VITRO POTENCY ASSAY FOR PROTEIN-BASED MENINGOCOCCAL VACCINES
20200319184 ยท 2020-10-08
Assignee
Inventors
Cpc classification
G01N33/577
PHYSICS
C07K2317/33
CHEMISTRY; METALLURGY
International classification
G01N33/577
PHYSICS
Abstract
The invention uses Elisa or similar assays for analysing a meningococcal vaccine. The assay uses antibodies which bind to meningococcal proteins within the vaccine, and in particular monoclonal antibodies which are bactericidal for meningococcus and/or which recognise conformational epitopes within the meningococcal proteins. By performing the assay on a series of dilutions of a test vaccine, and by comparing the results with those obtained using a reference vaccine of known potency, it is possible to determine the relative potency of the test vaccine. This value can be used as a parameter for determining whether a manufactured batch of a vaccine is suitable for release to the public, or whether it has experienced a production failure and so should not be used.
Claims
1-18. (canceled)
19. A monoclonal antibody selected from the group consisting of: (a) a monoclonal antibody comprising variable regions comprising the amino acid sequences of SEQ ID NO: 21 and SEQ ID NO: 22; (b) a monoclonal. antibody comprising variable regions comprising the amino acid sequences of SEQ ID NO: 23 and SEQ ID NO: 24; (c) a monoclonal antibody comprising variable regions comprising the amino acid sequences of SEQ ID NO: 25 and. SEQ ID NO: 26; (d) a monoclonal antibody comprising variable regions comprising the amino acid sequences of SEQ ID NO: 27 and SEQ ID NO:28.
20. The monoclonal antibody of claim 19, in contact with a batch of vaccine, a bulk of vaccine, or a sample from a batch of vaccine or from a bulk vaccine; comprising one or more meningococcal protein immunogen.
21. The monoclonal antibody of claim 20, wherein the one or more meningococcal protein immunogen is meningococcal NHBA, meningococcal factor H binding protein (fHbp), and/or meningococcal NadA.
22. The monoclonal antibody of claim 21, wherein the meningococcal protein immunogen is meningococcal fHbp.
23. The monoclonal antibody of claim 21, wherein the meningococcal protein immunogen is meningococcal NHBA, meningococcal fHbp, and meningococcal NadA.
24. The monoclonal antibody of claim 20, wherein at least one of the one or more meningococcal protein immunogens is adsorbed to an aluminium salt adjuvant.
25. The monoclonal antibody of claim 20, wherein the sample, batch of vaccine, or bulk vaccine further comprises a meningococcal vesicle.
26. The monoclonal antibody of claim 19, in contact with a secondary antibody labelled with an enzyme.
27. The monoclonal antibody of claim 20, further in contact with a secondary antibody labelled with an enzyme.
28. The monoclonal antibody of claim 19, wherein the monoclonal antibody is a murine monoclonal IgG antibody.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0146]
[0147]
[0148]
[0149]
[0150]
MODES FOR CARRYING OUT THE INVENTION
[0151] The BEXSERO product is described in reference 7, and it includes 50 g of each of NadA (subvariant 3.1; SEQ ID NO: 6), fHbp subvariant 1.1 (as a GNA2091-fHbp fusion protein; SEQ ID NO: 5), and NHBA subvariant 1.2 (as a NHBA-GNA1030 fusion protein; SEQ ID NO: 4), adsorbed onto 1.5 mg aluminium hydroxide, and with 25 g OMVs from N.meningitidis strain NZ98/254.
[0152] The following monoclonal antibodies are available: [0153] (A) 42A4A2 (murine IgG1 against NHBA) [0154] (B) MAb502 (murine IgG2a against fHbp) [0155] (C) 12C1/D7 (murine IgG2b against fHbp) [0156] (D) 11F10/G6 (murine IgG2b against fHbp) [0157] (E) 9F11/19 antibody (murine IgG2b against NadA) [0158] (F) Anti-PorA(P1.4), available from NIBSC.
[0159] These antibodies are bactericidal, except for 42A4A2 (which is non-bactericidal but seems to recognise a conformational epitope).
[0160] The BEXSERO product is serially diluted 9 times, either 1:2 or 1:5 each time. Six of these dilution series are present in rows (A) to (F) of a first microtitre plate (plate 1), from columns 1 (strongest) to 10 (most dilute). Each row receives one of the six monoclonal antibodies (A) to (F) described above. each used at the same strength in each column. After incubation the contents of these 60 wells are transferred into 60 wells in a second plate (plate 2). The wells in rows (A) to (F) in plate 2 are coated with the individual recombinant proteins (A) NHBA (B-D) fHbp (E) NadA and (F) PorA. In other embodiments, all wells in a single ELISA plate are coated using the same antigen, and each antigen is tested separately by using a different ELISA microtiter plate.
[0161] The mixture is incubated for 2 hours at 37 C. (for fHbp) or at room temperature (for NHBA, NadA and PorA), then washed. Monoclonal antibodies which were unbound to the vaccine antigens are retained on the plates. Anti-mouse IgG, conjugated to alkaline phosphatase, is then added to all 60 wells with pNPP and the amount of retained monoclonal antibody is assessed by OD.sub.405-620nm. Thus the vaccine immunogen (serially diluted) inhibits the binding of the monoclonal antibodies to the immobilised antigens in plate 2. Higher levels of epitope in the vaccine sample will lead to more inhibition of this binding, and thus to less detectable signal after adding the pNPP.
[0162]
TABLE-US-00001 A B C D E F R.P. 0.915 2.344 0.859 0.895 1.037 1.033
[0163] The aberrant value in
[0164] To check for inter-assay consistency the anti-PorA measurement was checked for two further BEXSERO batches (
[0165] The ability of this assay to identify damaged vaccine was tested by artificially exposing a BEXSERO product to thermal stress. Relative potency values for each of the four immunogen components after 2 hours at 80 C. were as follows:
TABLE-US-00002 NHBA fHbp NadA OMV R.P. 0.25 0.08 0.01 0.55
[0166]
[0167] To confirm that the aluminium hydroxide adjuvant did not interfere with the assay, antibodies (A), (B), (E) and (F) were tested with standard vaccine or with adjuvant. As shown in
[0168] Anti-fHbp Monoclonal Antibodies
[0169] Four bactericidal murine anti-fHbp IgG2b subclass monoclonal antibodies were obtained: 12C1/D7; 11F10/G6; 30G11/H3; and 14B3/D4, RNA was isolated from the murine hybridoma cells using an Oligotex Direct mRNA Mini Kit according to the manufacturer's instructions. cDNA was produced via reverse transcription using 200 ng of the poly(A)+RNA template, an oligo-(dT) primer, and Super script II RT. cDNA was amplified by PCR using immunoglobulin heavy (H)- and light (L)-chain degenerate primers as described in reference 86. The purified products were inserted into the pSTBlue-1 Perfectly Blunt vector for sequencing.
[0170] 12C1/D7's V.sub.L region has amino acid sequence SEQ ID NO: 21:
TABLE-US-00003 DIVLTQSPSSIYASLGERVTLTCKASQDIHNYLNWFQQKPGKSPKTLIYR ANRLVDGVPSRFSGGGSGQDYSLTISSLEEFEDIGIYYCLQYDEFPPTFG GGTRLEIKRADAAPTVS
and its V.sub.H region has amino acid sequence SEQ ID NO: 22:
TABLE-US-00004 QVQLQESPGELVKPGASVKISCKASGYSFSDYNMSWVKQSNGKSLEWIGI IDPKYGTINYNQKFKGKATLTVDQASSTAYMQLNSLTSEDSAVYYCVRDY YGSSYFDYWGQGTTLTVS
[0171] 11F10/G6's V.sub.L region has amino acid sequence SEQ ID NO: 23:
TABLE-US-00005 DIVLTQTPSSIYASLGERVTLTCKASQDIHNYLNWFQQKPGKSPKTLIYR ANRLVDGVPSRFSGGGSGQDYSLTISSLEFEDIGIYYCLQYDEFPPTFGG GTRLEIKRADAAPTVS
and its V.sub.H region has amino acid sequence SEQ ID NO: 24:
TABLE-US-00006 EFQLQQSGPELVKPGASVKISCKASGYSFSDYNMSWVKQSNGKSLEWIGI IDPKYGTINYNQKFKGKATLTVDQASSTAYMQLNSLTSEDSAVYYCVRDY YGSSYFDYWGQGTTLTVS
[0172] 30G11/H3's V.sub.L region has amino acid sequence SEQ ID NO: 25:
TABLE-US-00007 DIVMTQSQKFMSTSVGDRVSITCKASQHVRTAVAWYQQKPGQSPKGLIYL ASNRRTGVPDRFTASGSGTDFTLTITNVQSEDLADYFCLQHWNYPFTFGS GTKLEIKRADAAPTVS
and its V.sub.H region has amino acid sequence SEQ ID NO: 26:
TABLE-US-00008 EVQLEESGPELVKPGASVKISCKASGYSFSDYNMSWVKQSNGKSLEWIGI IDPKYGTINYNQKFKGKATLTVDQASSTAYMQLNSLTSEDSAVYYCVRDY YGSSYFDYWGTTLTVS
[0173] 14B3/D4's V.sub.L region has amino acid sequence SEQ ID NO: 27:
TABLE-US-00009 DIVLTQSPSSLTVTAGEKVTMSCRSSQSLLNSGNQKNYLTWYQQKPGQPP KLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVOAEDLAIYYCONDYNY PLTFGAGTKLELKR
and its V.sub.H region has amino acid sequence SEQ ID NO: 28:
TABLE-US-00010 QVQLQQPGAELVKPGASVKLSCKASGYSFTTYYWMNWVKQRPGQGLEWIG MIHPNSGSTNYNEKFKNKATLTVDKSSSTAYIQLSSLTSEDSAVFYCAAH YNKYEGYFYAMDYWGQTSVTVSS
[0174] In a FACS assay the 11F10/G6 and 30G11/H3 were able to bind to meningococcal strains having each of the three different fHbp variants: MC58 (variant 1); 961-5945 (variant 2); and M1239 (variant 3). Moreover, these two FACS-positive antibodies also showed bactericidal activity against strains having each of the three variants.
[0175] 14B3/D4 was FACS-positive and bactericidal against MC58 and 961-5945, but not against M1239.
[0176] 12C1/D7 was FACS-positive and bactericidal against MC58, but not against 961-5945 or M1239.
[0177] 12C1/D7 and 11F10/G6 competed with fH for binding to fHbp; the other two antibodies did not.
[0178] The epitope for 11F10/G6 seems to include residue Lys-268 in fHbp (var 1.1).
[0179] The epitope for 12C1/D7 seems to include residue Val-270 in fHbp (var 1.1).
[0180] The epitope for 14B3/D4 seems to include residues 60-90 in fHbp.
[0181] The epitope for 30H11/H3 seems to include residue Lys -257 in fHbp (var 1.1).
[0182] It will be understood that the invention is described above by way of example only and modifications may be made whilst remaining within the scope and spirit of the invention.
REFERENCES
[0183] [1] Metz et al. (2002) Vaccine 20:2411-30.
[0184] [2] Donnelly et al. (2010) PNAS USA 107:19490-5.
[0185] [3] US-2010/0035234.
[0186] [4] U.S. Pat. No. 7,510,687.
[0187] [5] WO2007/066231.
[0188] [6] Poulsen & Jensen (2007) J Biomol Screen 12:240-7.
[0189] [7] Bai et al. (2011) Expert Opin Biol Ther. 11:969-85.
[0190] [8] Giuliani et al. (2006) PNAS USA 103:10834-9.
[0191] [9] Marsh et al. (2011) Vaccine 29:6049-58.
[0192] [10] WO02/09643.
[0193] [11] Katial et al. (2002) Infect. Immun. 70:702-707.
[0194] [12] U.S. Pat. No. 6,180,111.
[0195] [13] WO01/34642.
[0196] [14] WO2006/046143.
[0197] [15] WO2004/019977.
[0198] [16] European patent 0011243.
[0199] [17] Fredriksen et al. (1991) NIPH Ann. 14(2):67-80.
[0200] [18] WO01/91788.
[0201] [19] WO2005/004908.
[0202] [20] WO2011/036562.
[0203] [21] Claassen et al. (1996) Vaccine 14:1001-8.
[0204] [22] de Kleijn et al. (2000) Vaccine 18:1456-66.
[0205] [23] WO03/105890.
[0206] [24] WO2006/024946
[0207] [25] Tettelin et al. (2000) Science 287:1809-1815.
[0208] [26] Gennaro (2000) Remington: The Science and Practice of Pharmacy. 20th edition, ISBN: 0683306472.
[0209] [27] Vaccine Design . . . (1995) eds. Powell & Newman. ISBN: 030644867X. Plenum.
[0210] [28] Borrow et al. (2006) Vaccine. 24:5093-107.
[0211] [29] Rodriguez et al. (2002) Clin Vaccine Immunol 9:109-14.
[0212] [30] Borrow & Carlone (2001) Methods in Molecular Medicine 66:289-304.
[0213] [31] Martin et al. (2005) Vaccine 23:2218-21.
[0214] [32] Borrow et al. (2005) Clin Diag Lab Immunol 12:970-6.
[0215] [33] WO2009/150531.
[0216] [34] Scarselli et al. (2009) J Mol Biol 386:97-108.
[0217] [35] Welsch et al. (2004) J Immunol 172:5606-15.
[0218] [36] Beernink et al. (2009) Molecular Immunology 46:1647-53.
[0219] [37] Giuntini et al. (2011) Infect. Immun. 79:3751-9.
[0220] [38] Methods In Enzymology (S. Colowick and N. Kaplan, eds., Academic Press, Inc.)
[0221] [39] Handbook of Experimental Immunology, Vols. I-IV (D. M. Weir and C. C. Blackwell, eds, 1986. Blackwell Scientific Publications)
[0222] [40] Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual, 3rd edition (Cold Spring Harbor Laboratory Press).
[0223] [41] Handbook of Surface and Colloidal Chemistry (Birdi, K. S. ed., CRC Press, 1997)
[0224] [42] Ausubel et al. (eds) (2002) Short protocols in molecular biology, 5th edition (Current Protocols).
[0225] [43] Molecular Biology Techniques: An Intensive Laboratory Course, (Ream et al., eds., 1998, Academic Press)
[0226] [44] PCR (Introduction to Biotechniques Series), 2nd ed. (Newton & Graham eds., 1997, Springer Verlag)
[0227] [45] Geysen et al. (1984) PNAS USA 81:3998-4002.
[0228] [46] Carter (1994) Methods Mol Biol 36:207-23.
[0229] [47] Jameson, B A et al. 1988, CABIOS 4(1):181-186.
[0230] [48] Raddrizzani & Hammer (2000) Brief Bioinform 1(2):179-89.
[0231] [49] Bublil et al. (2007) Proteins 68(1):294-304.
[0232] [50] De Lalla et al. (1999) J. Immunol. 163:1725-29.
[0233] [51] Kwok et al, (2001) Trends Immunol 22:583-88,
[0234] [52] Brusic et al. (1998) Bioinformatics 14(2):121-30
[0235] [53] Meister et al. (1995) Vaccine 13(6):581-91.
[0236] [54] Roberts et al. (1996) AIDS Res Hum Retroviruses 12(7):593-610.
[0237] [55] Maksyutov & Zagrebelnaya (1993) Comput Appl Biosci 9(3):291-7.
[0238] [56] Feller & de la Cruz (1991) Nature 349(6311):720-1,
[0239] [57] Hopp (1993) Peptide Research 6:183-190.
[0240] [58] Welling et al. (1985) FEBS Lett. 188:215-218.
[0241] [59] Davenport et al. (1995) Immunogenetics 42:392-297.
[0242] [60] Tsurui & Takahashi (2007) J Pharmacol Sci. 105(4):299-316.
[0243] [61] Tong et al. (2007) Brief Bioinform. 8(2):96-108.
[0244] [62] Schirle et al. (2001) J Immunol Methods. 257(1-2):1-16.
[0245] [63] Chen et al. (2007) Amino Acids 33(3):423-8.
[0246] [64] Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987) Supplement 30
[0247] [65] Smith & Waterman (1981) Adv. Appl. Math. 2: 482-489.
[0248] [66] WO00/66741.
[0249] [67] WO99/57280
[0250] [68] Serrata et al. (2010) PNAS USA 107:3770-5.
[0251] [69] U.S. Pat. No. 5,698,438.
[0252] [70] WO2010/070453.
[0253] [71] Perkins-Balding et al. (2003) Microbiology 149:3423-35.
[0254] [72] Masignani et al. (2003) J Exp Med 197:789-799.
[0255] [73] Welsch et al. (2004) J Immunol 172:5605-15.
[0256] [74] Hou et al. (2005) J infect Dis 192(4):580-90.
[0257] [75] WO03/063766.
[0258] [76] Fletcher et al. (2004) Infect Immun 72:2088-2100.
[0259] [77] Zhu et al. (2005) Infect Immun 73(10):6838-45.
[0260] [78] Cantini et al. (2006) J. Biol. Chem. 281:7220-7227
[0261] [79] WO2004/048404
[0262] [80] WO2009/104097.
[0263] [81] Martin et al. (1997) J Exp Med 185(7):1173-83.
[0264] [82] WO96/29412.
[0265] [83] WO01/55182.
[0266] [84] WO01/38350.
[0267] [85] WO00/23595.
[0268] [86] Wang et al. (2000) J. Immunol. Meth. 233:167-77.