beta 80 83.3% 4213-F24-TCRa2 pairs 37 38.5% Total paired TCRs 44 45.8%
[0191] The sequence of 4213-PBL-TCR1, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 367), the second underlined region is the CDR2alpha (SEQ ID NO: 368), the third underlined region is the CDR3alpha (SEQ ID NO: 369), the fourth underlined region is the CDR1beta (SEQ ID NO: 370), the fifth underlined region is the CDR2beta (SEQ ID NO: 371), and the sixth underlined region is the CDR3beta (SEQ ID NO: 372). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 373) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 374) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 375) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 376) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0192] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00028 TCRname:4213-PBL-TCR1 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlongpep- tidewereco-culturedwithR248Qlongpeptideand CD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:9.5% (observed6timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:571) MALLLVPAFQVIFTLGGTRAQSVTQLDSQVPVFEEAPVELRCNYSSSVSVY LFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHI SDTAEYFCAVSKGTGAQKLVFGQGTRLTINPNIQNPEPAVYQLKDPRSQDS TLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSF TCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLK VAGFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHNQVLCCV VLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQ GLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLIVTSAQKNPTASYLCA SEAFFGQGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFF PDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFWHNPRN HFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVL SATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0193] The statistics for TCR 4213-PBL-TCR1 of Patient 4213 are set forth in Table 18 below.
TABLE-US-00029 TABLE 18 Parameter # Frequency Total wells 192 100% CDR3alpha 9 4.7% CDR3beta 6 3.1% 4213-PBL-TCR1 pairs 6 3.1% Total paired TCRs 63 32.8%
[0194] The sequence of 4213-PBL-TCR2, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 377), the second underlined region is the CDR2alpha (SEQ ID NO: 378), the third underlined region is the CDR3alpha (SEQ ID NO: 379), the fourth underlined region is the CDR1beta (SEQ ID NO: 380), the fifth underlined region is the CDR2beta (SEQ ID NO: 381), and the sixth underlined region is the CDR3beta (SEQ ID NO: 382). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 383) includes the sequence starting from the amino terminus and ending prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 384) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 385) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 386) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0195] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00030 TCRname:4213-PBL-TCR2 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlongpep- tidewereco-culturedwithR248Qlongpeptideand CD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:7.9% (observed5timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:572) MALVTSITVLLSLGIMGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIH WYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAV YYCILASGAGSYQLTFGKGTKLSVIPNIQNPEPAVYQLKDPRSQDSTLCLF TDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDI FKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFN LLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHCRLLCCVVFCLL QAGPLDTAVSQTPKYLVTQMGNDKSIKCEQNLGHDTMYWYKQDSKKFLKIM FSYNNKELIINETVPNRFSPKSPDKAHLNLHINSLELGDSAVYFCASRTIG YNTEAFFGQGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARG FFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSATFWHNP RNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQG VLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0196] The statistics for TCR 4213-PBL-TCR2 of Patient 4213 are set forth in Table 19 below.
TABLE-US-00031 TABLE 19 Parameter # Frequency Total wells 192 100% CDR3alpha 8 4.2% CDR3beta 8 4.2% 4213-PBL-TCR2 pairs 5 2.6% Total paired TCRs 63 32.8%
[0197] The sequence of 4213-PBL-TCR3, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 387), the second underlined region is the CDR2alpha (SEQ ID NO: 388), the third underlined region is the CDR3alpha (SEQ ID NO: 389), the fourth underlined region is the CDR1beta (SEQ ID NO: 390), the fifth underlined region is the CDR2beta (SEQ ID NO: 391), and the sixth underlined region is the CDR3beta (SEQ ID NO: 392). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 393) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 394) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 395) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 396) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0198] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00032 TCRname:4213-PBL-TCR3 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutationuniversal screening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlongpep- tidewereco-culturedwithR248Qlongpeptideand CD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:6.3% (observed4timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:573) MAKIRQFLLAILWLQLSCVSAAKNEVEQSPQNLTAQEGEFITINCSYSVGI SALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPR DSAVYICAALSYNTDKLIFGTGTRLQVFPNIQNPEPAVYQLKDPRSQDSTL CLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTC QDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVA GFNLLMTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAAL CLLGADHTGAGVSQTPSNKVTEKGKYVELRCDPISGHTALYWYRQSLGQGP EFLIYFQGTGAADDSGLPNDRFFAVRPEGSVSTLKIQRTERGDSAVYLCAS SLSGLLQETQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEIANKQKATLV CLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYCLSSRLRVSAT FWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSA SYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0199] The statistics for TCR 4213-PBL-TCR3 of Patient 4213 are set forth in Table 20 below.
TABLE-US-00033 TABLE 20 Parameter # Frequency Total wells 192 100% CDR3alpha 4 2.1% CDR3beta 7 3.6% 4213-PBL-TCR3 pairs 4 2.1% Total paired TCRs 63 32.8%
[0200] The sequence of 4213-PBL-TCR4a1, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 397), the second underlined region is the CDR2alpha (SEQ ID NO: 398), the third underlined region is the CDR3alpha (SEQ ID NO: 399), the fourth underlined region is the CDR1beta (SEQ ID NO: 400), the fifth underlined region is the CDR2beta (SEQ ID NO: 401), and the sixth underlined region is the CDR3beta (SEQ ID NO: 402). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 403) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 404) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 405) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 406) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0201] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00034 TCRname:4213-PBL-TCR4a1 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlong peptidewereco-culturedwithR248Qlongpeptide andCD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:3.2% (observed2timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:574) MAYSPGLVSLILLLLGRTRGNSVTQMEGPVTLSEEAFLTINCTYT ATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETT SFHLEKGSVQVSDSAVYFCALSHTGSSNTGKLIFGQGTRLQVKPN IQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITD KCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC DATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGENLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAALCLLGAE LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGP KLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSA VYLCASSTGGGRHQPQHFGDGTRLSILEDLRNVTPPKVSLFEPSK AEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAY KESNYSYCLSSRLRVSATEWHNPRNHERCQVQFHGLSEEDKWPEG SPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKAT LYAVLVSTLVVMAMVKRKNS
[0202] The statistics for TCR 4213-PBL-TCR4a1 of Patient 4213 are set forth in Table 21 below.
TABLE-US-00035 TABLE 21 Parameter # Frequency Total wells 192 100% CDR3alpha 2 1.0% CDR3beta 36 18.8% 4213-PBL-TCR4a1 pairs 2 1.0% Total paired TCRs 63 32.8%
[0203] The sequence of 4213-PBL-TCR4a2, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 407), the second underlined region is the CDR2alpha (SEQ ID NO: 408), the third underlined region is the CDR3alpha (SEQ ID NO: 409), the fourth underlined region is the CDR1beta (SEQ ID NO: 410), the fifth underlined region is the CDR2beta (SEQ ID NO: 411), and the sixth underlined region is the CDR3beta (SEQ ID NO: 412). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 413) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 414) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 415) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 416) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0204] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00036 TCRname:4213-PBL-TCR4a2 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlong peptidewereco-culturedwithR248Qlong peptideandCD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:3.2% (observed2timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:575) MAYSPGLVSLILLLLGRTRGNSVTQMEGPVTLSEEAFLTINCTYT ATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETT SFHLEKGSVQVSDSAVYFCALSQTGSSKTGKLIFGQGTRLQVKPN IQNPEPAVYQLKDPRSQDSTLCLFTDEDSQINVPKTMESGTFITD KCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC DATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAALCLLGAE LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGP KLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSA VYLCASSTGGGRHQPQHFGDGTRLSILEDLRNVTPPKVSLFEPSK AEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAY KESIVYSYCLSSRLRVSATEWHNPRNHERCQVQFHGLSEEDKWPE GSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKA TLYAVLVSTLVVMAMVKRKNS
[0205] The statistics for TCR 4213-PBL-TCR4a2 of Patient 4213 are set forth in Table 22 below.
TABLE-US-00037 TABLE 22 Parameter # Frequency Total wells 192 100% CDR3alpha 2 1.0% CDR3beta 36 18.8% 4213-PBL-TCR4a2 pairs 2 1.0% Total paired TCRs 63 32.8%
[0206] The sequence of 4213-PBL-TCR4a3, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 417), the second underlined region is the CDR2alpha (SEQ ID NO: 418), the third underlined region is the CDR3alpha (SEQ ID NO: 419), the fourth underlined region is the CDR1beta (SEQ ID NO: 420), the fifth underlined region is the CDR2beta (SEQ ID NO: 421), and the sixth underlined region is the CDR3beta (SEQ ID NO: 422). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 423) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 424) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 425) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 426) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0207] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00038 TCRname:4213-PBL-TCR4a3 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlong peptidewereco-culturedwithR248Qlongpeptide andCD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:4.8% (observed3timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:576) MAYSPGLVSLILLLLGRTRGNSVTQMEGPVTLSEEAFLTINCTYT ATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETT SFHLEKGSVQVSDSAVYFCALSQTGSSNTGKLIFGQGTRLQVKPN IQNPEPAVYQLKDPRSQDSTLCLETDFDSQINVPKTMESGTFITD KCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC DATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGENLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAALCLLGAE LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGP KLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSA VYLCASSTGGGRHQPQHFGDGTRLSILEDLRNVTPPKVSLFEPSK AEIANKQKATLVCLARGFFPDTIVELSWWVNGKEVHSGVCTDPQA YKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPE GSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKA TLYAVLVSTLVVMAMVKRKNS
[0208] The statistics for TCR 4213-PBL-TCR4a3 of Patient 4213 are set forth in Table 23 below.
TABLE-US-00039 TABLE 23 Parameter # Frequency Total wells 192 100% CDR3alpha 4 2.1% CDR3beta 36 18.8% 4213-PBL-TCR4a3 pairs 3 1.6% Total paired TCRs 63 32.8%
[0209] The sequence of 4213-PBL-TCR4a4, which was isolated from Patient 4213, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 427), the second underlined region is the CDR2alpha (SEQ ID NO: 428), the third underlined region is the CDR3alpha (SEQ ID NO: 429), the fourth underlined region is the CDR1beta (SEQ ID NO: 430), the fifth underlined region is the CDR2beta (SEQ ID NO: 431), and the sixth underlined region is the CDR3beta (SEQ ID NO: 432). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 433) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 434) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 435) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 436) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0210] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00040 TCRname:4213-PBL-TCR4a4 Recognitionofp53mutation:R248Q Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:CD4+MemoryTcells afterinvitrosensitizationwithR248Qlong peptidewereco-culturedwithR248Qlongpeptide andCD4+41BB+Tcellsweresorted MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:3.2% (observed2timesof63pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:577) MAYSPGLVSLILLLLGRTRGNSVTQMEGPVTLSEEAFLTINCTYT ATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETT SFHLEKGSVQVSDSAVYFCALSTTGSSNTGKLIFGQGTTLQVKPN IQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITD KCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC DATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAALCLLGAE LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGP KLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSA VYLCASSTGGGRHQPQHFGDGTRLSILEDLRNVTPPKVSLFEPSK AEIANKQKATLVCLARGFFPDHVELSWWVNGKEVIISGVCTDPQA YKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPE GSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKA TLYAVLVSTLVVMAMVKRKNS
[0211] The statistics for TCR 4213-PBL-TCR4a4 of Patient 4213 are set forth in Table 24 below.
TABLE-US-00041 TABLE 24 Parameter # Frequency Total wells 192 100% CDR3alpha 2 1.0% CDR3beta 36 18.8% 4213-PBL-TCR4a3 pairs 2 1.0% Total paired TCRs 63 32.8%
Example 9
[0212] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4268 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening). This example also demonstrates the isolation of five anti-mutated p53 TCRs from patient 4268.
[0213] Experiments were carried out as described for
[0214] TIL fragments (F1-F24, n=24) from patient 4268 were co-cultured with autologous APCs electroporated with TMG composed of irrelevant, WT p53, or mutated p53 sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0215] TIL fragments (F1-F24, n=24) from patient 4268 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of WT p53-R248 sequence or mutated p53-R248Q sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0216] TIL fragments (F1-F24, n=24) from patient 4268 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of wt p53-R248 sequence or mutated p53-R248Q sequence. Co-cultures were performed overnight at 37 C. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells). The results are shown in
[0217] The sequence of 4268-TCR1, which was isolated from Patient 4268, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 137), the second underlined region is the CDR2alpha (SEQ ID NO: 138), the third underlined region is the CDR3alpha (SEQ ID NO: 139), the fourth underlined region is the CDR1beta (SEQ ID NO: 140), the fifth underlined region is the CDR2beta (SEQ ID NO: 141), and the sixth underlined region is the CDR3beta (SEQ ID NO: 142). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 143) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 144) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 145) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 146) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0218] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00042 TCRname:4268-TCR1 Recognitionofp53mutation:R248Q Method:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4268-F7 and4268-F8withp53-R248Qlong peptide,sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:78.7% (observed48timesof61pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:578) MASLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCT YSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKAS QYVSLLIRDSQPSDSATYLCAVSWYSTLTFGKGTMLLVSPNIQNP EPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVL DMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATL TEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSSRAK RSGSGATNFSLLKQAGDVEENPGPMHTRLFFYVALCLLWAGHRDA GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIY YSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCA SSGSRTDTQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQ KATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNVYS YCLSSRLRVSATEWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVT QNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLV STLVVMAMVKRKNS
[0219] The statistics for TCR 4268-TCR1 of Patient 4268 are set forth in Table 25 below.
TABLE-US-00043 TABLE 25 Parameter # Frequency Total wells 96 100% CDR3alpha 54 56.3% CDR3beta 71 74.0% 4268-TCR1 pairs 48 50.0% Total paired TCRs 61 63.5%
[0220] The sequence of 4268-TCR2, which was isolated from Patient 4268, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 147), the second underlined region is the CDR2alpha (SEQ ID NO: 148), the third underlined region is the CDR3alpha (SEQ ID NO: 149), the fourth underlined region is the CDR1beta (SEQ ID NO: 150), the fifth underlined region is the CDR2beta (SEQ ID NO: 151), and the sixth underlined region is the CDR3beta (SEQ ID NO: 152). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 153) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 154) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 155) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 156) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0221] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00044 TCRname:4268-TCR2 Recognitionofp53mutation:R248Q Method:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4268-F7 and4268-F8withp53-R248Qlong peptide,sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:6.6% (observed4timesof61pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:579) MALKFSVSILWIQLAWVSTQLLEQSPQFLSIQEGENLTVYCNSS SVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARK DSSLHITAAQPGDTGLYLCAGEFAGNQFYFGTGTSLTVIPNIQN PEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKC VLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCD ATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHCRLLCCAVLCLLGA VPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKK PPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPED SALYLCASSQVGLTYEQYFGPGTRLTVTEDLRNVTPPKVSLFEP SKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDP QAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDK WPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEIL LGKATLYAVLVSTLVVMAMVKRKNS
[0222] The statistics for TCR 4268-TCR2 of Patient 4268 are set forth in Table 26 below.
TABLE-US-00045 TABLE 26 Parameter # Frequency Total wells 96 100% CDR3alpha 6 6.3% CDR3beta 4 4.2% 4268-TCR2 pairs 4 4.2% Total paired TCRs 61 63.5%
[0223] The sequence of 4268-TCR3, which was isolated from Patient 4268, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 157), the second underlined region is the CDR2alpha (SEQ ID NO: 158), the third underlined region is the CDR3alpha (SEQ ID NO: 159), the fourth underlined region is the CDR1beta (SEQ ID NO: 160), the fifth underlined region is the CDR2beta (SEQ ID NO: 161), and the sixth underlined region is the CDR3beta (SEQ ID NO: 162). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 163) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 164) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 165) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 166) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0224] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00046 TCRname:4268-TCR3 Recognitionofp53mutation:R248Q Method:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4268-F15 withp53-R248Qlongpeptide,sortedCD8+41BB+ Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:88.6% (observed31timesof35pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:580) MASAPISMLAMLFTLSGLRAQSVAQPEDQVNVAEGNPLTVKCTY SVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNK SQTSFHLKKPSALVSDSALYFCAVRDNSGGSNYKLTFGKGTLLT VNPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESG TFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYP SSDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGENLL MTLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWA ALCLLGAELTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYW YQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLK IQPAKLEDSAVYLCASSLGQGQTQYFGPGTRLLVLEDLRNVTPP KVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVH SGVCTDPQAYKESNVYSYCLSSRLRVSATFWHNPRNHFRCQVQF HGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS ATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0225] The statistics for TCR 4268-TCR3 of Patient 4268 are set forth in Table 27 below.
TABLE-US-00047 TABLE 27 Parameter # Frequency Total wells 96 100% CDR3alpha 42 43.8% CDR3beta 37 38.5% 4268-TCR3 pairs 31 32.3% Total paired TCRs 35 36.5%
[0226] The sequence of 4268-TCR4, which was isolated from Patient 4268, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 167), the second underlined region is the CDR2alpha (SEQ ID NO: 168), the third underlined region is the CDR3alpha (SEQ ID NO: 169), the fourth underlined region is the CDR1beta (SEQ ID NO: 170), the fifth underlined region is the CDR2beta (SEQ ID NO: 171), and the sixth underlined region is the CDR3beta (SEQ ID NO: 172). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 173) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 174) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 175) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 176) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0227] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00048 TCRname:4268-TCR4 Recognitionofp53mutation:R248Q Method:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4268-F18 withp53-R248Qlongpeptide,sorted CD4+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:95.2% (observed40timesof42pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:581) MALLLVPAFQVIFTLGGTRAQSVTQLDSQVPVFEEAPVELRCNY SSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNK SQTSFHLRKPSVHISDTAEYFCAVRGSSGTYKYIFGTGTRLKVL ANIQNPEPAVYQLKDPRSQDSTLCLETDFDSQINVPKTMESGTF ITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSS DVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMT LRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHIRLLCRVAF CFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYR QDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILES ASTNQTSMYLCASKGDQNTEAFFGQGTRLTVVEDLRNVTPPKVS LFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGV CTDPQAYKESNYSYCLSSRLRVSATEWHNPRNHERCQVQFHGLS EEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATIL YEILLGKATLYAVLVSTLVVMAMVKRKNS
[0228] The statistics for TCR 4268-TCR4 of Patient 4268 are set forth in Table 28 below.
TABLE-US-00049 TABLE 28 Parameter # Frequency Total wells 96 100% CDR3alpha 43 44.8% CDR3beta 53 55.2% 4268-TCR4 pairs 40 41.7% Total paired TCRs 42 43.8%
[0229] The sequence of 4268-TCR5, which was isolated from Patient 4268, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 177), the second underlined region is the CDR2alpha (SEQ ID NO: 178), the third underlined region is the CDR3alpha (SEQ ID NO: 179), the fourth underlined region is the CDR1beta (SEQ ID NO: 180), the fifth underlined region is the CDR2beta (SEQ ID NO: 181), and the sixth underlined region is the CDR3beta (SEQ ID NO: 182). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 183) includes the sequence starting from the amino teiiuinus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 184) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 185) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 186) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0230] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00050 TCRname:4268-TCR5 Recognitionofp53mutation:R248Q Method:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4268-F19 withp53-mut-TMG,sortedCD4+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:11.8% (observed2timesof17pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:582) MAGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTS GFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYS YLLLKELQMKDSASYLCAVRDLQTGANNLFFGTGTRLTVIPNIQ NPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDK CVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC DATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLW SSRAKRSGSGATNFSLLKQAGDVEENPGPMHIRLLCRVAFCFLA VGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPG LGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTN QTSMYLCASSLTFGTTEAFFGQGTRLTVVEDLRNVTPPKVSLFE PSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTD PQAYKESNYSYCLSSRLRVSATEWHNPRNHERCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEI LLGKATLYAVLVSTLVVMAMVKRKNS
[0231] The statistics for TCR 4268-TCR5 of Patient 4268 are set forth in Table 29 below.
TABLE-US-00051 TABLE 29 Parameter # Frequency Total wells 96 100% CDR3alpha 2 2.1% CDR3beta 87 90.6% 4268-TCR5 pairs 2 2.1% Total paired TCRs 17 17.7%
Example 10
[0232] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4266 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening). This example also demonstrates the isolation of four anti-mutated p53 TCRs from patient 4266.
[0233] Experiments were carried out as described for
[0234] TIL fragments (F1-F24, n=24) from patient 4266 were co-cultured with autologous APCs electroporated with TMG composed of irrelevant, WT p53, or mutated p53 sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0235] TIL fragments (F1-F24, n=24) from patient 4266 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25-amino acid peptides composed of WT p53-R248 sequence or mutated p53-R248W sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0236] Cos7 cells (2.510.sup.4 per well) were plated on wells of flat-bottom 96 well plates. The following day, cells were co-transfected with individual HLA alleles from patient 4266. The next day cells were pulsed with no peptide, DMSO, WT p53-R248 peptide SSCMGGMNRR (SEQ ID NO: 590) or mutated p53-R248W peptide SSCMGGMNWR (SEQ ID NO: 591) for 2 hours at 37 C. at 1 pg/mL. TIL cultures from patient 4266 (10.sup.5) were added to wells and co-cultured overnight at 37 C. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells).fwdarw.CD4-CD8+. The results are shown in
[0237] T cells expressing mock (no TCR), 4266-TCR1, 4266-TCR2, 4266-TCR3 or 4266-TCR4 with putative specificity to p53-R248W identified from 4266-TIL were co-cultured with autologous APCs which were pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-R248 sequence or mutated p53-R248W sequence. Media alone and PMA and lonomycin were negative and positive controls, respectively. Co-cultures were performed overnight at 37 C. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells).fwdarw.CD4-CD8+. The results are shown in
[0238] A tumor cell (TC) line was established from a xenografted tumor fragment resected from Patient 4266 then serially passaged through immunocompromised mice (TC #4266). The TC #4266 was co-cultured with T cells (10.sup.5) expressing mock (no TCR) or p53-R248W-specific TCRs (4266-TCR2, 4266-TCR3 or 4266-TCR4) overnight at 37 C. The TC #4266 cells were either incubated with nothing, W6/32 pan-HLA Class-I specific blocking antibody, IVA12 pan-HLA Class-II specific blocking antibody or mutated p53-R248W peptide SSCMGGMNWR (SEQ ID NO: 591) for 2 hours at 37 C. The antibodies were kept in the co-culture at 5 g/mL final concentration. The peptide was incubated at 1 g/mL and excess peptide was washed after incubation. Media alone (no TC) and PMA and Ionomycin were negative and positive controls, respectively. Expression of 4-1BB was evaluated by flow cytometry after gating for lymphocytes.fwdarw.living cells (PI negative).fwdarw.CD3+ (T cells).fwdarw.CD4-CD8+. The results are shown in
[0239] The sequence of 4266-TCR1, which was isolated from Patient 4266, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 97), the second underlined region is the CDR2alpha (SEQ ID NO: 98), the third underlined region is the CDR3alpha (SEQ ID NO: 99), the fourth underlined region is the CDR1beta (SEQ ID NO: 100), the fifth underlined region is the CDR2beta (SEQ ID NO: 101), and the sixth underlined region is the CDR3beta (SEQ ID NO: 102). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 103) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 104) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 105) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 106) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0240] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00052 TCRname:4266-TCR1 Recognitionofp53mutation:R248W Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4266-F1, 4266-F3,4266-F5and4266-F6withp53mutTMGor R248Wlongpeptide(bothco-culturesdetected thesameTCR),sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:17.0% (observed9timesof53pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:583) MALLLVPAFQVIFTLGGTRAQSVTQLDSQVPVFEEAPVELRCNY SSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNK SQTSFHLRKPSVHISDTAEYFCAVSDLVRDDKIIFGKGTRLHIL PNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTF ITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSS DVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMT LRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHIGLLCCVAF SLLWASPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYR QDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLES AAPSQTSVYFCASIGGFEAFFGQGTRLTVVEDLRNVTPPKVSLF EPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCT DPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEE DKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYE ILLGKATLYAVLVSTLVVAJAHVKRKNS
[0241] The statistics for TCR 4266-TCR1 of Patient 4266 are set forth in Table 30 below.
TABLE-US-00053 TABLE 30 Parameter # Frequency Total wells 96 100% CDR3alpha 9 9.4% CDR3beta 10 10.4% 4266-TCR1 pairs 9 9.4% Total paired TCRs 53 55.2%
[0242] The sequence of 4266-TCR2, which was isolated from Patient 4266, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 107), the second underlined region is the CDR2alpha (SEQ ID NO: 108), the third underlined region is the CDR3alpha (SEQ ID NO: 109), the fourth underlined region is the CDR1beta (SEQ ID NO: 110), the fifth underlined region is the CDR2beta (SEQ ID NO: 111), and the sixth underlined region is the CDR3beta (SEQ ID NO: 112). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 113) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 114) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 115) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 116) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0243] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00054 TCRname:4266-TCR2 Recognitionofp53mutation:R248W Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture 4266-F1,4266-F3,4266-F5and4266-F6with p53mutTMGorR248Wlongpeptide (bothco-culturesdetectedthesameTCR), sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:24.5% (observed13timesof53pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:584) MAGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTS GFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYS YLLLKELQMKDSASYLCAVYTGGFKTIFGAGTRLFVKANIQNPE PAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVL DMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDAT LTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSSR AKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAALCLLGAEL TEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGP KLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDS AVYLCASNLGGGSTDTQYFGPGTRLTVLEDLRNVTPPKVSLFEP SKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDP QAYKESIVYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEI LLGKATLYAVLVSTLVVMAMVKRKNS
[0244] The statistics for TCR 4266-TCR2 of Patient 4266 are set forth in Table 31 below.
TABLE-US-00055 TABLE 31 Parameter # Frequency Total wells 96 100% CDR3alpha 21 21.9% CDR3beta 18 18.8% 4266-TCR2 pairs 13 13.5% Total paired TCRs 53 55.2%
[0245] The sequence of 4266-TCR3, which was isolated from Patient 4266, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 117), the second underlined region is the CDR2alpha (SEQ ID NO: 118), the third underlined region is the CDR3alpha (SEQ ID NO: 119), the fourth underlined region is the CDR1beta (SEQ ID NO: 120), the fifth underlined region is the CDR2beta (SEQ ID NO: 121), and the sixth underlined region is the CDR3beta (SEQ ID NO: 122). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 123) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 124) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 125) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 126) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0246] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00056 TCRname:4266-TCR3 Recognitionofp53mutation:R248W Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4266-F1, 4266-F3,4266-F5and4266-F6withp53mutTMGor R248Wlongpeptide(bothco-culturesdetected thesameTCR),sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:34.0% (observed18timesof53pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:585) MAGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTS GFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYS YLLLKELQMKDSASYLCAFYYGGSQGNLIFGKGTKLSVKPNIQN PEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKC VLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCD ATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWVVLGFLGT DHTGAGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQ GPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQE DSAVYLCASSFGSGSTDTQYFGPGTRLTVLEDLRNVTPPKVSLF EPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCT DPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEE DKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYE ILLGKATLYAVLVSTLVVMAMVKRKNS
[0247] The statistics for TCR 4266-TCR3 of Patient 4266 are set forth in Table 32 below.
TABLE-US-00057 TABLE 32 Parameter # Frequency Total wells 96 100% CDR3alpha 19 19.8% CDR3beta 26 27.1 4266-TCR3 pairs 18 18.8% Total paired TCRs 53 55.2%
[0248] The sequence of 4266-TCR4, which was isolated from Patient 4266, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 127), the second underlined region is the CDR2alpha (SEQ ID NO: 128), the third underlined region is the CDR3alpha (SEQ ID NO: 129), the fourth underlined region is the CDR1beta (SEQ ID NO: 130), the fifth underlined region is the CDR2beta (SEQ ID NO: 131), and the sixth underlined region is the CDR3beta (SEQ ID NO: 132). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 133) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 134) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 135) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 136) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0249] Cancer reactive T cells were identified using the screening method set forth below. The method used to isolate the TCR is set forth below.
TABLE-US-00058 TCRname:4266-TCR4 Recognitionofp53mutation:R248W Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4266-F1, 4266-F3,4266-F5and4266-F6withp53mutTMGor R248Wlongpeptide(bothco-culturesdetected thesameTCR),sortedCD8+41BB+Tcells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs: 9.4(observed5timesof53pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:586) MAGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTS GFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYS YLLLKELQMKDSASYLCAVYPGGSQGNLIFGKGTKLSVKPNIQN PEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKC VLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCD ATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGENLLMTLRLWS SRAKRSGSGATNFSLLKQAGDVEENPGPMHTRLLCWAALCLLGA ELTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQ GPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLE DSAVYLCASSLGTGSTDTQYFGPGTRLTVLEDLRNVTPPKVSLF EPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCT DPQAYKESNYSYCLSSRLRVSATEWHNPRNHERCQVQFHGLSEE DKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYE ILLGKATLYAVLVSTLVVMAMVKRKNS
[0250] The statistics for TCR 4266-TCR4 of Patient 4266 are set forth in Table 33 below.
TABLE-US-00059 TABLE 33 Parameter # Frequency Total wells 96 100% CDR3alpha 5 5.2% CDR3beta 13 13.5 4266-TCR3 pairs 5 5.2% Total paired TCRs 53 55.2%
Example 11
[0251] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4252 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening).
[0252] TIL fragments F1, F3, F7 and F19 patient 4252 were used as effectors. Co-cultures with T cell effectors and autologous APCs (immature DCs) were either (1) electroporated with TMGs composed of irrelevant, WT p53 or mutated p53 sequences or (2) pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-R175 sequence or mutated p53-R175H sequence. T cells only (no target) was negative control and PMA and lono was positive control. Co-cultures were performed overnight at 37 C. Expression of 4-1BB on CD3+CD8-CD4+ T cells was evaluated by flow cytometry. The results are shown in
Example 12
[0253] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4270 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening).
[0254] TIL fragments F13 and F16 patient 4270 were used as effectors. Co-cultures with T cell effectors and autologous APCs (immature DCs) were either (1) electroporated with TMGs composed of irrelevant, WT p53 or mutated p53 sequences or (2) pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-R282 sequence or mutated p53-R282W sequence. T cells only was negative control and PMA and Iono was positive control. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
Example 13
[0255] This example demonstrates the identification of anti-mutated p53 T cells in Patient 4285 by co-culturing autologous APCs induced to express mutated p53 within autologous T cells (p53 hotspot mutation universal screening).
[0256] TIL fragments (F1-F22 and F24, n=18) from patient 4285 were co-cultured with autologous APCs electroporated with TMGs composed of irrelevant, WT p53 or mutated p53 sequences. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0257] TIL fragments (F1-F22 and F24, n=18) from patient 4285 were co-cultured with autologous APCs pulsed with peptide vehicle (DMSO) or purified (>95% by HPLC) 25 amino acid peptides composed of WT p53-R175 sequence or mutated p53-R175H sequence. Co-cultures were performed overnight at 37 C. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in
[0258] Autologous APCs were pulsed with 15-amino acid peptides from the p53-R175H sequence (amino acid substitution underlined in Table 34) overlapping 14 amino acids. TIL from patient 4285 (fragment cultures 10, 6 and 9) with specificity to p53-R175H were co-cultured overnight at 37 C. with peptide-pulsed APCs. DMSO was peptide vehicle. Secretion of IFN- was evaluated using ELISPOT assay. The results are shown in Table 34.
TABLE-US-00060 TABLE34 ELISPOTResult Positive(+)or negative(-)for IFN-production Peptide SEQIDNO: 4285-F10 4285-F6 4285-F9 None(vehicle) Not - - - applicable YKQSQHMTEVVRHCP 519 - - - KQSQHMTEVVRHCPH 520 - - + QSQHMTEVVRHCPHH 521 - + + SQHMTEVVRHCPHHE 522 + + + QHMTEVVRHCPHHER 523 + + + HMTEVVRHCPHHERC 524 + + + MTEVVRHCPHHERCS 525 + + + TEVVRHCPHHERCSD 526 + + + EVVRHCPHHERCSDS 527 + + + VVRHCPHHERCSDSD 528 + + - VRHCPHHERCSDSDG 529 + + -
[0259] Cos7 cells (2.510.sup.4 per well) were plated on wells of flat-bottom 96 well plates. The following day, cells were co-transfected with individual HLA alleles from patient 4285. The next day cells were pulsed with DMSO or mutated p53-R175H peptide YKQSQHMTEVVRHCPHHERCSDSDG (SEQ ID NO: 2) for 2 hours at 37 C. at 10 g/mL. Selected TIL fragment cultures with specificity to p53-R175H from Patient 4285 (4285-F6, 4285-F9 and 4285-F10) were co-cultured with transfected Cos7 cells overnight at 37 C. Expression of 4-1BB was assayed by flow cytometry after gating lymphocytes.fwdarw.live.fwdarw.CD3+ (T cells).fwdarw.CD8-CD4+. The results are shown in
[0260] Autologous APCs were pulsed with decreasing concentrations of 25- or 15-amino acid peptides corresponding to the WT or mutated p53-R175H sequence for 2 hours at 37 C. T cells transposed with 4285-TCR1 from patient 4285 were co-cultured overnight at 37 C. with peptide-pulsed APCs. Expression of 4-1BB was assayed by flow cytometry after gating lymphocytes.fwdarw.live.fwdarw.CD3+ (T cells).fwdarw.CD8-CD4+. The results are shown in
[0261] The sequence of 4285-TCR1, which was isolated from Patient 4285, is set forth below. Starting from the amino terminus, the first underlined region is the CDR1alpha (SEQ ID NO: 487), the second underlined region is the CDR2alpha (SEQ ID NO: 488), the third underlined region is the CDR3alpha (SEQ ID NO: 489), the fourth underlined region is the CDR1beta (SEQ ID NO: 490), the fifth underlined region is the CDR2beta (SEQ ID NO: 491), and the sixth underlined region is the CDR3beta (SEQ ID NO: 492). The bold region is the linker (SEQ ID NO: 26). Starting from the amino terminus, the first italicized region is the alpha chain constant region (SEQ ID NO: 23) and the second italicized region is the beta chain constant region (SEQ ID NO: 25). The alpha chain variable region (SEQ ID NO: 493) includes the sequence starting from the amino terminus and ending immediately prior to the start of the alpha chain constant region. The beta chain variable region (SEQ ID NO: 494) includes the sequence starting immediately after the linker and ending immediately prior to the start of the beta chain constant region. The full-length alpha chain (SEQ ID NO: 495) includes the sequence starting from the amino terminus and ending immediately prior to the start of the linker. The full-length beta chain (SEQ ID NO: 496) includes the sequence starting immediately after the linker and ending with the carboxyl terminus.
[0262] Cancer reactive T cells were identified as described below. The TCR was isolated as described below.
TABLE-US-00061 TCRname:4285-TCR1 Recognitionofp53mutation:R175H Screeningmethod:p53hotspotmutation universalscreening Co-culturetoidentifyTCR:Co-culture4285-F6 withp53-R175HpeptideandsortedCD4+41BB+T cells MethodtoidentifyTCR:single-cellRT-PCR AbundanceofTCRamongstallpairedTCRs:81.8% (observed36timesof44pairs) TCRorientation:alpha-beta Expressionvector:SBtransposon (SEQIDNO:589) MAKNPLAAPLLILWFHLDCVSSILNVEQSPQSLHVQEGDSTNFT CSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATL NTKEGYSYLYIKGSQPEDSATYLCALITGGGNKLTFGTGTQLKV ELNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGT FITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPS SDVPCDATLTEKSFETDMNLNFQNLLVIVLRILLLKVAGFNLLM TLRLWSSRAKRSGSGATNFSLLKQAGDVEENPGPMHLGLLCCGA FSLLWAGPVNAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWY RQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLE SAAPSQTSVYFCASRLQGWNSPLHFGNGTRLTVTEDLRNVTPPK VSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHS GVCTDPQAYKESNYSYCLSSRLRVSATFWHNPRNIIFRCQVQFH GLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSA TILYEILLGKATLYAVLVSTLVVMAMVKRKNS
[0263] The statistics for 4285-TCR1 from patient 4285 are set forth in Table 35.
TABLE-US-00062 TABLE 35 Parameter # Frequency Total wells 96 100% CDR3alpha 37 39.8% CDR3beta 39 40.6% 4285-TCR1 pairs 36 37.5% Total paired TCRs 44 45.8%
Example 14
[0264] This example demonstrates a summary of responses to p53 hotspot mutations by T cells.
[0265] A summary of responses to p53 hotspot mutations by T cells is provided in Table 36. Numbers 1-15 of Table 36 were a retrospective study. Numbers 16-33 of Table 36 were a prospective study.
TABLE-US-00063 TABLE 36 p53 T cell # Tumor type Patient mut screen HLA 1 Gastric 3446 G245S n/a n/a 2 Gastroesophageal 3788 Y220C N n/a 3 Rectal 3942 R273C n/a n/a 4 Colon 4023 R282W Y Class-II 5 Colon 4095 R282W n/a n/a 6 Ovarian 4127 G245S Y DRB3*02:02 7 Breast 4130 R273H Y Class-II 8 Colon 4141 R175H Y A*02:01 9 Ovarian 4149 Y220C Y DRB3*02:02 10 Colon 4160 R273H N n/a 11 Melanoma 4165 G245D N n/a 12 Colon 4166 R248W n/a n/a 13 Rectal 4171 R248Q N n/a 14 Melanoma 4187 R273H N n/a 15 Colon 4196 R175H Y A*02:01 16 Colon 4213 R248Q Y both 17 Colon 4217 R175H N n/a 18 Cholangiocarcinoma 4220 R248Q N n/a 19 Rectal 4235 R273C N n/a 20 Colon 4238 R248Q Y Class-I 21 Colon 4244 R282W N n/a 22 Colon 4245 R248Q N n/a 23 Colon 4252 R175H N n/a 24 Melanoma 4253 R248W Y unknown 25 Colon 4254 R273H N n/a 26 Colon 4257 R248W N n/a 27 Endometrial 4258 R273H N n/a 28 Colon 4259 Y220C Y A*02:01, DRB1*04 29 Colon 4266 R248W Y A*68:01 30 Colon 4268 R248Q Y both 31 Pancreatic 4270 R282W Y unknown 32 Rectal 4273 R248W Y DPB1*02:01 33 Rectal 4274 R175H n/a 34 Colon 4283 R175H N n/a 35 Colon 4285 R175H Y DRB1*13:01 36 Colon 4287 R248W N n/a 37 Colon 4312 R175H N n/a n/a = not applicable; N = negative; Y = confirmed reactive; TBS = to be screened.
Example 15
[0266] This example demonstrates the treatment of patients with p53 mutation-reactive TIL.
[0267] A summary of the treatment of patients with p53 mutation-reactive TIL is provided in Table 37.
TABLE-US-00064 TABLE 37 Total % of # of p53 Infusion # of p53 reactive Tumor p53 bag Cells reactive TIL Re- Duration # Type Patient mut screening (10.sup.9) TIL (10.sup.9) sponse (months) 1 Ovarian 4127 G245S Y 143 2.8 4.0 P.R. 4 2 Colon 4141 R175H Y 69 0.8 0.6 N.R. 3 Colon 4196 R175H Y 92 3.3 3.0 N.R. 4 Ovarian 4149 Y220C Y 37 11.1 4.1 N.R. 5 Colon 4213 R2480 TBS 33 P.R. 4 6 Colon 4238 R2480 TBS 57 N.R. 7 Colon 4266 R248W Y 104 50.8 52.8 8 Colon 4268 R248Q **TBS 9 Rectal 4273 R248W **Y 117 6.8 8.0 N.R. 10 Colon 4285 R175H Y 69.6 2.4 1.7 N.R. NT = not treated TBS = to be screened; N.R. = no response; P.R. = partial response; **patient not yet treated.
Example 16
[0268] This example demonstrates the overall frequencies of each missense p53 mutation in all of the tumors sequenced.
[0269] Samples were acquired as follows: Tumor and PBL were collected from 141 cancer patients. TIL were grown from tumors. Tumor samples underwent exome and transcriptome sequencing. Tp53 mutations were identified. Out of 150 tumors, 30% expressed WT p53, and 70% expressed mutated p53. Out of 122 tumor samples which expressed mutated p53, 73% expressed a missense mutation, 13% expressed a stop-gain mutation, 11% expressed a frameshift mutation, and 3% expressed an indel mutation.
[0270] The overall frequencies of each missense p53 mutation in all of the tumors sequenced are shown in
Example 17
[0271] This example demonstrates a summary of the reactivity of TCRs of Examples 1-15.
[0272] The TCRs of Table 38 were isolated, expressed in T cells and tested against the relevant antigen. A summary of the results is shown in Table 38.
TABLE-US-00065 TABLE 38 p53 a.a. TCR p53 mutation TCR name substitution tested? reactive? 4127-TP53-G245S-TCR1 G245S yes yes 4149TCRa2b2 Y220C yes yes 4266-TCR1 R248W yes no 4266-TCR2 R248W yes yes 4266-TCR3 R248W yes yes 4266-TCR4 R248W yes yes 4268-TCR1 R248Q yes no 4268-TCR2 R248Q yes no 4268-TCR3 R248Q yes no 4268-TCR4 R248Q yes no 4268-TCR5 R248Q yes no 4273-TP53-R248W- R248W yes no TCR1a1 4273-TP53-R248W- R248W yes Yes TCR1a2 4141-TCR1a2 R175H yes yes 4285-TCR1 R175H yes yes 4259-F6-TCR Y220C yes yes 4127-O37-TCR G245S yes yes
[0273] All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein.
[0274] The use of the terms a and an and the and at least one and similar referents in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The use of the term at least one followed by a list of one or more items (for example, at least one of A and B) is to be construed to mean one item selected from the listed items (A or B) or any combination of two or more of the listed items (A and B), unless otherwise indicated herein or clearly contradicted by context. The terms comprising, having, including, and containing are to be construed as open-ended terms (i.e., meaning including, but not limited to,) unless otherwise noted. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.
[0275] Preferred embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.