Sting agonist compounds
10793557 ยท 2020-10-06
Assignee
Inventors
- Michael D. Altman (Needham, MA)
- Brandon D. Cash (Stoughton, MA, US)
- Matthew Lloyd Childers (Medfield, MA, US)
- Jared N. Cumming (Winchester, MA)
- Duane E. DeMong (Hanover, MA, US)
- Andrew Marc Haidle (Somerville, MA, US)
- Timothy J. Henderson (Natick, MA)
- James P. Jewell (Newton, MA, US)
- Matthew A. Larsen (Dedham, MA, US)
- Jongwon Lim (Lexington, MA)
- Min Lu (Brookline, MA, US)
- Ryan D. Otte (Natick, MA)
- Benjamin Wesley Trotter (Medfield, MA, US)
Cpc classification
C07D409/12
CHEMISTRY; METALLURGY
C07D417/12
CHEMISTRY; METALLURGY
C07D277/64
CHEMISTRY; METALLURGY
C07D417/10
CHEMISTRY; METALLURGY
International classification
C07D409/12
CHEMISTRY; METALLURGY
C07D417/10
CHEMISTRY; METALLURGY
C07D277/64
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
Compounds of general formula (I), of general formula (II), of general formula (III), of general formula (IV), of general formula (V), of general formula (VI), and their pharmaceutically acceptable salts, wherein all variables are defined herein, that may be useful as inductors of type I interferon production, specifically as STING active agents, are provided. Also provided are compositions comprising such compounds, processes for the synthesis of such compounds, and to uses of such compounds, including administration of such compounds to induce immune response, to induce STING-dependent type I interferon production, and/or to treat a cell proliferation disorder, such as cancer. ##STR00001##
Claims
1. A compound according to general formula (I): ##STR00629## or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6, ##STR00630## SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
2. The compound according to claim 1, or a pharmaceutically acceptable salt thereof, wherein each ##STR00631## is independently selected from the group consisting of ##STR00632##
3. A compound of general formula (II): ##STR00633## or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6, ##STR00634## SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
4. The compound according to claim 3, or a pharmaceutically acceptable salt thereof, wherein each ##STR00635## is independently selected from the group consisting of ##STR00636##
5. A compound of general formula (III): ##STR00637## or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.3 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring G, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring G is from an atom on said ring G with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.4 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6, ##STR00638## SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
6. The compound according to claim 5, or a pharmaceutically acceptable salt thereof, wherein ##STR00639## is independently selected from the group consisting of ##STR00640## is selected from the group consisting of ##STR00641##
7. A compound of general formula (IV): ##STR00642## or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6, ##STR00643## SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
8. The compound according to claim 7, or a pharmaceutically acceptable salt thereof, wherein ##STR00644## is independently selected from the group consisting of ##STR00645## is selected from the group consisting of ##STR00646##
9. A compound of general formula (V): ##STR00647## or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6, ##STR00648## SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
10. The compound according to claim 9, or a pharmaceutically acceptable salt thereof, wherein each ##STR00649## is independently selected from the group consisting of ##STR00650##
11. A compound of general formula (VI): ##STR00651## or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6, ##STR00652## SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
12. The compound according to claim 11, or a pharmaceutically acceptable salt thereof, wherein each ##STR00653## is independently selected from the group consisting of ##STR00654##
13. A compound selected from the group consisting of ##STR00655## ##STR00656## ##STR00657## ##STR00658## ##STR00659## ##STR00660## ##STR00661## ##STR00662## ##STR00663## ##STR00664## ##STR00665## ##STR00666## ##STR00667## ##STR00668## ##STR00669## ##STR00670## ##STR00671## ##STR00672## ##STR00673## ##STR00674## ##STR00675## ##STR00676## ##STR00677## ##STR00678## ##STR00679## ##STR00680## ##STR00681## ##STR00682## ##STR00683## ##STR00684## ##STR00685## ##STR00686## ##STR00687## ##STR00688## ##STR00689## ##STR00690## ##STR00691## ##STR00692## ##STR00693## ##STR00694## ##STR00695## ##STR00696## ##STR00697## ##STR00698## ##STR00699## ##STR00700## ##STR00701## ##STR00702## ##STR00703## ##STR00704## ##STR00705## ##STR00706## or a pharmaceutically acceptable salt thereof.
14. A compound selected from the group consisting of ##STR00707## or a pharmaceutically acceptable salt thereof.
15. The compound according to claim 14, wherein the compound is a ##STR00708##
16. A compound selected from the group consisting of ##STR00709## or a pharmaceutically acceptable salt thereof.
17. The compound according to claim 16, wherein the compound is ##STR00710##
18. A compound selected from the group consisting of ##STR00711## or a pharmaceutically acceptable salt thereof.
19. The compound according to claim 18, wherein the compound is ##STR00712##
20. A compound selected from the group consisting of ##STR00713## or a pharmaceutically acceptable salt thereof.
21. The compound according to claim 20, wherein the compound is ##STR00714##
22. A compound selected from the group consisting of ##STR00715## or a pharmaceutically acceptable salt thereof.
23. The compound according to claim 22, wherein the compound is ##STR00716##
24. A compound selected from the group consisting of ##STR00717## or a pharmaceutically acceptable salt thereof.
25. The compound according to claim 24, wherein the compound is ##STR00718##
26. A pharmaceutical composition comprising a compound according to claim 1, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
27. A pharmaceutical composition comprising a compound according to claim 13, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
28. A method of inducing an immune response in a subject, said method comprising: (a) administering a therapeutically effective amount of a compound according to claim 1, or a pharmaceutically acceptable salt thereof, to the subject.
29. A method of inducing an immune response in a subject, said method comprising: (a) administering a therapeutically effective amount of a pharmaceutical composition according to claim 26 to the subject.
30. A method of inducing STING-dependent type I interferon production in a subject, said method comprising administering a therapeutically effective amount of a compound according to claim 1, or a pharmaceutically acceptable salt thereof, to the subject.
31. A method of inducing STING-dependent type I interferon production in a subject, said method comprising administering a therapeutically effective amount of a pharmaceutical composition according to claim 26 to the subject.
32. A method of treating a cell proliferation disorder in a subject, said method comprising administering a therapeutically effective amount of a compound according to claim 1, or a pharmaceutically acceptable salt thereof, to the subject.
33. The method of claim 32, wherein the cell proliferation disorder is cancer.
34. A method of treating a cell proliferation disorder in a subject, said method comprising administering a therapeutically effective amount of a pharmaceutical composition according to claim 26 to the subject.
35. The method of claim 34, wherein the cell proliferation disorder is cancer.
36. A method of inducing an immune response in a subject, said method comprising: (a) administering a therapeutically effective amount of a compound according to claim 13, or a pharmaceutically acceptable salt thereof, to the subject.
37. A method of inducing an immune response in a subject, said method comprising: (a) administering a therapeutically effective amount of a pharmaceutical composition according to claim 27 to the subject.
38. A method of inducing STING-dependent type I interferon production in a subject, said method comprising administering a therapeutically effective amount of a compound according to claim 13, or a pharmaceutically acceptable salt thereof, to the subject.
39. A method of inducing STING-dependent type I interferon production in a subject, said method comprising administering a therapeutically effective amount of a pharmaceutical composition according to claim 23 to the subject.
40. A method of treating a cell proliferation disorder in a subject, said method comprising administering a therapeutically effective amount of a compound according to claim 13, or a pharmaceutically acceptable salt thereof, to the subject.
41. The method of claim 40, wherein the cell proliferation disorder is cancer.
42. A method of treating a cell proliferation disorder in a subject, said method comprising administering a therapeutically effective amount of a pharmaceutical composition according to claim 27 to the subject.
43. The method of claim 42, wherein the cell proliferation disorder is cancer.
Description
DETAILED DESCRIPTION OF THE INVENTION
(1) The present disclosure includes compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and pharmaceutically acceptable salts thereof. These compounds and their pharmaceutically acceptable salts may be useful as agents to induce immune responses, to induce STING-dependent type I interferon production, and/or to treat a cell proliferation disorder.
(2) A first embodiment relates to compounds of general formula (I):
(3) ##STR00008##
or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(4) ##STR00009##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
(5) In a first aspect of the first embodiment, each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N. In particular instances of this aspect, each
(6) ##STR00010##
is independently selected from the group consisting of
(7) ##STR00011##
In more particular instances of this aspect, each
(8) ##STR00012##
is independently selected from the group consisting of
(9) ##STR00013##
In this aspect, all other groups are as provided in the general formula (I) of the first embodiment above.
(10) In a second aspect of the first embodiment, each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2. In instances of this aspect, each R.sup.1 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and halogen. In more particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and F. In this aspect, all other groups are as provided in the general formula (I) of the first embodiment above or in the first aspect above.
(11) In a third aspect of the first embodiment, each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6). In instances of this aspect, each R.sup.2 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, OC.sub.1-C.sub.3 alkyl, C.sub.2-C.sub.3 alkenyl, and N(R.sup.6).sub.2. In particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, Br, Cl, CH.sub.3, CH.sub.2CH.sub.3, CHCH.sub.2, OCH.sub.3, OCFH.sub.2, OCF.sub.2H, OCF.sub.3, and N(R.sup.6).sub.2. In more particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, CH.sub.3, OCH.sub.3, and OCF.sub.2H. In this aspect, all other groups are as provided in the general formula (I) of the first embodiment or in the first or second aspects described above.
(12) In a fourth aspect of the first embodiment, R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2-8, O(CH.sub.2).sub.1-7, O(CH.sub.2).sub.1-6O, NH(CH.sub.2).sub.1-7, and NH(CH.sub.2).sub.1-6O. In particular instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2, (CH.sub.2).sub.3, (CH.sub.2).sub.4, O(CH.sub.2).sub.2, O(CH.sub.2).sub.3, O(CH.sub.2).sub.4, O(CH.sub.2).sub.20, O(CH.sub.2).sub.3O, OCH.sub.2CH(CH.sub.3)CH.sub.2O, O(CH.sub.2).sub.4O, O(CH.sub.2).sub.5O, NH(CH.sub.2).sub.2, NH(CH.sub.2).sub.3, and NH(CH.sub.2).sub.3O. In specific instances of this fourth aspect, R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In this instance, the structure of general formula (I) is formula (Ia):
(13) ##STR00014##
wherein all groups are as provided in the general formula (I). In this aspect, all other groups are as provided in the general formula (I) of the first embodiment or in the first through third aspects described above.
(14) In a fifth aspect of the first embodiment, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl. In instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, CH.sub.3, and CHF.sub.2. In this aspect, all other groups are as provided in the general formula (I) of the first embodiment or in the first through fourth aspects described above.
(15) In a sixth aspect of the first embodiment, each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2. In instances of this aspect, X.sup.1 is selected from the group consisting of CO and CH.sub.2. In particular instances of this aspect, X.sup.1 is CO.
(16) In this embodiment, all other groups are as provided in the general formula (I) of the first embodiment or in the first through fifth aspects described above.
(17) In a seventh aspect of the first embodiment, each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle. In a first instance of this aspect, each X.sup.2 is CH.sub.2CHR.sup.8, where R.sup.8 is selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl. In particular occurrences of this first instance, each X.sup.2 is CH.sub.2CHR.sup.8, wherein R.sup.8 is selected from the group consisting of H, CH.sub.3, CH.sub.2OH, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2CH.sub.3, CH(CH.sub.3).sub.2, CH.sub.2OCH.sub.3, and cyclopropyl. In a second instance of this aspect, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In particular occurrences of this second instance, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In a third instance of this aspect, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In particular occurrences of this third instance, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In this aspect, all other groups are as provided in the general formula (I) of the first embodiment or in the first through sixth aspects described above.
(18) In an eighth aspect of the first embodiment, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(19) ##STR00015##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6,
(20) ##STR00016##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)N(R.sup.9).sub.2, and CN. In even more particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOH, COOCH.sub.3, CONH.sub.2, and CN. In this aspect, all other groups are as provided in the general formula (I) of the first embodiment or in the first through seventh aspects described above.
(21) In a ninth aspect of the first embodiment, each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6. In instances of this aspect, each R.sup.9 is independently H. In this aspect, all other groups are as provided in the general formula (I) of the first embodiment or in the first through eighth aspects described above.
(22) A tenth aspect of the first embodiment relates to a pharmaceutical composition, said pharmaceutical composition comprising (a) a compound according to general formula (I) above of the first embodiment or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof, and (b) a pharmaceutically acceptable carrier.
(23) An eleventh aspect of the first embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (I) above of the first embodiment or the first through ninth aspects described above described above or a pharmaceutically acceptable salt thereof to the patient.
(24) A twelfth aspect of the first embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(25) A thirteenth aspect of the first embodiment relates to methods of inducing a STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (I) of the first embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(26) A fourteenth aspect of the first embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(27) A fifteenth aspect of the first embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (I) of the first embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(28) A sixteenth aspect of the first embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(29) A seventeenth aspect of the first embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound of general formula (I), or a pharmaceutically acceptable salt thereof to the patient. In instances of this seventeenth aspect of the first embodiment, the cell proliferation disorder is cancer.
(30) An eighteenth aspect of the first embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition according to the eleventh aspect described above to the patient. In instances of this eighteenth aspect of the first embodiment, the cell proliferation disorder is cancer.
(31) In each aspect of the first embodiment described herein, variables R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, R.sup.9, A, X.sup.1, X.sup.2, and X.sup.3 of general formula (I) of the first embodiment, and the various aspects and instances thereof, are each independently selected from each other, with the proviso that at least one of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, and R.sup.9 is not H.
(32) A second embodiment relates to compounds of general formula (II):
(33) ##STR00017##
or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(34) ##STR00018##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
(35) In a first aspect of the second embodiment, each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N. In particular instances of this aspect, each
(36) ##STR00019##
is independently selected from the group consisting of
(37) ##STR00020##
In more particular instances of this aspect, each
(38) ##STR00021##
is independently selected from the group consisting of
(39) ##STR00022##
In this aspect, all other groups are as provided in the general formula (II) of the second embodiment above.
(40) In a second aspect of the second embodiment, each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2. In instances of this aspect, each R.sup.1 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and halogen. In more particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and F. In this aspect, all other groups are as provided in the general formula (II) of the second embodiment above or in the first aspect above.
(41) In a third aspect of the second embodiment, each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6). In instances of this aspect, each R.sup.2 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, OC.sub.1-C.sub.3 alkyl, C.sub.2-C.sub.3 alkenyl, and N(R.sup.6).sub.2. In particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, Br, Cl, CH.sub.3, CH.sub.2CH.sub.3, CHCH.sub.2, OCH.sub.3, OCFH.sub.2, OCF.sub.2H, OCF.sub.3, and N(R.sup.6).sub.2. In more particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, CH.sub.3, OCH.sub.3, and OCF.sub.2H. In this aspect, all other groups are as provided in the general formula (II) of the second embodiment or in the first or second aspects described above.
(42) In a fourth aspect of the second embodiment, R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2-8, O(CH.sub.2).sub.1-7, O(CH.sub.2).sub.1-6O, NH(CH.sub.2).sub.1-7, and NH(CH.sub.2).sub.1-6O. In particular instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2, (CH.sub.2).sub.3, (CH.sub.2).sub.4, O(CH.sub.2).sub.2, O(CH.sub.2).sub.3, O(CH.sub.2).sub.4, O(CH.sub.2).sub.20, O(CH.sub.2).sub.3O, OCH.sub.2CH(CH.sub.3)CH.sub.2O, O(CH.sub.2).sub.4O, O(CH.sub.2).sub.5O, NH(CH.sub.2).sub.2, NH(CH.sub.2).sub.3, and NH(CH.sub.2).sub.3O. In specific instances of this fourth aspect, R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In this instance, the structure of general formula (II) is formula (IIa):
(43) ##STR00023##
wherein all groups are as provided in the general formula (II). In this aspect, all other groups are as provided in the general formula (II) of the second embodiment or in the first through third aspects described above.
(44) In a fifth aspect of the second embodiment, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl. In instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, CH.sub.3, and CHF.sub.2. In this aspect, all other groups are as provided in the general formula (II) of the second embodiment or in the first through fourth aspects described above.
(45) In a sixth aspect of the second embodiment, each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2. In instances of this aspect, X.sup.1 is selected from the group consisting of CO and CH.sub.2. In particular instances of this aspect, X.sup.1 is CO. In this embodiment, all other groups are as provided in the general formula (II) of the second embodiment or in the first through fifth aspects described above
(46) In a seventh aspect of the second embodiment, each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle. In a first instance of this aspect, each X.sup.2 is CH.sub.2CHR.sup.8, where R.sup.8 is selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl. In particular occurrences of this first instance, each X.sup.2 is CH.sub.2CHR.sup.8, wherein R.sup.8 is selected from the group consisting of H, CH.sub.3, CH.sub.2OH, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2CH.sub.3, CH(CH.sub.3).sub.2, CH.sub.2OCH.sub.3, and cyclopropyl. In a second instance of this aspect, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In particular occurrences of this second instance, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In a third instance of this aspect, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In particular occurrences of this third instance, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In this aspect, all other groups are as provided in the general formula (II) of the second embodiment or in the first through sixth aspects described above.
(47) In an eighth aspect of the second embodiment, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(48) ##STR00024##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6,
(49) ##STR00025##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)N(R.sup.9).sub.2, and CN. In even more particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOH, COOCH.sub.3, CONH.sub.2, and CN. In this aspect, all other groups are as provided in the general formula (II) of the second embodiment or in the first through seventh aspects described above.
(50) In a ninth aspect of the second embodiment, each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6. In instances of this aspect, each R.sup.9 is independently H. In this aspect, all other groups are as provided in the general formula (II) of the second embodiment or in the first through eighth aspects described above.
(51) A tenth aspect of the second embodiment relates to a pharmaceutical composition, said pharmaceutical composition comprising (a) a compound according to general formula (II) above of the second embodiment or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof; and (b) a pharmaceutically acceptable carrier.
(52) An eleventh aspect of the second embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (II) above of the second embodiment or the first through ninth aspects described above described above or a pharmaceutically acceptable salt thereof to the patient.
(53) A twelfth aspect of the second embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(54) A thirteenth aspect of the second embodiment relates to methods of inducing a STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (II) of the second embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(55) A fourteenth aspect of the second embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(56) A fifteenth aspect of the second embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (II) of the second embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(57) A sixteenth aspect of the second embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(58) A seventeenth aspect of the second embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound of general formula (II), or a pharmaceutically acceptable salt thereof to the patient. In instances of this seventeenth aspect of the second embodiment, the cell proliferation disorder is cancer.
(59) An eighteenth aspect of the second embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition according to the eleventh aspect described above to the patient. In instances of this eighteenth aspect of the second embodiment, the cell proliferation disorder is cancer.
(60) In each aspect of the second embodiment described herein, variables R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, R.sup.9, A, X.sup.1, X.sup.2, and X.sup.3 of general formula (II) of the second embodiment, and the various aspects and instances thereof, are each independently selected from each other, with the proviso that at least one of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, and R.sup.9 is not H.
(61) A third embodiment relates to compounds of general formula (III):
(62) ##STR00026##
or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.3 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring G, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring G is from an atom on said ring G with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.4 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(63) ##STR00027##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
(64) In a first aspect of the third embodiment, each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N. In particular instances of this aspect, each
(65) ##STR00028##
is independently selected from the group consisting of
(66) ##STR00029##
is selected from the group consisting of
(67) ##STR00030##
In more particular instances of this aspect, each
(68) ##STR00031##
is independently selected from the group consisting of
(69) ##STR00032##
and each
(70) ##STR00033##
is selected from the group consisting of
(71) ##STR00034##
In this aspect, all other groups are as provided in the general formula (III) of the third embodiment above.
(72) In a second aspect of the third embodiment, each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2. In instances of this aspect, each R.sup.1 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and halogen. In more particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and F. In this aspect, all other groups are as provided in the general formula (III) of the third embodiment above or in the first aspect above.
(73) In a third aspect of the third embodiment, each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6). In instances of this aspect, each R.sup.2 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, OC.sub.1-C.sub.3 alkyl, C.sub.2-C.sub.3 alkenyl, and N(R.sup.6).sub.2. In particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, Br, Cl, CH.sub.3, CH.sub.2CH.sub.3, CHCH.sub.2, OCH.sub.3, OCFH.sub.2, OCF.sub.2H, OCF.sub.3, and N(R.sup.6).sub.2. In more particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, CH.sub.3, OCH.sub.3, and OCF.sub.2H. In this aspect, all other groups are as provided in the general formula (III) of the third embodiment or in the first or second aspects described above.
(74) In a fourth aspect of the third embodiment, R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); optionally R.sup.3 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring G, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring G is from an atom on said ring G with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl; optionally R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.4 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2.sub.8-, O(CH.sub.2).sub.1-7, O(CH.sub.2).sub.1-6O, NH(CH.sub.2).sub.1-7, and NH(CH.sub.2).sub.1-6O. In particular instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2, (CH.sub.2).sub.3, (CH.sub.2).sub.4, O(CH.sub.2).sub.2, O(CH.sub.2).sub.3, O(CH.sub.2).sub.4, O(CH.sub.2).sub.20, O(CH.sub.2).sub.3O, OCH.sub.2CH(CH.sub.3)CH.sub.2O, O(CH.sub.2).sub.4O, O(CH.sub.2).sub.5O, NH(CH.sub.2).sub.2, NH(CH.sub.2).sub.3, and NH(CH.sub.2).sub.3O. In specific instances of this fourth aspect, R.sup.3 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring G, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.4 from said ring G is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In this instance, the structure of general formula (III) is formula (IIIa):
(75) ##STR00035##
wherein all groups are as provided in the general formula (III). In further specific instances of this fourth aspect, R.sup.4 may be taken together with an adjacent CR.sup.1 and the atom to which they are attached to form fused ring E, which is selected from phenyl or a 5- or 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, N, and N(R.sup.6) wherein the bond to R.sup.3 from said ring E is from an atom on said ring E with an open valence for substitution and wherein said phenyl or heterocyclic ring is optionally substituted with one or more members of the group consisting of halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl.
(76) In this instance, the structure of general formula (III) is formula (IIIb):
(77) ##STR00036##
wherein all groups are as provided in the general formula (III). In this aspect, all other groups are as provided in the general formula (III) of the first embodiment or in the first through third aspects described above.
(78) In a fifth aspect of the third embodiment, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl. In instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, CH.sub.3, and CHF.sub.2. In this aspect, all other groups are as provided in the general formula (III) of the third embodiment or in the first through fourth aspects described above.
(79) In a sixth aspect of the third embodiment, each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2. In instances of this aspect, X.sup.1 is selected from the group consisting of CO and CH.sub.2. In particular instances of this aspect, X.sup.1 is CO.
(80) In this embodiment, all other groups are as provided in the general formula (III) of the third embodiment or in the first through fifth aspects described above.
(81) In a seventh aspect of the third embodiment, each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle. In a first instance of this aspect, each X.sup.2 is CH.sub.2CHR.sup.8, where R.sup.8 is selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl. In particular occurrences of this first instance, each X.sup.2 is CH.sub.2CHR.sup.8, wherein R.sup.8 is selected from the group consisting of H, CH.sub.3, CH.sub.2OH, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2CH.sub.3, CH(CH.sub.3).sub.2, CH.sub.2OCH.sub.3, and cyclopropyl. In a second instance of this aspect, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In particular occurrences of this second instance, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In a third instance of this aspect, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In particular occurrences of this third instance, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In this aspect, all other groups are as provided in the general formula (III) of the third embodiment or in the first through sixth aspects described above.
(82) In an eighth aspect of the third embodiment, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(83) ##STR00037##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6,
(84) ##STR00038##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)N(R.sup.9).sub.2, and CN. In even more particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOH, COOCH.sub.3, CONH.sub.2, and CN. In this aspect, all other groups are as provided in the general formula (III) of the third embodiment or in the first through seventh aspects described above.
(85) In a ninth aspect of the third embodiment, each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6. In instances of this aspect, each R.sup.9 is independently H. In this aspect, all other groups are as provided in the general formula (III) of the third embodiment or in the first through sixth aspects described above.
(86) A tenth aspect of the third embodiment relates to a pharmaceutical composition, said pharmaceutical composition comprising (a) a compound according to general formula (III) of the third embodiment or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof; and (b) a pharmaceutically acceptable carrier.
(87) An eleventh aspect of the third embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (III) of the third embodiment or the first through ninth aspects described above described above or a pharmaceutically acceptable salt thereof to the patient.
(88) A twelfth aspect of the third embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(89) A thirteenth aspect of the third embodiment relates to methods of inducing a STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (III) of the third embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(90) A fourteenth aspect of the third embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(91) A fifteenth aspect of the third embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (III) of the third embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(92) A sixteenth aspect of the third embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(93) A seventeenth aspect of the third embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound of general formula (III), or a pharmaceutically acceptable salt thereof to the patient. In instances of this seventeenth aspect of the third embodiment, the cell proliferation disorder is cancer.
(94) An eighteenth aspect of the third embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition according to the eleventh aspect described above to the patient. In instances of this eighteenth aspect of the third embodiment, the cell proliferation disorder is cancer.
(95) In each aspect of the third embodiment described herein, variables R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, R.sup.9, A, X.sup.1, X.sup.2, and X.sup.3 of general formula (III) of the third embodiment, and the various aspects and instances thereof, are each independently selected from each other, with the proviso that at least one of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, and R.sup.9 is not H.
(96) A fourth embodiment relates to compounds of general formula (IV):
(97) ##STR00039##
or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6); R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(98) ##STR00040##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
(99) In a first aspect of the fourth embodiment, each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N. In particular instances of this aspect, each
(100) ##STR00041##
is independently selected from the group consisting of
(101) ##STR00042##
is selected from the group consisting of
(102) ##STR00043##
In more particular instances of this aspect, each
(103) ##STR00044##
independently selected from the group consisting of
(104) ##STR00045##
is selected from the group consisting of
(105) ##STR00046##
In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment above.
(106) In a second aspect of the fourth embodiment, each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2. In instances of this aspect, each R.sup.1 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and halogen. In more particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and F. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment above or in the first aspect above.
(107) In a third aspect of the fourth embodiment, each R.sup.2 is independently selected from the group consisting of H, halogen, CN, OR.sup.6, N(R.sup.6).sub.2, COOR.sup.6, C(O)N(R.sup.6).sub.2, SO.sub.2R.sup.6, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 haloalkenyl, C.sub.2-C.sub.6 alkenyl substituted by OR.sup.6, C.sub.2-C.sub.6 alkynyl, C.sub.2-C.sub.6 haloalkynyl, C.sub.2-C.sub.6 alkynyl substituted by OR.sup.6, C.sub.3-C.sub.6 cycloalkyl, and a 3- to 6-membered heterocyclic ring including 1 to 2 ring members selected from the group consisting of O, S, and N(R.sup.6). In instances of this aspect, each R.sup.2 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, OC.sub.1-C.sub.3 alkyl, C.sub.2-C.sub.3 alkenyl, and N(R.sup.6).sub.2. In particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, Br, Cl, CH.sub.3, CH.sub.2CH.sub.3, CHCH.sub.2, OCH.sub.3, OCFH.sub.2, OCF.sub.2H, OCF.sub.3, and N(R.sup.6).sub.2. In more particular instances of this aspect, each R.sup.2 independently is selected from the group consisting of H, CH.sub.3, OCH.sub.3, and OCF.sub.2H. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first or second aspects described above.
(108) In a fourth aspect of the fourth embodiment, R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene). In instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2.sub.8-, O(CH.sub.2).sub.1-7, O(CH.sub.2).sub.1-6O, NH(CH.sub.2).sub.1-7, and NH(CH.sub.2).sub.1-6O. In particular instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2, (CH.sub.2).sub.3, (CH.sub.2).sub.4, O(CH.sub.2).sub.2, O(CH.sub.2).sub.3, O(CH.sub.2).sub.4, O(CH.sub.2).sub.20, O(CH.sub.2).sub.3O, OCH.sub.2CH(CH.sub.3)CH.sub.2O, O(CH.sub.2).sub.4O, O(CH.sub.2).sub.5O, NH(CH.sub.2).sub.2, NH(CH.sub.2).sub.3, and NH(CH.sub.2).sub.3O. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first through third aspects described above.
(109) In a fifth aspect of the fourth embodiment, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl. In instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, CH.sub.3, and CHF.sub.2. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first through fourth aspects described above.
(110) In a sixth aspect of the fourth embodiment, each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2. In instances of this aspect, X.sup.1 is selected from the group consisting of CO and CH.sub.2. In particular instances of this aspect, X.sup.1 is CO.
(111) In this embodiment, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first through fifth aspects described above.
(112) In a seventh aspect of the fourth embodiment, each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle. In a first instance of this aspect, each X.sup.2 is CH.sub.2CHR.sup.8, where R.sup.8 is selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl. In particular occurrences of this first instance, each X.sup.2 is CH.sub.2CHR.sup.8, wherein R.sup.8 is selected from the group consisting of H, CH.sub.3, CH.sub.2OH, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2CH.sub.3, CH(CH.sub.3).sub.2, CH.sub.2OCH.sub.3, and cyclopropyl. In a second instance of this aspect, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In particular occurrences of this second instance, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In a third instance of this aspect, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In particular occurrences of this third instance, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first through sixth aspects described above.
(113) In an eighth aspect of the fourth embodiment, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(114) ##STR00047##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6,
(115) ##STR00048##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)N(R.sup.9).sub.2, and CN. In even more particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOH, COOCH.sub.3, CONH.sub.2, and CN. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first through seventh aspects described above.
(116) In a ninth aspect of the fourth embodiment, each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6. In instances of this aspect, each R.sup.9 is independently H. In this aspect, all other groups are as provided in the general formula (IV) of the fourth embodiment or in the first through eighth aspects described above.
(117) A tenth aspect of the fourth embodiment relates to a pharmaceutical composition, said pharmaceutical composition comprising (a) a compound according to general formula (IV) of the fourth embodiment or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof; and (b) a pharmaceutically acceptable carrier.
(118) An eleventh aspect of the fourth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (IV) of the fourth embodiment or the first through ninth aspects described above described above or a pharmaceutically acceptable salt thereof to the patient.
(119) A twelfth aspect of the fourth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(120) A thirteenth aspect of the fourth embodiment relates to methods of inducing a STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (IV) of the fourth embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(121) A fourteenth aspect of the fourth embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(122) A fifteenth aspect of the fourth embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (IV) of the fourth embodiment above or the first through ninth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(123) A sixteenth aspect of the fourth embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the tenth aspect described above to the patient.
(124) A seventeenth aspect of the fourth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound of general formula (IV), or a pharmaceutically acceptable salt thereof to the patient. In instances of this seventeenth aspect of the fourth embodiment, the cell proliferation disorder is cancer.
(125) An eighteenth aspect of the fourth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition according to the eleventh aspect described above to the patient. In instances of this eighteenth aspect of the fourth embodiment, the cell proliferation disorder is cancer.
(126) In each aspect of the fourth embodiment described herein, variables R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, R.sup.9, A, X.sup.1, X.sup.2, and X.sup.3 of general formula (IV) of the fourth embodiment, and the various aspects and instances thereof, are each independently selected from each other, with the proviso that at least one of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, and R.sup.9 is not H.
(127) A fifth embodiment relates to compounds of general formula (V):
(128) ##STR00049##
or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(129) ##STR00050##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
(130) In a first aspect of the fifth embodiment, each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N. In particular instances of this aspect, each
(131) ##STR00051##
is independently selected from the group consisting of
(132) ##STR00052##
In more particular instances of this aspect, each
(133) ##STR00053##
is independently selected from the group consisting of
(134) ##STR00054##
In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment above.
(135) In a second aspect of the fifth embodiment, each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2. In instances of this aspect, each R.sup.1 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and halogen. In more particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and F. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment above or in the first aspect above.
(136) In a third aspect of the fifth embodiment, R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene). In instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2.sub.8-, O(CH.sub.2).sub.1-7, O(CH.sub.2).sub.1-6O, NH(CH.sub.2).sub.1-7, and NH(CH.sub.2).sub.1-6O. In particular instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2, (CH.sub.2).sub.3, (CH.sub.2).sub.4, O(CH.sub.2).sub.2, O(CH.sub.2).sub.3, O(CH.sub.2).sub.4, O(CH.sub.2).sub.20, O(CH.sub.2).sub.3O, OCH.sub.2CH(CH.sub.3)CH.sub.2O, O(CH.sub.2).sub.4O, O(CH.sub.2).sub.5O, NH(CH.sub.2).sub.2, NH(CH.sub.2).sub.3, and NH(CH.sub.2).sub.3O. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first and second aspects described above.
(137) In a fourth aspect of the fifth embodiment, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl. In instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, CH.sub.3, and CHF.sub.2. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first through third aspects described above.
(138) In a fifth aspect of the fifth embodiment, each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2. In instances of this aspect, X.sup.1 is selected from the group consisting of CO and CH.sub.2. In particular instances of this aspect, X.sup.1 is CO.
(139) In this embodiment, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first through fourth aspects described above.
(140) In a sixth aspect of the fifth embodiment, each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle. In a first instance of this aspect, each X.sup.2 is CH.sub.2CHR.sup.8, where R.sup.8 is selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl. In particular occurrences of this first instance, each X.sup.2 is CH.sub.2CHR.sup.8, wherein R.sup.8 is selected from the group consisting of H, CH.sub.3, CH.sub.2OH, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2CH.sub.3, CH(CH.sub.3).sub.2, CH.sub.2OCH.sub.3, and cyclopropyl. In a second instance of this aspect, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In particular occurrences of this second instance, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In a third instance of this aspect, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In particular occurrences of this third instance, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first through fifth aspects described above.
(141) In a seventh aspect of the fifth embodiment, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(142) ##STR00055##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6,
(143) ##STR00056##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)N(R.sup.9).sub.2, and CN. In even more particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOH, COOCH.sub.3, CONH.sub.2, and CN. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first through sixth aspects described above.
(144) In an eighth aspect of the fifth embodiment, each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6. In instances of this aspect, each R.sup.9 is independently H. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first through seventh aspects described above.
(145) A ninth aspect of the fifth embodiment relates to a pharmaceutical composition, said pharmaceutical composition comprising (a) a compound according to general formula (V) of the fifth embodiment or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof; and (b) a pharmaceutically acceptable carrier.
(146) A tenth aspect of the fifth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (V) of the fifth embodiment or the first through eighth aspects described above described above or a pharmaceutically acceptable salt thereof to the patient.
(147) An eleventh aspect of the fifth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient.
(148) A twelfth aspect of the fifth embodiment relates to methods of inducing a STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (V) of the fifth embodiment above or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(149) A thirteenth aspect of the fifth embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient.
(150) A fourteenth aspect of the fifth embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (V) of the fifth embodiment above or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(151) A fifteenth aspect of the fifth embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient.
(152) A sixteenth aspect of the fifth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (V) of the fifth embodiment above or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof to the patient. In instances of this sixteenth aspect of the fifth embodiment, the cell proliferation disorder is cancer.
(153) A seventeenth aspect of the fifth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient. In instances of this seventeenth aspect of the fifth embodiment, the cell proliferation disorder is cancer.
(154) In each aspect of the fifth embodiment described herein, variables R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, R.sup.9, A, X.sup.1, X.sup.2, and X.sup.3 of general formula (V) of the fifth embodiment, and the various aspects and instances thereof, are each independently selected from each other, with the proviso that at least one of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, and R.sup.9 is not H.
(155) A sixth embodiment relates to compounds of general formula (VI):
(156) ##STR00057##
or a pharmaceutically acceptable salt thereof, wherein each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N; each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2; R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene); each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl; each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2; each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle; each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(157) ##STR00058##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN; and each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6.
(158) In a first aspect of the sixth embodiment, each A-R.sup.1 is independently selected from the group consisting of CR.sup.1 and N. In particular instances of this aspect, each
(159) ##STR00059##
is independently selected from the group consisting of
(160) ##STR00060##
In more particular instances of this aspect, each
(161) ##STR00061##
is independently selected from the group consisting of
(162) ##STR00062##
In this aspect, all other groups are as provided in the general formula (VI) of the sixth embodiment above.
(163) In a second aspect of the sixth embodiment, each R.sup.1 is independently selected from the group consisting of H, halogen, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 haloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2, COOR.sup.6, and C(O)N(R.sup.6).sub.2. In instances of this aspect, each R.sup.1 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and halogen. In more particular instances of this aspect, each R.sup.1 is independently selected from the group consisting of H and F. In this aspect, all other groups are as provided in the general formula (VI) of the sixth embodiment above or in the first aspect above.
(164) In a third aspect of the sixth embodiment, R.sup.3 and R.sup.4 are independently selected from the group consisting of O(C.sub.1-C.sub.4 alkylene or haloalkylene), C.sub.1-C.sub.5 alkylene or haloalkylene, and N(R.sub.6)(C.sub.1-C.sub.4 alkylene or haloalkylene). In instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2-8, O(CH.sub.2).sub.1-7, O(CH.sub.2).sub.1-6O, NH(CH.sub.2).sub.1-7, and NH(CH.sub.2).sub.1-6O. In particular instances of this fourth aspect, R.sup.3-R.sup.4 is selected from the group consisting of (CH.sub.2).sub.2, (CH.sub.2).sub.3, (CH.sub.2).sub.4, O(CH.sub.2).sub.2, O(CH.sub.2).sub.3, O(CH.sub.2).sub.4, O(CH.sub.2).sub.20, O(CH.sub.2).sub.3O, OCH.sub.2CH(CH.sub.3)CH.sub.2O, O(CH.sub.2).sub.4O, O(CH.sub.2).sub.5O, NH(CH.sub.2).sub.2, NH(CH.sub.2).sub.3, and NH(CH.sub.2).sub.3O. In this aspect, all other groups are as provided in the general formula (VI) of the sixth embodiment or in the first and second aspects described above.
(165) In a fourth aspect of the sixth embodiment, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, and C.sub.1-C.sub.6 haloalkyl. In instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, and C.sub.1-C.sub.3 haloalkyl. In particular instances of this aspect, each R.sup.6 is independently selected from the group consisting of H, CH.sub.3, and CHF.sub.2. In this aspect, all other groups are as provided in the general formula (VI) of the sixth embodiment or in the first through third aspects described above.
(166) In a fifth aspect of the sixth embodiment, each X.sup.1 is independently selected from the group consisting of CO, CH.sub.2, CHF, and CF.sub.2. In instances of this aspect, X.sup.1 is selected from the group consisting of CO and CH.sub.2. In particular instances of this aspect, X.sup.1 is CO.
(167) In this embodiment, all other groups are as provided in the general formula (VI) of the sixth embodiment or in the first through fourth aspects described above
(168) In a sixth aspect of the sixth embodiment, each X.sup.2 is independently selected from (C(R.sup.8).sub.2).sub.(1-3), wherein each R.sup.8 is independently selected from the group consisting of H, halogen, C.sub.1-C.sub.6 alkyl, CN, OR.sup.6, N(R.sup.6).sub.2, C.sub.1-C.sub.6 haloalkyl, C.sub.3-C.sub.6 cycloalkyl, C.sub.1-C.sub.6 alkyl substituted by OR.sup.6, and C.sub.1-C.sub.6 alkyl substituted by N(R.sup.6).sub.2; optionally 2 R.sup.8 on different carbon atoms may be taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring; and optionally 2 R.sup.8 on a single carbon atom may be taken together, along with the atom to which they are attached, to form a 3- to 6-membered spirocycle. In a first instance of this aspect, each X.sup.2 is CH.sub.2CHR.sup.8, where R.sup.8 is selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl. In particular occurrences of this first instance, each X.sup.2 is CH.sub.2CHR.sup.8, wherein R.sup.8 is selected from the group consisting of H, CH.sub.3, CH.sub.2OH, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2CH.sub.3, CH(CH.sub.3).sub.2, CH.sub.2OCH.sub.3, and cyclopropyl. In a second instance of this aspect, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In particular occurrences of this second instance, each X.sup.2 is CHR.sup.8CHR.sup.8, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on different carbon atoms are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered fused ring. In a third instance of this aspect, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 alkyl substituted by OH, C.sub.1-C.sub.3 alkyl substituted by OC.sub.1-C.sub.3 alkyl, and C.sub.3-C.sub.6 cycloalkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In particular occurrences of this third instance, each X.sup.2 is CH.sub.2C(R.sup.8).sub.2, where each R.sup.8 is independently selected from the group consisting of H and C.sub.1-C.sub.3 alkyl, and optionally the 2 R.sup.8 on a single carbon atom are taken together, along with the atoms to which they are attached, to form a 3- to 6-membered spirocycle. In this aspect, all other groups are as provided in the general formula (VI) of the sixth embodiment or in the first through fifth aspects described above.
(169) In a seventh aspect of the sixth embodiment, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)SR.sup.6, C(S)OR.sup.6,
(170) ##STR00063##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6,
(171) ##STR00064##
SO.sub.2R.sup.6, C(O)N(R.sup.9).sub.2, and CN. In particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOR.sup.6, C(O)N(R.sup.9).sub.2, and CN. In even more particular instances of this aspect, each X.sup.3 is independently selected from the group consisting of COOH, COOCH.sub.3, CONH.sub.2, and CN. In this aspect, all other groups are as provided in the general formula (VI) of the sixth embodiment or in the first through sixth aspects described above.
(172) In an eighth aspect of the sixth embodiment, each R.sup.9 is independently selected from the group consisting of H, COOR.sup.6, and SO.sub.2R.sup.6. In instances of this aspect, each R.sup.9 is independently H. In this aspect, all other groups are as provided in the general formula (V) of the fifth embodiment or in the first through seventh aspects described above.
(173) A ninth aspect of the sixth embodiment relates to a pharmaceutical composition, said pharmaceutical composition comprising (a) a compound according to general formula (VI) of the sixth embodiment or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof; and (b) a pharmaceutically acceptable carrier.
(174) A tenth aspect of the sixth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (VI) of the sixth embodiment or the first through eighth aspects described above described above or a pharmaceutically acceptable salt thereof to the patient.
(175) An eleventh aspect of the sixth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient.
(176) A twelfth aspect of the sixth embodiment relates to methods of inducing a STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (VI) of the sixth embodiment above or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(177) A thirteenth aspect of the sixth embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient.
(178) A fourteenth aspect of the sixth embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (VI) of the sixth embodiment above or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof to the patient.
(179) A fifteenth aspect of the sixth embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient.
(180) A sixteenth aspect of the sixth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to general formula (VI) of the sixth embodiment above or the first through eighth aspects described above or a pharmaceutically acceptable salt thereof to the patient. In instances of this sixteenth aspect of the sixth embodiment, the cell proliferation disorder is cancer.
(181) A seventeenth aspect of the sixth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition according to the ninth aspect described above to the patient. In instances of this seventeenth aspect of the sixth embodiment, the cell proliferation disorder is cancer.
(182) In each aspect of the sixth embodiment described herein, variables R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, R.sup.9, A, X.sup.1, X.sup.2, and X.sup.3 of general formula (VI) of the sixth embodiment, and the various aspects and instances thereof, are each independently selected from each other, with the proviso that at least one of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.6, R.sup.8, and R.sup.9 is not H.
(183) A seventh embodiment relates to a compound selected from the group consisting of
(184) ##STR00065## ##STR00066## ##STR00067## ##STR00068## ##STR00069## ##STR00070## ##STR00071## ##STR00072## ##STR00073## ##STR00074## ##STR00075## ##STR00076## ##STR00077## ##STR00078## ##STR00079## ##STR00080## ##STR00081## ##STR00082## ##STR00083##
(185) ##STR00084## ##STR00085## ##STR00086## ##STR00087## ##STR00088## ##STR00089## ##STR00090## ##STR00091## ##STR00092## ##STR00093## ##STR00094## ##STR00095## ##STR00096## ##STR00097## ##STR00098## ##STR00099## ##STR00100## ##STR00101## ##STR00102## ##STR00103## ##STR00104## ##STR00105## ##STR00106## ##STR00107## ##STR00108## ##STR00109## ##STR00110## ##STR00111## ##STR00112##
and pharmaceutically acceptable salts thereof. Particular aspects of this seventh embodiment relate to a compound selected from the group consisting of
(186) ##STR00113## ##STR00114## ##STR00115## ##STR00116## ##STR00117## ##STR00118## ##STR00119## ##STR00120## ##STR00121## ##STR00122## ##STR00123## ##STR00124## ##STR00125## ##STR00126##
and pharmaceutically acceptable salts thereof.
(187) A first aspect of the seventh embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(188) A second aspect of the seventh embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition comprising a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(189) A third aspect of the seventh embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(190) A fourth aspect of the seventh embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition comprising a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(191) A fifth aspect of the seventh embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(192) A sixth aspect of the seventh embodiment relates to methods of inducing a STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition comprising a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(193) A seventh aspect of the seventh embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the seventh embodiment above or a pharmaceutically acceptable salt thereof to the patient. In instances of the seventh aspect of the seventh embodiment, the cell proliferation disorder is cancer.
(194) An eighth aspect of the seventh embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition comprising a compound according to the seventh embodiment above to the patient. In instances of this eighth aspect of the seventh embodiment, the cell proliferation disorder is cancer.
(195) An eighth embodiment relates to a compound selected from the exemplary species depicted in Examples 1 through 190 shown below.
(196) A first aspect of the eighth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(197) A second aspect of the eighth embodiment relates to methods of inducing an immune response in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition comprising a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(198) A third aspect of the eighth embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(199) A fourth aspect of the eighth embodiment relates to methods of inducing STING-dependent type I interferon production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition comprising a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(200) A fifth aspect of the eighth embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(201) A sixth aspect of the eighth embodiment relates to methods of inducing STING-dependent cytokine production in a patient in need of therapy, comprising administering a therapeutically effective amount of a composition comprising a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient.
(202) A seventh aspect of the eighth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, comprising administering a therapeutically effective amount of a compound according to the eighth embodiment above or a pharmaceutically acceptable salt thereof to the patient. In instances of the seventh aspect of the eighth embodiment, the cell proliferation disorder is cancer.
(203) An eighth aspect of the eighth embodiment relates to methods of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition comprising a compound according to the eighth embodiment above to the patient. In instances of this eighth aspect of the eighth embodiment, the cell proliferation disorder is cancer.
(204) Other embodiments of the present disclosure include the following:
(205) (a) A pharmaceutical composition comprising an effective amount of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
(206) (b) The pharmaceutical composition of (a), further comprising an active agent selected from the group consisting of STING agonist compounds, anti-viral compounds, antigens, adjuvants, CTLA-4 and PD-1 pathway antagonists and other immunomodulatory agents, lipids, liposomes, peptides, anti-cancer and chemotherapeutic agents.
(207) (c) A pharmaceutical combination that is (i) a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt thereof, and (ii) an active agent selected from the group consisting of STING agonist compounds, anti-viral compounds, antigens, adjuvants, CTLA-4 and PD-1 pathway antagonists and other immunomodulatory agents, lipids, liposomes, peptides, anti-cancer and chemotherapeutic agents; wherein the compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or pharmaceutically acceptable salt thereof, and the active agent are each employed in an amount that renders the combination effective for inducing an immune response in a patient.
(208) (d) A method of inducing an immune response in a patient, which comprises administering to the patient in need of therapy a therapeutically effective amount of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt thereof.
(209) (e) A method of inducing an immune response in a patient, which comprises administering to the patient in need of therapy a therapeutically effective amount of a composition of (a), a composition of (b), or a combination of (c).
(210) (f) A method of inducing STING-dependent type I interferon production in a patient, which comprises administering to the patient in need of therapy a therapeutically effective amount of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt thereof.
(211) A method of inducing STING-dependent type I interferon production in a patient, which comprises administering to the patient in need of therapy a therapeutically effective amount of a composition of (a), a composition of (b), or a combination of (c).
(212) (h) A method of inducing STING-dependent cytokine production in a patient, which comprises administering to the patient in need of therapy a therapeutically effective amount of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt thereof.
(213) (i) A method of inducing STING-dependent cytokine production in a patient, which comprises administering to the patient in need of therapy a therapeutically effective amount of a composition of (a), a composition of (b), or a combination of (c).
(214) (j) A method of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt thereof to the patient;
(215) (k) The method of (j), wherein the cell proliferation disorder is cancer.
(216) (l) A method of treating a cell proliferation disorder in a patient in need of therapy, said method comprising administering a therapeutically effective amount of a composition of (a), a composition of (b), or a combination of (c) to the patient.
(217) (m) The method of (l), wherein the cell proliferation disorder is cancer.
(218) The present disclosure also includes a compound of the present disclosure for use (i) in, (ii) as a medicament for, or (iii) in the preparation of a medicament for: (a) inducing an immune response in a patient, or (b) inducing STING-dependent cytokine production in a patient. In these uses, the compounds of the present disclosure can optionally be employed in combination with one or more active agents selected from STING agonist compounds, anti-viral compounds, antigens, adjuvants, CTLA-4 and PD-1 pathway antagonists and other immunomodulatory agents, lipids, liposomes, peptides, anti-cancer agents, and chemotherapeutic agents.
(219) Additional embodiments of the disclosure include the pharmaceutical compositions, combinations, and methods set forth in (a) through (m) above, and the uses set forth in the preceding paragraph, wherein the compound of the present disclosure employed therein is a compound of one of the embodiments, aspects, instances, occurrences, or features of the compounds described above. In all of these embodiments, the compound may optionally be used in the form of a pharmaceutically acceptable salt, as appropriate.
(220) In the embodiments of the compound provided above, it is to be understood that each embodiment may be combined with one or more other embodiments, to the extent that such a combination provides a stable compound and is consistent with the description of the embodiments. It is further to be understood that the embodiments of compositions and methods provided as (a) through (m) above are understood to include all embodiments of the compounds, including such embodiments as result from combinations of embodiments.
(221) The term subject (alternatively patient) as used herein refers to a mammal that has been the object of treatment, observation, or experiment. The mammal may be male or female. The mammal may be one or more selected from the group consisting of humans, bovine (e.g., cows), porcine (e.g., pigs), ovine (e.g., sheep), capra (e.g., goats), equine (e.g., horses), canine (e.g., domestic dogs), feline (e.g., house cats), Lagomorpha (rabbits), rodents (e.g., rats or mice), Procyon lotor (e.g., raccoons). In particular embodiments, the subject is human.
(222) As used herein, the term immune response relates to any one or more of the following: specific immune response, non-specific immune response, both specific and non-specific response, innate response, primary immune response, adaptive immunity, secondary immune response, memory immune response, immune cell activation, immune cell proliferation, immune cell differentiation, and cytokine expression. In certain embodiments, a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, is administered in conjunction with one or more additional therapeutic agents including anti-viral compounds, vaccines intended to stimulate an immune response to one or more predetermined antigens, adjuvants, CTLA-4 and PD-1 pathway antagonists and other immunomodulatory agents, lipids, liposomes, peptides, anti-cancer agents, and chemotherapeutic agents, etc. In certain embodiments, a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, is administered in conjunction with one or more additional compositions including anti-viral compounds, vaccines intended to stimulate an immune response to one or more predetermined antigens, adjuvants, CTLA-4 and PD-1 pathway antagonists and other immunomodulatory agents, lipids, liposomes, peptides, anti-cancer agents, and chemotherapeutic agents, etc.
(223) Compounds
(224) As used herein, the term alkyl refers to a monovalent straight or branched chain, saturated aliphatic hydrocarbon radical having a number of carbon atoms in the specified range. Thus, for example, C.sub.1-6 alkyl (or C.sub.1-C.sub.6 alkyl) refers to any of the hexyl alkyl and pentyl alkyl isomers as well as n-, iso-, sec- and tert-butyl, n- and iso-propyl, ethyl, and methyl. As another example, C.sub.14 alkyl refers to n-, iso-, sec- and tert-butyl, n- and isopropyl, ethyl, and methyl.
(225) As used herein, the term alkylene refers to a bivalent straight chain, saturated aliphatic hydrocarbon radical having a number of carbon atoms in the specified range.
(226) As used herein, the term alkenyl refers to a monovalent straight or branched chain, unsaturated aliphatic hydrocarbon radical having a number of carbon atoms in the specified range and including one or more double bonds.
(227) As used herein, the term alkenylene refers to a bivalent straight chain, unsaturated aliphatic hydrocarbon radical having a number of carbon atoms in the specified range and including one or more double bonds.
(228) As used herein, the term alkynyl refers to a monovalent straight or branched chain, unsaturated aliphatic hydrocarbon radical having a number of carbon atoms in the specified range and including one or more triple bonds.
(229) As used herein, the term alkynylene refers to a bivalent straight chain, unsaturated aliphatic hydrocarbon radical having a number of carbon atoms in the specified range and including one or more triple bonds.
(230) As used herein, the term halogen (or halo) refers to fluorine, chlorine, bromine, and iodine (alternatively fluoro, chloro, bromo, and iodo or F, Cl, Br, and I).
(231) As used herein, the term haloalkyl refers to an alkyl group as defined above in which one or more of the hydrogen atoms have been replaced with a halogen. Thus, for example, C.sub.1-6 haloalkyl (or C.sub.1-C.sub.6 haloalkyl) refers to a C.sub.1 to C.sub.6 linear or branched alkyl group as defined above with one or more halogen substituents. The term fluoroalkyl has an analogous meaning except the halogen substituents are restricted to fluoro. Suitable fluoroalkyls include the series (CH.sub.2).sub.0-4CF.sub.3 (i.e., trifluoromethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoro-n-propyl, etc.).
(232) As used herein, the term haloalkylene refers to an alkylene group as defined above in which one or more of the hydrogen atoms have been replaced by a halogen, as in the haloalkyl group defined above.
(233) As used herein, the term haloalkenyl refers to an alkenyl group as defined above in which one or more of the hydrogen atoms have been replaced with a halogen.
(234) As used herein, the term haloalkenylene refers to an alkenylene group as defined above in which one or more of the hydrogen atoms have been replaced by a halogen.
(235) As used herein, the term haloalkynyl refers to an alkynyl group as defined above in which one or more of the hydrogen atoms have been replaced with a halogen.
(236) As used herein, the term haloalkynylene refers to an alkynylene group as defined above in which one or more of the hydrogen atoms have been replaced by a halogen.
(237) As used herein, the term alkoxy as used herein, alone or in combination, includes an alkyl group connected to the oxy connecting atom. The term alkoxy also includes alkyl ether groups, where the term alkyl is defined above, and ether means two alkyl groups with an oxygen atom between them. Examples of suitable alkoxy groups include methoxy, ethoxy, n-propoxy, i-propoxy, n-butoxy, s-butoxy, t-butoxy, methoxymethane (also referred to as dimethyl ether), and methoxyethane (also referred to as ethyl methyl ether).
(238) As used herein, the term cycloalkyl refers to a saturated hydrocarbon containing one ring having a specified number of carbon atoms. Examples of cycloalkyl include cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl.
(239) As used herein, the term heterocycle, heterocyclyl, or heterocyclic, as used herein, represents a stable 3- to 6-membered monocyclic that is either saturated or unsaturated, and that consists of carbon atoms and from one to two heteroatoms selected from the group consisting of N, O, and S. The heterocyclic ring may be attached at any heteroatom or carbon atom which results in the creation of a stable structure. The term includes heteroaryl moieties. Examples of such heterocyclic elements include, but are not limited to, azepinyl, benzimidazolyl, benzisoxazolyl, benzofurazanyl, benzopyranyl, benzothiopyranyl, benzofuryl, benzothiazolyl, benzothienyl, benzoxazolyl, chromanyl, cinnolinyl, dihydrobenzofuryl, dihydrobenzothienyl, dihydrobenzothiopyranyl, dihydrobenzothiopyranyl sulfone, 1,3-dioxolanyl, furyl, imidazolidinyl, imidazolinyl, imidazolyl, indolinyl, indolyl, isochromanyl, isoindolinyl, isoquinolinyl, isothiazolidinyl, isothiazolyl, isothiazolidinyl, morpholinyl, naphthyridinyl, oxadiazolyl, 2-oxoazepinyl, oxazolyl, 2-oxopiperazinyl, 2-oxopiperdinyl, 2-oxopyrrolidinyl, piperidyl, piperazinyl, pyridyl, pyrazinyl, pyrazolidinyl, pyrazolyl, pyridazinyl, pyrimidinyl, pyrrolidinyl, pyrrolyl, quinazolinyl, quinolinyl, quinoxalinyl, tetrahydrofuryl, tetrahydroisoquinolinyl, tetrahydroquinolinyl, thiamorpholinyl, thiamorpholinyl sulfoxide, thiazolyl, thiazolinyl, thienofuryl, thienothienyl, triazolyl and thienyl.
(240) As used herein, the term fused ring refers to a cyclic group formed by substituents on separate atoms in a straight or branched alkane, or to a cyclic group formed by substituents on separate atoms in another ring.
(241) As used herein, the term spirocycle or spirocyclic ring refers to a pendant cyclic group formed by substituents on a single atom.
(242) Unless expressly stated to the contrary, all ranges cited herein are inclusive; i.e., the range includes the values for the upper and lower limits of the range as well as all values in between. As an example, temperature ranges, percentages, ranges of equivalents, and the like described herein include the upper and lower limits of the range and any value in the continuum there between. Numerical values provided herein, and the use of the term about, may include variations of 1%, +2%, +3%, +4%, +5%, +10%, +15%, and +20% and their numerical equivalents.
(243) As used herein, the term one or more item includes a single item selected from the list as well as mixtures of two or more items selected from the list.
(244) In the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and pharmaceutically acceptable salts of the foregoing, the atoms may exhibit their natural isotopic abundances, or one or more of the atoms may be artificially enriched in a particular isotope having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number predominantly found in nature. The present disclosure is meant to include all suitable isotopic variations of the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and pharmaceutically acceptable salts of the foregoing. For example, different isotopic forms of hydrogen (H) include protium (.sup.1H), deuterium (.sup.2H), and tritium (.sup.3H). Protium is the predominant hydrogen isotope found in nature. Enriching for deuterium may afford certain therapeutic advantages, such as increasing in vivo half-life or reducing dosage requirements, or may provide a compound useful as a standard for characterization of biological samples. Isotopically-enriched the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and pharmaceutically acceptable salts of the foregoing, can be prepared without undue experimentation by conventional techniques well known to those skilled in the art or by processes analogous to those described in the Schemes and Examples herein using appropriate isotopically-enriched reagents and/or intermediates.
(245) In particular embodiments of the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and pharmaceutically acceptable salts of the foregoing, the compounds are isotopically enriched with deuterium. In aspects of these embodiments, one or more of R.sup.1, R.sup.2, R.sup.3, R.sup.6, R.sup.8, and R.sup.9 may include deuterium.
(246) As shown in the general structural formulas and the structures of specific compounds as provided herein, a straight line at a chiral center includes both (R) and (S) stereoisomers and mixtures thereof. Also, unless otherwise specified (e.g., 100% purified compound), reference to a particular stereochemistry at a position provides a compound having the indicated stereochemistry but does not exclude the presence of stereoisomers having different stereochemistry at the indicated position.
(247) Recitation or depiction of a specific compound in the claims (i.e., a species) without a specific stereoconfiguration designation, or with such a designation for less than all chiral centers, is intended to encompass, for such undesignated chiral centers, the racemate, racemic mixtures, each individual enantiomer, a diastereoisomeric mixture and each individual diastereomer of the compound where such forms are possible due to the presence of one or more asymmetric centers. The separation of a mixture of stereoisomers can be carried out at an intermediate step during the synthesis of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, or it can be done on a final racemic product. Absolute stereochemistry may be determined by X-ray crystallography of crystalline products or crystalline intermediates, which are derivatized, if necessary, with a reagent containing a stereogenic center of known configuration. Alternatively, absolute stereochemistry may be determined by Vibrational Circular Dichroism (VCD) spectroscopy analysis. The present invention includes all such isomers, as well as salts, solvates (including hydrates), and solvated salts of such racernates, enantiomers, diastereomers, tautomers, and mixtures thereof.
(248) The invention includes all possible enantiomers and diastereomers and mixtures of two or more stereoisomers, for example mixtures of enantiomers and/or diastereomers, in all ratios. Thus, enantiomers are a subject of the invention in enantiomerically pure form, both as levorotatory and as dextrorotatory antipodes, in the form of racemates and in the form of mixtures of the two enantiomers in all ratios. In the case of a cis/trans isomerism, the invention includes both the cis form and the trans form, as well as mixtures of these forms in all ratios. The preparation of individual stereoisomers can be carried out, if desired, by separation of a mixture by customary methods, for example by chromatography or crystallization, by the use of stereochemically uniform starting materials for the synthesis or by stereoselective synthesis. Optionally a derivatization can be carried out before a separation of stereoisomers. The separation of a mixture of stereoisomers can be carried out at an intermediate step during the synthesis of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, or it can be done on a final racemic product. Absolute stereochemistry may be determined by X-ray crystallography of crystalline products or crystalline intermediates that are derivatized, if necessary, with a reagent containing a stereogenic center of known configuration. Unless a particular isomer, salt, solvate (including hydrates) or solvated salt of such racemate, enantiomer, or diastereomer is indicated, the present invention includes all such isomers, as well as salts, solvates (including hydrates), and solvated salts of such racemates, enantiomers, diastereomers, and mixtures thereof.
(249) The term compound refers to the compound and, in certain embodiments, to the extent they are stable, any hydrate or solvate thereof. A hydrate is the compound complexed with water, and a solvate is the compound complexed with a solvent, which may be an organic solvent or an inorganic solvent.
(250) A stable compound is a compound that can be prepared and isolated and whose structure and properties remain or can be caused to remain essentially unchanged for a period of time sufficient to allow use of the compound for the purposes described herein (e.g., therapeutic administration to a patient). The compounds of the present invention are limited to stable compounds embraced by general formula (I), general formula (II), general formula (III), general formula (IV), general formula (V), general formula (VI), or pharmaceutically acceptable salts thereof.
(251) Salts
(252) As indicated above, the compounds of the present invention can be employed in the form of pharmaceutically acceptable salts. Those skilled in the art will recognize those instances in which the compounds of the invention may form salts. Examples of such compounds are described herein by reference to possible salts. Such reference is for illustration only.
(253) Pharmaceutically acceptable salts can be used with compounds for treating patients. Non-pharmaceutical salts may, however, be useful in the preparation of intermediate compounds.
(254) The term pharmaceutically acceptable salt refers to a salt (including an inner salt such as a zwitterion) that possesses effectiveness similar to the parent compound and that is not biologically or otherwise undesirable (e.g., is neither toxic nor otherwise deleterious to the recipient thereof). Thus, an embodiment of the invention provides pharmaceutically acceptable salts of the compounds of the invention. The term salt(s), as employed herein, denotes any of the following: acidic salts formed with inorganic and/or organic acids, as well as basic salts formed with inorganic and/or organic bases. Salts of compounds of the invention may be formed by methods known to those of ordinary skill in the art, for example, by reacting a compound of the invention with an amount of acid or base, such as an equivalent amount, in a medium such as one in which the salt precipitates or in aqueous medium followed by lyophilization.
(255) Exemplary acid addition salts include acetates, ascorbates, benzoates, benzenesulfonates, bisulfates, borates, butyrates, citrates, camphorates, camphorsulfonates, fumarates, hydrochlorides, hydrobromides, hydroiodides, lactates, maleates, methanesulfonates (mesylates), naphthalenesulfonates, nitrates, oxalates, phosphates, propionates, salicylates, succinates, sulfates, tartarates, thiocyanates, toluenesulfonates (tosylates) and the like. Suitable salts include acid addition salts that may, for example, be formed by mixing a solution of a compound with a solution of a pharmaceutically acceptable acid such as hydrochloric acid, sulfuric acid, acetic acid, trifluoroacetic acid, or benzoic acid. Additionally, acids that are generally considered suitable for the formation of pharmaceutically useful salts from basic pharmaceutical compounds are discussed, for example, by P. Stahl et al, Camille G. (eds.), Handbook of Pharmaceutical Salts. Properties, Selection and Use. (2002) Zurich: Wiley-VCH; S. Berge et al, Journal of Pharmaceutical Sciences (1977) 66(1) 1-19; P. Gould, International J. of Pharmaceutics (1986) 33 201-217; Anderson et al, The Practice of Medicinal Chemistry (1996), Academic Press, New York; and in The Orange Book (Food & Drug Administration, Washington, D.C. on their website). These disclosures are incorporated herein by reference thereto.
(256) Exemplary basic salts include ammonium salts, alkali metal salts such as sodium, lithium, and potassium salts, alkaline earth metal salts such as calcium and magnesium salts, salts with organic bases (for example, organic amines) such as dicyclohexylamine, t-butyl amine, choline, and salts with amino acids such as arginine, lysine and the like. Basic nitrogen-containing groups may be quarternized with agents such as lower alkyl halides (e.g., methyl, ethyl, and butyl chlorides, bromides and iodides), dialkyl sulfates (e.g., dimethyl, diethyl, and dibutyl sulfates), long chain halides (e.g., decyl, lauryl, and stearyl chlorides, bromides and iodides), aralkyl halides (e.g., benzyl and phenethyl bromides), and others. Compounds carrying an acidic moiety can be mixed with suitable pharmaceutically acceptable salts to provide, for example, alkali metal salts (e.g., sodium or potassium salts), alkaline earth metal salts (e.g., calcium or magnesium salts), and salts formed with suitable organic ligands such as quaternary ammonium salts. Also, in the case of an acid (COOH) or alcohol group being present, pharmaceutically acceptable esters can be employed to modify the solubility or hydrolysis characteristics of the compound.
(257) All such acid salts and base salts are intended to be pharmaceutically acceptable salts within the scope of the invention and all acid and base salts are considered equivalent to the free forms of the corresponding compounds for purposes of the invention.
(258) In addition, when a compound of the invention contains both a basic moiety, such as, but not limited to an aliphatic primary, secondary, tertiary or cyclic amine, an aromatic or heteroaryl amine, pyridine or imidazole, and an acidic moiety, such as, but not limited to tetrazole or carboxylic acid, zwitterions (inner salts) may be formed and are included within the terms salt(s) as used herein. It is understood that certain compounds of the invention may exist in zwitterionic form, having both anionic and cationic centers within the same compound and a net neutral charge. Such zwitterions are included within the invention.
(259) Methods of Preparing Compounds
(260) Several methods for preparing the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and pharmaceutically acceptable salts of the foregoing, are described in the following Schemes and Examples. Starting materials and intermediates are purchased from commercial sources, made from known procedures, or are otherwise illustrated. In some cases the order of carrying out the steps of the reaction schemes may be varied to facilitate the reaction or to avoid unwanted reaction products.
(261) In the following Methods and Schemes, LG represents a leaving group, which may be a halide or triflate group. The variables included in the Methods and Schemes have the meanings provided; exemplary catalysts are defined in the Abbreviations (below).
(262) Method 1
(263) Benzothiophene dimers 1D and 1E, and pharmaceutically acceptable salts thereof, can be prepared in multiple ways. One way is shown in Scheme 1. The sequence begins with allyl-benzothiophene 1A. Cross-metathesis with Grubbs catalyst 2G affords the olefinic dimers 1B and 1C. Hydrogenation and then hydrolysis affords the dimers 1D and 1E with different tether lengths.
(264) ##STR00127##
Method 2
(265) Another method for the preparation of benzothiophene dimers, and pharmaceutically salts thereof, is detailed in Scheme 2. The sequence starts with an appropriately substituted aryl halide, 2A. Cross-coupling with a primary alcohol containing benzothiophene (2B) using RockPhos Pd G3 followed by hydrolysis affords the dimer 2C.
(266) ##STR00128##
Method 3
(267) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 3. The cross-coupling of alkyl bromide benzothiophene 3A and an aryl bromide 3B affords the ester nitrile dimer 3C. Hydrolysis with aqueous sodium hydroxide affords the dimer 3D.
(268) ##STR00129##
Method 4
(269) Another method for the preparation of benzothiphene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 4. Alkyl Suzuki reaction between aryl bromide 4a and alkyl boronate ester 4B in the presence of a palladium catalyst followed by hydrolysis of the ester affords the dimer 4C.
(270) ##STR00130##
Method 5
(271) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 5. The cross-coupling of alkyl bromide benzothiophene 5A and an aryl bromide 5B affords the dimer 5C. Hydrolysis affords the dimer 5D. Similarly, aryl halide 5E can be coupled with alkyl bromide 5F to create intermediate 5G. Hydrolysis affords the acid affords 5H.
(272) ##STR00131## ##STR00132##
Method 6
(273) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 6. The sequence begins with alkyl halide 6A. Displacement of the halide with an appropriately substituted phenol, 6B, under basic conditions followed by hydrolysis affords dimer 6C. Similarly, alkyl chloride 6D can be displaced by phenol 6E under basic conditions to afford 6F after conversion to the diacid. Phenol 6G can also be used to displace alkyl chloride 6D to afford the desired 6H after conversion to the diacid. Finally, alkyl bromide 61 can be displaced by the phenol 6J to afford 6K after conversion to the diacid.
(274) ##STR00133## ##STR00134##
Method 7
(275) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 7. The sequence begins with a Mitsunobu reaction between a primary alcohol 7A and a phenol 7B to afford 7C after hydrolysis of the diester. Alternatively, phenol 7D can be reacted with alcohol 7E under Mitsunobu conditions. Subsequent saponification affords the diacid 7F. Phenol 7G can also be used in a Mitsunobu reaction with 7H to afford 71 after conversion of the diester to the diacid.
(276) Similarly, a bis-phenol benzothiophene 7J and an appropriately substituted diol (7K) can be subjected to Mitsnobu conditions to afford a mixture of 7L and 7M. Hydrolysis affords a mixture of the diacids 7N and 7O.
(277) ##STR00135## ##STR00136## ##STR00137##
Method 8
(278) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 8. The sequence begins with an appropriately substituted aryl bromide, 8A. Reaction with an alkyl amine 8B in the presence of a palladium catalyst affords the alkyl amino dimer diester 8C. Hydrolysis affords the desired diacid 8D.
(279) ##STR00138##
Method 9
(280) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 9. The sequence begins with a reductive amination between aldehyde 9A and amino azabenzothiphene 9B in the presence of sodium triacetoxyborohydride. Addition of TFA to the crude mixture affords the desired diacid 9C.
(281) ##STR00139##
Method 10
(282) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 10. The sequence begins with the bis-alkylation of an alkyl dihalide with an appropriately substituted phenolic benzothiophene 10A to afford the dimer diester 10B. Hydrolysis affords the desired diacid, 10C. Similarly, a dihalide can be bis-alkylated with 10D to afford the diacid 10E after conversion of the diester to the diacid.
(283) ##STR00140##
Method 11
(284) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 11. The sequence begins with the alkylation of aniline 11B with the alkyl bromide 11A to afford 11C. Hydrolysis of the diester affords 11D.
(285) ##STR00141##
Method 12
(286) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 12. The sequence begins with the alkylation of phenol 12B with the alkyl bromide 12A to afford 12C. Selective base-mediated hydrolysis affords the mono-acid 12D. Coupling of 12D with either a sulfonamide or a sulfamide affords 12E. Acid-mediated hydrolysis affords 12F.
(287) ##STR00142## ##STR00143##
Method 13
(288) Another method for the preparation of benzothiophene dimers, and pharmaceutically acceptable salts thereof, is detailed in Scheme 13. The sequence begins with the alkylation of phenol 13B with the alkyl bromide 13A to afford 13C. Hydrolysis of the diester followed by acid-mediated deprotection of the methoxymethyl acetal (MOM)-protected phenol affords 13D.
(289) ##STR00144##
Methods of Use
(290) Compounds described herein having therapeutic applications, such as the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), the compounds of the Examples 1 through 190, and pharmaceutically acceptable salts of the foregoing, may be administered to a patient for the purpose of inducing an immune response, inducing STING-dependent cytokine production and/or inducing anti-tumor activity. The term administration and variants thereof (e.g., administering a compound) means providing the compound to the individual in need of treatment. When a compound is provided in combination with one or more additional active agents (e.g., antiviral agents useful for treating HCV infection or anti-tumor agents for treating cancers), administration and its variants are each understood to include concurrent and sequential provision of the compound or salt and other agents.
(291) The compounds disclosed herein may be STING agonists. These compounds are potentially useful in treating diseases or disorders including, but not limited to, cell proliferation disorders. Cell-proliferation disorders include, but are not limited to, cancers, benign papillomatosis, gestational trophoblastic diseases, and benign neoplastic diseases, such as skin papilloma (warts) and genital papilloma.
(292) In specific embodiments, the disease or disorder to be treated is a cell proliferation disorder. In certain embodiments, the cell proliferation disorder is cancer. In particular embodiments, the cancer is selected from brain and spinal cancers, cancers of the head and neck, leukemia and cancers of the blood, skin cancers, cancers of the reproductive system, cancers of the gastrointestinal system, liver and bile duct cancers, kidney and bladder cancers, bone cancers, lung cancers, malignant mesothelioma, sarcomas, lymphomas, glandular cancers, thyroid cancers, heart tumors, germ cell tumors, malignant neuroendocrine (carcinoid) tumors, midline tract cancers, and cancers of unknown primary (i.e., cancers in which a metastasized cancer is found but the original cancer site is not known). In particular embodiments, the cancer is present in an adult patient; in additional embodiments, the cancer is present in a pediatric patient. In particular embodiments, the cancer is AIDS-related.
(293) In specific embodiments, the cancer is selected from brain and spinal cancers. In particular embodiments, the cancer is selected from the group consisting of anaplastic astrocytomas, glioblastomas, astrocytomas, and estheosioneuroblastomas (also known as olfactory blastomas). In particular embodiments, the brain cancer is selected from the group consisting of astrocytic tumor (e.g., pilocytic astrocytoma, subependymal giant-cell astrocytoma, diffuse astrocytoma, pleomorphic xanthoastrocytoma, anaplastic astrocytoma, astrocytoma, giant cell glioblastoma, glioblastoma, secondary glioblastoma, primary adult glioblastoma, and primary pediatric glioblastoma), oligodendroglial tumor (e.g., oligodendroglioma, and anaplastic oligodendroglioma), oligoastrocytic tumor (e.g., oligoastrocytoma, and anaplastic oligoastrocytoma), ependymoma (e.g., myxopapillary ependymoma, and anaplastic ependymoma); medulloblastoma, primitive neuroectodermal tumor, schwannoma, meningioma, atypical meningioma, anaplastic meningioma, pituitary adenoma, brain stem glioma, cerebellar astrocytoma, cerebral astorcytoma/malignant glioma, visual pathway and hypothalmic glioma, and primary central nervous system lymphoma. In specific instances of these embodiments, the brain cancer is selected from the group consisting of glioma, glioblastoma multiforme, paraganglioma, and suprantentorial primordial neuroectodermal tumors (sPNET).
(294) In specific embodiments, the cancer is selected from cancers of the head and neck, including nasopharyngeal cancers, nasal cavity and paranasal sinus cancers, hypopharyngeal cancers, oral cavity cancers (e.g., squamous cell carcinomas, lymphomas, and sarcomas), lip cancers, oropharyngeal cancers, salivary gland tumors, cancers of the larynx (e.g., laryngeal squamous cell carcinomas, rhabdomyosarcomas), and cancers of the eye or ocular cancers. In particular embodiments, the ocular cancer is selected from the group consisting of intraocular melanoma and retinoblastoma.
(295) In specific embodiments, the cancer is selected from leukemia and cancers of the blood. In particular embodiments, the cancer is selected from the group consisting of myeloproliferative neoplasms, myelodysplastic syndromes, myelodysplastic/myeloproliferative neoplasms, acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myelogenous leukemia (CML), myeloproliferative neoplasm (MPN), post-MPN AML, post-MDS AML, del(5q)-associated high risk MDS or AML, blast-phase chronic myelogenous leukemia, angioimmunoblastic lymphoma, acute lymphoblastic leukemia, Langerans cell histiocytosis, hairy cell leukemia, and plasma cell neoplasms including plasmacytomas and multiple myelomas. Leukemias referenced herein may be acute or chronic.
(296) In specific embodiments, the cancer is selected from skin cancers. In particular embodiments, the skin cancer is selected from the group consisting of melanoma, squamous cell cancers, and basal cell cancers.
(297) In specific embodiments, the cancer is selected from cancers of the reproductive system. In particular embodiments, the cancer is selected from the group consisting of breast cancers, cervical cancers, vaginal cancers, ovarian cancers, prostate cancers, penile cancers, and testicular cancers. In specific instances of these embodiments, the cancer is a breast cancer selected from the group consisting of ductal carcinomas and phyllodes tumors. In specific instances of these embodiments, the breast cancer may be male breast cancer or female breast cancer. In specific instances of these embodiments, the cancer is a cervical cancer selected from the group consisting of squamous cell carcinomas and adenocarcinomas. In specific instances of these embodiments, the cancer is an ovarian cancer selected from the group consisting of epithelial cancers.
(298) In specific embodiments, the cancer is selected from cancers of the gastro-intestinal system. In particular embodiments, the cancer is selected from the group consisting of esophageal cancers, gastric cancers (also known as stomach cancers), gastrointestinal carcinoid tumors, pancreatic cancers, gallbladder cancers, colorectal cancers, and anal cancer. In instances of these embodiments, the cancer is selected from the group consisting of esophageal squamous cell carcinomas, esophageal adenocarcinomas, gastric adenocarcinomas, gastrointestinal carcinoid tumors, gastrointestinal stromal tumors, gastric lymphomas, gastrointestinal lymphomas, solid pseudopapillary tumors of the pancreas, pancreatoblastoma, islet cell tumors, pancreatic carcinomas including acinar cell carcinomas and ductal adenocarcinomas, gallbladder adenocarcinomas, colorectal adenocarcinomas, and anal squamous cell carcinomas.
(299) In specific embodiments, the cancer is selected from liver and bile duct cancers. In particular embodiments, the cancer is liver cancer (also known as hepatocellular carcinoma). In particular embodiments, the cancer is bile duct cancer (also known as cholangiocarcinoma); in instances of these embodiments, the bile duct cancer is selected from the group consisting of intrahepatic cholangiocarcinoma and extrahepatic cholangiocarcinoma.
(300) In specific embodiments, the cancer is selected from kidney and bladder cancers. In particular embodiments, the cancer is a kidney cancer selected from the group consisting of renal cell cancer, Wilms tumors, and transitional cell cancers. In particular embodiments, the cancer is a bladder cancer selected from the group consisting of urethelial carcinoma (a transitional cell carcinoma), squamous cell carcinomas, and adenocarcinomas.
(301) In specific embodiments, the cancer is selected from bone cancers. In particular embodiments, the bone cancer is selected from the group consisting of osteosarcoma, malignant fibrous histiocytoma of bone, Ewing sarcoma, chordoma (cancer of the bone along the spine).
(302) In specific embodiments, the cancer is selected from lung cancers. In particular embodiments, the lung cancer is selected from the group consisting of non-small cell lung cancer, small cell lung cancers, bronchial tumors, and pleuropulmonary blastomas.
(303) In specific embodiments, the cancer is selected from malignant mesothelioma. In particular embodiments, the cancer is selected from the group consisting of epithelial mesothelioma and sarcomatoids.
(304) In specific embodiments, the cancer is selected from sarcomas. In particular embodiments, the sarcoma is selected from the group consisting of central chondrosarcoma, central and periosteal chondroma, fibrosarcoma, clear cell sarcoma of tendon sheaths, and Kaposi's sarcoma.
(305) In specific embodiments, the cancer is selected from lymphomas. In particular embodiments, the cancer is selected from the group consisting of Hodgkin lymphoma (e.g., Reed-Sternberg cells), non-Hodgkin lymphoma (e.g., diffuse large B-cell lymphoma, follicular lymphoma, mycosis fungoides, Sezary syndrome, primary central nervous system lymphoma), cutaneous T-cell lymphomas, primary central nervous system lymphomas.
(306) In specific embodiments, the cancer is selected from glandular cancers. In particular embodiments, the cancer is selected from the group consisting of adrenocortical cancer (also known as adrenocortical carcinoma or adrenal cortical carcinoma), pheochromocytomas, paragangliomas, pituitary tumors, thymoma, and thymic carcinomas.
(307) In specific embodiments, the cancer is selected from thyroid cancers. In particular embodiments, the thyroid cancer is selected from the group consisting of medullary thyroid carcinomas, papillary thyroid carcinomas, and follicular thyroid carcinomas.
(308) In specific embodiments, the cancer is selected from germ cell tumors. In particular embodiments, the cancer is selected from the group consisting of malignant extracranial germ cell tumors and malignant extragonadal germ cell tumors. In specific instances of these embodiments, the malignant extragonadal germ cell tumors are selected from the group consisting of nonseminomas and seminomas.
(309) In specific embodiments, the cancer is selected from heart tumors. In particular embodiments, the heart tumor is selected from the group consisting of malignant teratoma, lymphoma, rhabdomyosacroma, angiosarcoma, chondrosarcoma, infantile fibrosarcoma, and synovial sarcoma.
(310) In specific embodiments, the cell-proliferation disorder is selected from benign papillomatosis, benign neoplastic diseases and gestational trophoblastic diseases. In particular embodiments, the benign neoplastic disease is selected from skin papilloma (warts) and genital papilloma. In particular embodiments, the gestational trophoblastic disease is selected from the group consisting of hydatidiform moles, and gestational trophoblastic neoplasia (e.g., invasive moles, choriocarcinomas, placental-site trophoblastic tumors, and epithelioid trophoblastic tumors).
(311) As used herein, the terms treatment and treating refer to all processes in which there may be a slowing, interrupting, arresting, controlling, or stopping of the progression of a disease or disorder described herein. The terms do not necessarily indicate a total elimination of all disease or disorder symptoms.
(312) The terms administration of and or administering a compound should be understood to include providing a compound described herein, or a pharmaceutically acceptable salt thereof, and compositions of the foregoing to a patient.
(313) The amount of a compound administered to a patient is an amount sufficient to induce an immune response and/or to induce STING-dependent type I interferon production in the patient. In an embodiment, the amount of a compound can be an effective amount or therapeutically effective amount, such that the subject compound is administered in an amount that will elicit, respectively, a biological or medical (i.e., intended to treat) response of a tissue, system, animal, or human that is being sought by a researcher, veterinarian, medical doctor, or other clinician. An effective amount does not necessarily include considerations of toxicity and safety related to the administration of a compound.
(314) An effective amount of a compound will vary with the particular compound chosen (e.g., considering the potency, efficacy, and/or half-life of the compound); the route of administration chosen; the condition being treated; the severity of the condition being treated; the age, size, weight, and physical condition of the patient being treated; the medical history of the patient being treated; the duration of the treatment; the nature of a concurrent therapy; the desired therapeutic effect; and like factors and can be routinely determined by the skilled artisan.
(315) The compounds disclosed herein may be administered by any suitable route including oral and parenteral administration. Parenteral administration is typically by injection or infusion and includes intravenous, intramuscular, and subcutaneous injection or infusion.
(316) The compounds disclosed herein may be administered once or according to a dosing regimen where a number of doses are administered at varying intervals of time for a given period of time. For example, doses may be administered one, two, three, or four times per day. Doses may be administered until the desired therapeutic effect is achieved or indefinitely to maintain the desired therapeutic effect. Suitable dosing regimens for a compound disclosed herein depend on the pharmacokinetic properties of that compound, such as absorption, distribution and half-life, which can be determined by a skilled artisan. In addition, suitable dosing regimens, including the duration such regimens are administered, for a compound disclosed herein depend on the disease or condition being treated, the severity of the disease or condition, the age and physical condition of the patient being treated, the medical history of the patient being treated, the nature of concurrent therapy, the desired therapeutic effect, and like factors within the knowledge and expertise of the skilled artisan. It will be further understood by such skilled artisans that suitable dosing regimens may require adjustment given an individual patient's response to the dosing regimen or over time as the individual patient needs change. Typical daily dosages may vary depending upon the particular route of administration chosen.
(317) One embodiment of the present disclosure provides for a method of treating a cell proliferation disorder comprising administration of a therapeutically effective amount of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), and pharmaceutically acceptable salts of the foregoing, to a patient in need of treatment thereof. In embodiments, the disease or disorder to be treated is a cell proliferation disorder. In aspects of these embodiments, the cell proliferation disorder is cancer. In further aspects of these embodiments, the cancer is selected from brain and spinal cancers, cancers of the head and neck, leukemia and cancers of the blood, skin cancers, cancers of the reproductive system, cancers of the gastrointestinal system, liver and bile duct cancers, kidney and bladder cancers, bone cancers, lung cancers, malignant mesothelioma, sarcomas, lymphomas, glandular cancers, thyroid cancers, heart tumors, germ cell tumors, malignant neuroendocrine (carcinoid) tumors, midline tract cancers, and cancers of unknown primary.
(318) In one embodiment, disclosed herein is the use of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, in a therapy. The compound may be useful in a method of inducing an immune response and/or inducing STING-dependent type I interferon production in a patient, such as a mammal in need of such inhibition, comprising administering an effective amount of the compound to the patient.
(319) In one embodiment, disclosed herein is a pharmaceutical composition comprising at least one compound of general formula (I), at least one compound of general formula (II), at least one compound of general formula (III), at least one compound of general formula (IV), at least one compound of general formula (V), at least one compound of general formula (VI), or at least one pharmaceutically acceptable salt of the foregoing, for use in potential treatment to induce an immune response and/or to induce STING-dependent type I interferon production.
(320) One embodiment disclosed herein is the use of a compound of general formula (I), a compound of general formula (II), a compound of general formula (III), a compound of general formula (IV), a compound of general formula (V), a compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, in the manufacture of a medicament to induce an immune response and/or to induce STING-dependent type I interferon production. In embodiments, the disease or disorder to be treated is a cell proliferation disorder. In aspects of these embodiments, the cell proliferation disorder is cancer. In further aspects of these embodiments, the cancer is selected from brain and spinal cancers, cancers of the head and neck, leukemia and cancers of the blood, skin cancers, cancers of the reproductive system, cancers of the gastrointestinal system, liver and bile duct cancers, kidney and bladder cancers, bone cancers, lung cancers, malignant mesothelioma, sarcomas, lymphomas, glandular cancers, thyroid cancers, heart tumors, germ cell tumors, malignant neuroendocrine (carcinoid) tumors, midline tract cancers, and cancers of unknown primary.
(321) Compositions
(322) The term composition as used herein is intended to encompass a dosage form comprising a specified compound in a specified amount, as well as any dosage form that results, directly or indirectly, from combination of a specified compound in a specified amount. Such term is intended to encompass a dosage form comprising a compound of general formula (I), a compound of general formula (II), a compound of general formula (III), a compound of general formula (IV), a compound of general formula (V), a compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, and one or more pharmaceutically acceptable carriers or excipients. Accordingly, the compositions of the present disclosure encompass any composition made by admixing a compound of the present disclosure and one or more pharmaceutically acceptable carrier or excipients. By pharmaceutically acceptable, it is meant the carriers or excipients are compatible with the compound disclosed herein and with other ingredients of the composition.
(323) For the purpose of inducing an immune response and/or inducing STING-dependent type I interferon production, the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or pharmaceutically acceptable salts of the foregoing, can be administered by means that produces contact of the active agent with the agent's site of action. The compounds can be administered by conventional means available for use in conjunction with pharmaceuticals, either as individual therapeutic agents or in a combination of therapeutic agents. The compounds can be administered alone, but typically are administered with a pharmaceutical carrier selected on the basis of the chosen route of administration and standard pharmaceutical practice.
(324) In one embodiment, disclosed herein is a composition comprising a compound of general formula (I), a compound of general formula (II), a compound of general formula (III), a compound of general formula (IV), a compound of general formula (V), a compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, and one or more pharmaceutically acceptable carriers or excipients. The composition may be prepared and packaged in bulk form in which a therapeutically effective amount of a compound of the disclosure can be extracted and then given to a patient, such as with powders or syrups. Alternatively, the composition may be prepared and packaged in unit dosage form in which each physically discrete unit contains a therapeutically effective amount of a compound of general formula (I), a compound of general formula (II), a compound of general formula (III), a compound of general formula (IV), a compound of general formula (V), a compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing.
(325) The compounds disclosed herein and a pharmaceutically acceptable carrier or excipient(s) will typically be formulated into a dosage form adapted for administration to a patient by a desired route of administration. For example, dosage forms include those adapted for (1) oral administration, such as tablets, capsules, caplets, pills, troches, powders, syrups, elixirs, suspensions, solutions, emulsions, sachets, and cachets; and (2) parenteral administration, such as sterile solutions, suspensions, and powders for reconstitution. Suitable pharmaceutically acceptable carriers or excipients will vary depending upon the particular dosage form chosen. In addition, suitable pharmaceutically acceptable carriers or excipients may be chosen for a particular function that they may serve in the composition. For example, certain pharmaceutically acceptable carriers or excipients may be chosen for their ability to facilitate the production of uniform dosage forms. Certain pharmaceutically acceptable carriers or excipients may be chosen for their ability to facilitate the production of stable dosage forms. Certain pharmaceutically acceptable carriers or excipients may be chosen for their ability to facilitate the carrying or transporting of a compound disclosed herein, once administered to the patient, from one organ or portion of the body to another organ or another portion of the body. Certain pharmaceutically acceptable carriers or excipients may be chosen for their ability to enhance patient compliance.
(326) Suitable pharmaceutically acceptable excipients include the following types of excipients: diluents, lubricants, binders, disintegrants, fillers, glidants, granulating agents, coating agents, wetting agents, solvents, co-solvents, suspending agents, emulsifiers, sweeteners, flavoring agents, flavor masking agents, coloring agents, anti-caking agents, hemectants, chelating agents, plasticizers, viscosity increasing agents, antioxidants, preservatives, stabilizers, surfactants, and buffering agents.
(327) A skilled artisan possesses the knowledge and skill in the art to select suitable pharmaceutically acceptable carriers and excipients in appropriate amounts for the use in the compositions of the disclosure. In addition, there are a number of resources available to the skilled artisan, which describe pharmaceutically acceptable carriers and excipients and may be useful in selecting suitable pharmaceutically acceptable carriers and excipients. Examples include R
(328) The compositions of the disclosure are prepared using techniques and methods known to those skilled in the art. Some methods commonly used in the art are described in REMINGTON'S PHARMACEUTICAL SCIENCES (Mack Publishing Company).
(329) In one embodiment, the disclosure is directed to a solid oral dosage form such as a tablet or capsule comprising a therapeutically effective amount of a compound of general formula (I), a compound of general formula (II), a compound of general formula (III), a compound of general formula (IV), a compound of general formula (V), a compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, and a diluent or filler. Suitable diluents and fillers include lactose, sucrose, dextrose, mannitol, sorbitol, starch (e.g., corn starch, potato starch, and pre-gelatinized starch), cellulose and its derivatives, (e.g., microcrystalline cellulose), calcium sulfate, and dibasic calcium phosphate. The solid oral dosage form may further comprise a binder. Suitable binders include starch (e.g., corn starch, potato starch, and pre-gelatinized starch) gelatin, acacia, sodium alginate, alginic acid, tragacanth, guar gum, povidone, and cellulose and its derivatives (e.g., microcrystalline cellulose). The solid oral dosage form may further comprise a disintegrant. Suitable disintegrants include crospovidone, sodium starch glycolate, croscarmelose, alginic acid, and sodium carboxymethyl cellulose. The solid oral dosage form may further comprise a lubricant. Suitable lubricants include stearic acid, magnesium stearate, calcium stearate, and talc.
(330) Where appropriate, dosage unit formulations for oral administration can be microencapsulated. The composition can also be prepared to prolong or sustain the release as, for example, by coating or embedding particulate material in polymers, wax, or the like.
(331) The compounds disclosed herein may also be coupled with soluble polymers as targetable drug carriers. Such polymers can include polyvinylpyrrolidone, pyrancopolymer, polyhydroxypropylmethacrylamidephenol, polyhydroxyethylaspartamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues. Furthermore, the compounds of the disclosure may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example polylactic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanacrylates, and cross-linked or amphipathic block copolymers of hydrogels.
(332) In one embodiment, the disclosure is directed to a liquid oral dosage form. Oral liquids such as solutions, syrups, and elixirs can be prepared in dosage unit form so that a given quantity contains a predetermined amount of a compound or a pharmaceutically acceptable salt thereof disclosed herein. Syrups can be prepared by dissolving the compound of the disclosure in a suitably flavored aqueous solution; elixirs are prepared through the use of a non-toxic alcoholic vehicle. Suspensions can be formulated by dispersing a compound disclosed herein in a non-toxic vehicle. Solubilizers and emulsifiers such as ethoxylated isostearyl alcohols and polyoxy ethylene sorbitol ethers, preservatives, flavor additives such as peppermint oil, or other natural sweeteners or saccharin or other artificial sweeteners and the like can also be added.
(333) In one embodiment, the disclosure is directed to compositions for parenteral administration. Compositions adapted for parenteral administration include aqueous and non-aqueous sterile injection solutions that may contain anti-oxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions that may include suspending agents and thickening agents. The compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition, requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, and tablets.
(334) Combinations
(335) The compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), and/or pharmaceutically acceptable salts of the foregoing, may be administered in combination with one or more additional active agents. In embodiments, one or more compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or one or more pharmaceutically acceptable salts of the foregoing, and the one or more additional active agents may be co-administered. The additional active agent(s) may be administered in a single dosage form with the compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or pharmaceutically acceptable salt of the foregoing, or the additional active agent(s) may be administered in separate dosage form(s) from the dosage form containing the compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or pharmaceutically acceptable salt of the foregoing.
(336) The additional active agent(s) may be provided as a pharmaceutically acceptable salt, where appropriate.
(337) The additional active agent(s) may be one or more agents selected from the group consisting of STING agonist compounds, anti-viral compounds, antigens, adjuvants, anti-cancer agents, CTLA-4, LAG-3 and PD-1 pathway antagonists, lipids, liposomes, peptides, cytotoxic agents, chemotherapeutic agents, immunomodulatory cell lines, checkpoint inhibitors, vascular endothelial growth factor (VEGF) receptor inhibitors, topoisomerase II inhibitors, smoothen inhibitors, alkylating agents, anti-tumor antibiotics, anti-metabolites, retinoids, and immunomodulatory agents including but not limited to anti-cancer vaccines. It will be understood that such additional active agent(s) may be provided as a pharmaceutically acceptable salt. It will be understood the descriptions of the above additional active agents may be overlapping. It will also be understood that the treatment combinations are subject to optimization, and it is understood that the best combination to use of the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or pharmaceutically acceptable salts of the foregoing, and one or more additional active agents will be determined based on the individual patient needs.
(338) A compound disclosed herein may be used in combination with one or more other active agents, including but not limited to, other anti-cancer agents that are used in the prevention, treatment, control, amelioration, or reduction of risk of a particular disease or condition (e.g., cell proliferation disorders). In one embodiment, a compound disclosed herein is combined with one or more other anti-cancer agents for use in the prevention, treatment, control amelioration, or reduction of risk of a particular disease or condition for which the compounds disclosed herein are useful. Such other active agents may be administered, by a route and in an amount commonly used therefor, contemporaneously or sequentially with a compound of the present disclosure.
(339) When a compound disclosed herein is used contemporaneously with one or more other active agents, a composition containing such other active agents in addition to the compound disclosed herein is contemplated. Accordingly, the compositions of the present disclosure include those that also contain one or more other active ingredients, in addition to a compound disclosed herein. A compound disclosed herein may be administered either simultaneously with, or before or after, one or more other active agent(s). A compound disclosed herein may be administered separately, by the same or different route of administration, or together in the same pharmaceutical composition as the other agent(s).
(340) Products provided as combinations may include a composition comprising a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, and one or more other active agent(s) together in the same pharmaceutical composition, or may include a composition comprising a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, and a composition comprising one or more other active agent(s) in separate form, e.g. in the form of a kit or in any form designed to enable separate administration either concurrently or on separate dosing schedules.
(341) The weight ratio of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, to a second active agent may be varied and will depend upon the therapeutically effective dose of each agent. Generally, a therapeutically effective dose of each will be used. Combinations of a compound disclosed herein and other active agents will generally also be within the aforementioned range, but in each case, a therapeutically effective dose of each active agent should be used. In such combinations, the compound disclosed herein and other active agents may be administered separately or in conjunction. In addition, the administration of one element may be prior to, concurrent to, or subsequent to the administration of other agent(s).
(342) In one embodiment, this disclosure provides a composition comprising a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, and at least one other active agent as a combined preparation for simultaneous, separate, or sequential use in therapy. In one embodiment, the therapy is the treatment of a cell proliferation disorder, such as cancer.
(343) In one embodiment, the disclosure provides a kit comprising two or more separate pharmaceutical compositions, at least one of which contains a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing. In one embodiment, the kit comprises means for separately retaining said compositions, such as a container, divided bottle, or divided foil packet. An example of such a kit is a blister pack, as typically used for the packaging of tablets, capsules, and the like.
(344) A kit of this disclosure may be used for administration of different dosage forms, for example, oral and parenteral, for administration of the separate compositions at different dosage intervals, or for titration of the separate compositions against one another. To assist with compliance, a kit of the disclosure typically comprises directions for administration.
(345) Disclosed herein is a use of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, for treating a cell proliferation disorder, where the medicament is prepared for administration with another active agent. The disclosure also provides the use of another active agent for treating a cell proliferation disorder, where the medicament is administered with a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing.
(346) The disclosure also provides the use of a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing, for treating a cell proliferation disorder, where the patient has previously (e.g., within 24 h) been treated with another active agent. The disclosure also provides the use of another active agent for treating a cell proliferation disorder, where the patient has previously (e.g., within 24 h) been treated with a compound of general formula (I), compound of general formula (II), compound of general formula (III), compound of general formula (IV), compound of general formula (V), compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing. The second agent may be administered a week, several weeks, a month, or several months after the administration of a compound disclosed herein.
(347) STING agonist compounds that may be used in combination with the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or pharmaceutically acceptable salts of the foregoing, disclosed herein include but are not limited to cyclic di-nucleotide compounds, such as those disclosed, for example, in International Patent Application Publication Nos. WO2014093936, WO2014189805, WO2014189806, WO2015185565, WO2016120305, WO2016096174, WO2016096577, WO2017027645, WO2017027646, WO2017075477, WO2017093933, and WO2018009466.
(348) Anti-viral compounds that may be used in combination with the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or pharmaceutically acceptable salts of the foregoing, disclosed herein include hepatitis B virus (HBV) inhibitors, hepatitis C virus (HCV) protease inhibitors, HCV polymerase inhibitors, HCV NS4A inhibitors, HCV NS5A inhibitors, HCV NS5b inhibitors, and human immunodeficiency virus (HIV) inhibitors. Such anti-viral compounds may be provided as a pharmaceutically acceptable salt, where appropriate.
(349) Antigens and adjuvants that may be used in combination with the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or the pharmaceutically acceptable salts of the foregoing, include B7 costimulatory molecule, interleukin-2, interferon-y, GM-CSF, CTLA-4 antagonists, OX-40/OX-40 ligand, CD40/CD40 ligand, sargramostim, levamisol, vaccinia virus, Bacille Calmette-Guerin (BCG), liposomes, alum, Freund's complete or incomplete adjuvant, detoxified endotoxins, mineral oils, surface active substances such as lipolecithin, pluronic polyols, polyanions, peptides, and oil or hydrocarbon emulsions. Adjuvants, such as aluminum hydroxide or aluminum phosphate, can be added to increase the ability of the vaccine to trigger, enhance, or prolong an immune response. Additional materials, such as cytokines, chemokines, and bacterial nucleic acid sequences, like CpG, a toll-like receptor (TLR) 9 agonist as well as additional agonists for TLR 2, TLR 4, TLR 5, TLR 7, TLR 8, TLR9, including lipoprotein, LPS, monophosphoryllipid A, lipoteichoic acid, imiquimod, resiquimod, and in addition retinoic acid-inducible gene I (RIG-I) agonists such as poly I:C, used separately or in combination with the described compositions are also potential adjuvants. Such antigens and anjuvants may be provided as a pharmaceutically acceptable salt, where appropriate.
(350) CLTA-4 and PD-1 pathways are important negative regulators of immune response. Activated T-cells up-regulate CTLA-4, which binds on antigen-presenting cells and inhibits T-cell stimulation, IL-2 gene expression, and T-cell proliferation; these anti-tumor effects have been observed in mouse models of colon carcinoma, metastatic prostate cancer, and metastatic melanoma. PD-1 binds to active T-cells and suppresses T-cell activation; PD-1 antagonists have demonstrated anti-tumor effects as well. CTLA-4 and PD-1 pathway antagonists that may be used in combination with the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or the pharmaceutically acceptable salts of the foregoing, disclosed herein, include ipilimumab, tremelimumab, nivolumab, pembrolizumab, CT-011, AMP-224, and MDX-1106.
(351) PD-1 antagonist or PD-1 pathway antagonist means any chemical compound or biological molecule that blocks binding of PD-L1 expressed on a cancer cell to PD-1 expressed on an immune cell (T-cell, B-cell, or NKT-cell) and preferably also blocks binding of PD-L2 expressed on a cancer cell to the immune-cell expressed PD-1. Alternative names or synonyms for PD-1 and its ligands include: PDCD1, PD1, CD279, and SLEB2 for PD-1; PDCD1L1, PDL1, B7H1, B7-4, CD274, and B7-H for PD-L1; and PDCD1L2, PDL2, B7-DC, Btdc, and CD273 for PD-L2. In any of the treatment method, medicaments and uses of the present disclosure in which a human individual is being treated, the PD-1 antagonist blocks binding of human PD-L1 to human PD-1, and preferably blocks binding of both human PD-L1 and PD-L2 to human PD-1. Human PD-1 amino acid sequences can be found in NCBI Locus No.: NP_005009. Human PD-L1 and PD-L2 amino acid sequences can be found in NCBI Locus No.: NP_054862 and NP_079515, respectively.
(352) PD-1 antagonists useful in any of the treatment method, medicaments and uses of the present disclosure include a monoclonal antibody (mAb), or antigen binding fragment thereof, which specifically binds to PD-1 or PD-L1, and preferably specifically binds to human PD-1 or human PD-L1. The mAb may be a human antibody, a humanized antibody, or a chimeric antibody and may include a human constant region. In some embodiments, the human constant region is selected from the group consisting of IgG1, IgG2, IgG3, and IgG4 constant regions, and in preferred embodiments, the human constant region is an IgG1 or IgG4 constant region. In some embodiments, the antigen binding fragment is selected from the group consisting of Fab, Fab-SH, F(ab).sub.2, scFv, and Fv fragments.
(353) Examples of mAbs that bind to human PD-1, and useful in the treatment method, medicaments and uses of the present disclosure, are described in U.S. Pat. Nos. 7,488,802, 7,521,051, 8,008,449, 8,354,509, and 8,168,757, PCT International Patent Application Publication Nos. WO2004/004771, WO2004/072286, and WO2004/056875, and U.S. Patent Application Publication No. US2011/0271358.
(354) Examples of mAbs that bind to human PD-L1, and useful in the treatment method, medicaments and uses of the present disclosure, are described in PCT International Patent Application Nos. WO2013/019906 and WO2010/077634 A1 and in U.S. Pat. No. 8,383,796. Specific anti-human PD-L1 mAbs useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present disclosure include MPDL3280A, BMS-936559, MEDI4736, MSB0010718C, and an antibody that comprises the heavy chain and light chain variable regions of SEQ ID NO:24 and SEQ ID NO:21, respectively, of WO2013/019906.
(355) Other PD-1 antagonists useful in any of the treatment method, medicaments, and uses of the present disclosure include an immune-adhesion that specifically binds to PD-1 or PD-L1, and preferably specifically binds to human PD-1 or human PD-L1, e.g., a fusion protein containing the extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region such as an Fc region of an immunoglobulin molecule. Examples of immune-adhesion molecules that specifically bind to PD-1 are described in PCT International Patent Application Publication Nos. WO2010/027827 and WO2011/066342. Specific fusion proteins useful as the PD-1 antagonist in the treatment method, medicaments, and uses of the present disclosure include AMP-224 (also known as B7-DCIg), which is a PD-L2-FC fusion protein and binds to human PD-1.
(356) The disclosure further relates to a method of treating cancer in a human patient comprising administration of a compound disclosed herein (i.e., a compound of general formula (I), a compound of general formula (II), a compound of general formula (III), a compound of general formula (IV), a compound of general formula (V), a compound of general formula (VI), or a pharmaceutically acceptable salt of the foregoing) and a PD-1 antagonist to the patient. The compound of the disclosure and the PD-1 antagonist may be administered concurrently or sequentially.
(357) In particular embodiments, the PD-1 antagonist is an anti-PD-1 antibody, or antigen binding fragment thereof. In alternative embodiments, the PD-1 antagonist is an anti-PD-L1 antibody, or antigen binding fragment thereof. In some embodiments, the PD-1 antagonist is pembrolizumab (KEYTRUDA, Merck & Co., Inc., Kenilworth, N.J., USA), nivolumab (OPDIVO, Bristol-Myers Squibb Company, Princeton, N.J., USA), cemiplimab (LIBTAYO, Regeneron Pharmaceuticals, Inc., Tarrytown, N.Y., USA), atezolizumab (TECENTRIQ, Genentech, San Francisco, Calif., USA), durvalumab (IMFINZI, AstraZeneca Pharmaceuticals LP, Wilmington, Del.), or avelumab (BAVENCIO, Merck KGaA, Darmstadt, Germany).
(358) In some embodiments, the PD-1 antagonist is pembrolizumab. In particular sub-embodiments, the method comprises administering 200 mg of pembrolizumab to the patient about every three weeks. In other sub-embodiments, the method comprises administering 400 mg of pembrolizumab to the patient about every six weeks.
(359) In further sub-embodiments, the method comprises administering 2 mg/kg of pembrolizumab to the patient about every three weeks. In particular sub-embodiments, the patient is a pediatric patient.
(360) In some embodiments, the PD-1 antagonist is nivolumab. In particular sub-embodiments, the method comprises administering 240 mg of nivolumab to the patient about every two weeks. In other sub-embodiments, the method comprises administering 480 mg of nivolumab to the patient about every four weeks.
(361) In some embodiments, the PD-1 antagonist is cemiplimab. In particular embodiments, the method comprises administering 350 mg of cemiplimab to the patient about every 3 weeks.
(362) In some embodiments, the PD-1 antagonist is atezolizumab. In particular sub-embodiments, the method comprises administering 1200 mg of atezolizumab to the patient about every three weeks.
(363) In some embodiments, the PD-1 antagonist is durvalumab. In particular sub-embodiments, the method comprises administering 10 mg/kg of durvalumab to the patient about every two weeks.
(364) In some embodiments, the PD-1 antagonist is avelumab. In particular sub-embodiments, the method comprises administering 800 mg of avelumab to the patient about every two weeks.
(365) Examples of cytotoxic agents that may be used in combination with the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or pharmaceutically acceptable salts of the foregoing, include, but are not limited to, arsenic trioxide (sold under the tradename T
(366) Chemotherapeutic agents that may be used in combination with the compounds of general formula (I), compounds of general formula (II), compounds of general formula (III), compounds of general formula (IV), compounds of general formula (V), compounds of general formula (VI), or pharmaceutically acceptable salts of the foregoing, disclosed herein include abiraterone acetate, altretamine, anhydrovinblastine, auristatin, bexarotene, bicalutamide, BMS 184476, 2,3,4,5,6-pentafluoro-N-(3-fluoro-4-methoxyphenyl) benzene sulfonamide, bleomycin, N,N-dimethyl-L-valyl-L-valyl-N-methyl-L-valyl-L-prolyl-1-Lproline-t-butylamide, cachectin, cemadotin, chlorambucil, cyclophosphamide, 3,4-didehydro-4deoxy-8-norvin-caleukoblastine, docetaxol, doxetaxel, cyclophosphamide, carboplatin, carmustine, cisplatin, cryptophycin, cyclophosphamide, cytarabine, dacarbazine (DTIC), dactinomycin, daunorubicin, decitabine dolastatin, doxorubicin (adriamycin), etoposide, 5-fluorouracil, finasteride, flutamide, hydroxyurea and hydroxyurea andtaxanes, ifosfamide, liarozole, lonidamine, lomustine (CCNU), MDV3100, mechlorethamine (nitrogen mustard), melphalan, mivobulin isethionate, rhizoxin, sertenef, streptozocin, mitomycin, methotrexate, taxanes, nilutamide, nivolumab, onapristone, paclitaxel, pembrolizumab, prednimustine, procarbazine, RPR109881, stramustine phosphate, tamoxifen, tasonermin, taxol, tretinoin, vinblastine, vincristine, vindesine sulfate, and vinflunine. Such chemotherapeutic agents may be provided as a pharmaceutically acceptable salt, where appropriate.
(367) Examples of vascular endothelial growth factor (VEGF) receptor inhibitors include, but are not limited to, bevacizumab (sold under the trademark AVASTIN), axitinib (described in PCT International Patent Publication No. WO01/002369), Brivanib Alaninate ((S)((R)-1-(4-(4-Fluoro-2-methyl-1H-indol-5-yloxy)-5-methylpyrrolo[2,1-f][1,2,4]triazin-6-yloxy) propan-2-yl).sub.2-aminopropanoate, also known as BMS-582664), motesanib (N-(2,3-dihydro-3,3-dimethyl-1H-indol-6-yl)-2-[(4-pyridinylmethyl)amino]-3-pyridinecarboxamide. and described in PCT International Patent Application Publication No. WO02/068470), pasireotide (also known as SO 230, and described in PCT International Patent Publication No. WO02/010192), and sorafenib (sold under the tradename NEXAVAR). Such inhibitors may be provided as a pharmaceutically acceptable salt, where appropriate.
(368) Examples of topoisomerase II inhibitors, include but are not limited to, etoposide (also known as VP-16 and Etoposide phosphate, sold under the tradenames TOPOSAR, VEPESID, and ETOPOPHOS), and teniposide (also known as VM-26, sold under the tradename VUMON). Such inhibitors may be provided as a pharmaceutically acceptable salt, where appropriate.
(369) Examples of alkylating agents, include but are not limited to, 5-azacytidine (sold under the trade name VIDAZA), decitabine (sold under the trade name of DECOGEN), temozolomide (sold under the trade names TEMCAD, TEMODAR, and TEMODAL), dactinomycin (also known as actinomycin-D and sold under the tradename COSMEGEN), melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, sold under the tradename ALKERAN), altretamine (also known as hexamethylmelamine (HMM), sold under the tradename HEXALEN), carmustine (sold under the tradename BCNU), bendamustine (sold under the tradename TREANDA), busulfan (sold under the tradenames B
(370) Examples of anti-tumor antibiotics include, but are not limited to, doxorubicin (sold under the tradenames A
(371) Examples of anti-metabolites include, but are not limited to, claribine (2-chlorodeoxyadenosine, sold under the tradename L
(372) Examples of retinoids include, but are not limited to, alitretinoin (sold under the tradename P
(373) Activity: STING Biochemical [3H]cGAMP Competition Assay
(374) The individual compounds described in the Examples herein are defined as STING agonists by (i) binding to the STING protein as evidenced by a reduction in binding of tritiated cGAMP ligand to the STING protein by at least 20% at 20 uM (concentration of compound being tested) in a STING Biochemical [3H]cGAMP Competition Assay and/or (ii) demonstrating interferon production with a 6% or greater induction of IFN-3 secretion at 30 uM in the THP1 cell assay (where induction caused by cGAMP at 30 uM was set at 100%).
(375) The ability of compounds to bind STING is quantified by the ability to compete with tritiated cGAMP ligand for human STING receptor membrane using a radioactive filter-binding assay. The binding assay employs STING receptor obtained from Hi-Five cell membranes overexpressing full-length HAQ STING prepared in-house and tritiated cGAMP ligand also purified in-house.
(376) The following experimental procedures detail the preparation of specific examples of the instant disclosure. The compounds of the examples are drawn in their neutral forms in the procedures and tables below. In some cases, the compounds were isolated as salts depending on the method used for their final purification and/or intrinsic molecular properties. The examples are for illustrative purposes only and are not intended to limit the scope of the instant disclosure in any way.
EXAMPLES
Abbreviations
(377) 2,3cGAMP, cGAMP 2,3-cyclic guanosine monophosphate-adenosine monophosphate 18-Crown-6 1,4,7,10,13,16-hexaoxacyclooctadecane Ac Acetyl ACN, MeCN Acetonitrile AcOH, HOAc Acetic acid AMP Adenosine monophosphate aq Aqueous ATP Adenosine 5-triphosphate BIIC Baculovirus Infected Insect Cell br Broad Bu Butyl, C.sub.4H.sub.9 cat Catalog number CBZ Benzyl chlorocarbonate CD.sub.3OD Deuterium-enriched methyl alcohol, deuterium-enriched methanol CDCl.sub.3 Deuterated trichloromethane, deuterated chloroform CDI Carbonyl diimidazole cGAMP Cyclic GMP-AMP synthase Ci Curie, a non-standard unit of radioactivity; 1 Ci=3.710.sup.10Bq, where Bq is Becquerel, the SI unit of radioactivity, equivalent to 1 disintegration per second (dps) C-Phos Pd G3 [(2-Dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-amino-1,1-biphenyl)] palladium(II) methanesulfonate C-Phos Pd G4 2-Aminobiphenylpalladium methanesulfonate palladium CPhos precatalyst (4.sup.th generation precatalyst); [(2-Dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-methylamino-1,1-biphenyl)] palladium(II) methanesulfonate Cy Cyclohexyl d Doublet DBU 1,8-Diazabicyclo[5.4.0]undec-7-ene DCE 1,2-Dichloroethane DCM, CH.sub.2Cl.sub.2 Dichloromethane ddd Doublet of doublet of doublet ddt Doublet of doublet of triplet DIAD Diisopropyl azodicarboxylate DIPEA N,N-Diisopropylethylamine DMA Dimethylacetamide DMAP 4-dimethylaminopyridine DME Dimethylether DMEA N,N-dimethyl ethyl amine DMF N,N-dimethylformamide DMPU 1,3-Dimethyl-3,4,5,6-tetrahydro-2-pyrimidinone DMSO Dimethylsulfoxide DMTr 4,4-dimethoxytrityl DMTrCl 4,4-dimethoxytrityl chloride dq Doublet of quartet EC.sub.50 half maximal effective concentration; concentration of a drug, antibody, or toxicant that induces a response halfway between the baseline and maximum after a specified exposure time EDC Ethylene dichloride eq Equivalents ES Electron spray Et Ethyl, C.sub.2H.sub.5 GMP Guanosine 5-monophosphate Grubbs catalyst 2G (1,3-Bis(2,4,6-trimethylphenyl)-2-imidazolidinylidene)dichloro (phenylmethyl ene)(tricyclohexylphosphine)ruthenium; Benzylidene[1,3-bis(2,4,6-trimethylphenyl)-2-imidazolidinylidene]dichloro(tricyclohexylphosphine)ruthenium; Dichloro[1,3-bis(2,4,6-trimethylphenyl)-2-imidazolidinylidene](benzylidene) (tricyclohexylphosphine)ruthenium(II) GTP Guanosine 5-triphosphate h Hour HAQ STING Common STING variant containing the three mutations R71H-G230A-R293Q (DNA construct used herein: STING(1-379)R71H, G230A,H232R,R293Q-GG-AviTag-GS-HRV3C-HIS8/pBAC1) HEPES 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid, a zwitterionic organic chemical buffering agent hept Heptet Hex Hexanes HPLC High performance liquid chromatography IC.sub.50 half maximal inhibitory concentration; concentration of a drug, antibody, or toxicant required for 50% inhibition of response or binding Inh Inhibition IPA Isopropyl alcohol, CH.sub.3CHOHCH.sub.3 LAH Lithium aluminum hydride Lawesson's reagent 2,4-Bis(4-methoxyphenyl)-1,3,2,4-dithiadiphosphetane-2,4-dithione LCMS Liquid chromatography-mass spectroscopy LDA Lithium di-isopropyl amide m Multiplet M Molar, moles per liter m/z Mass-to-charge ratio M+H Protonated mass, mass measurement produced by mass spectrometry Me Methyl, CH.sub.3 min Minute(s) MOI Multiplicity of infection MOM-Cl Cloromethyl methyl ether MP-TsOH para-Tolune sulfonated macroporous polystyrene resin n-BuLi n-Butyl lithium NBS N-Bromosuccinamide NCS N-Chlorosuccinamide NMP N-methyl-2-pyrrolidone OXONE Potassium peroxymonosulfate, specifically 2KHSO.sub.5KHSO.sub.4K.sub.2SO.sub.4 Pd/C Palladium on carbon PdCl.sub.2(dppf)-CH.sub.2C.sub.2[1,1-Bis(diphenylphosphino)ferrocene]dichloropalladiumn(II), complex with dichloromethane Pd(Ph.sub.3P).sub.4 Tetrakis(triphenyl phosphine) palladium(0) Pd.sub.2(dba).sub.3 Tris(dibenzylidene acetone) dipalladium(0) PE Petroleum ether pfu Plaque-forming unit Ph.sub.3P Triphenyl phosphine prep-HPLC Preparative high performance liquid chromatography prep-TLC Preparative thin layer liquid chromatography PS-TPP Polymer-supported triphenylphospine PSI Pounds per square inch pTsOH para-Tolunesulfonic acid Py, py Pyridine q Quartet Rac, rac Racemic Rac BINAP Pd G3 2-(2-aminophenyl)benzen-1-ide methanesulfonic acid {1-[2-(diphenyl-phosphanyl)naphthalen-1-yl]naphthalen-2-yl}diphenylphosphane palladium RockPhos Pd G3 [(2-Di-tert-butylphosphino-3-methoxy-6-methyl-2,4,6-triisopropyl-1,1-biphenyl)-2-(2-aminobiphenyl)]palladium(II) methanesulfonate RP-HPLC Reverse-phase high performance liquid chromatography RPM, rpm Revolutions per minute RT, rt Room temperature, approximately 25 C. s Singlet sat Saturated SFC Supercritical fluid chromatography t Triplet TBAF, nBu.sub.4NF Tetra-n-Butylammonium fluoride TBS, TBDMS tert-Butyldimethylsilyl TBTU 2-(1H-Benzotriazole-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate TEA Triethylamine TFA Trifluoroacetic acid THF Tetrahydrofuran TLC Thin layer chromatography TMS Trimethylsilyl T.sub.R Retention time TrisCl Tris(hydroxymethyl)aminomethane hydrochloride v/v Volume/volume WT STING Wild type (most abundant) variant of STING in humans (DNA construct used herein: STING(1-379)H232R-gg-AviTag-gs-HRV3C-HIS8/pBAC1) X-Phos 2-Dicyclohexylphosphino-2,4,6-triisopropylbiphenyl Xantphos 4,5-Bis(diphenylphosphino)-9,9-dimethylxanthene .sub.em Emission wavelength .sub.ex Excitation wavelength
Preparation 1: Magnesium 3-(tert-butoxy)-3-oxopropanoate
(378) ##STR00145##
(379) Magnesium ethanolate (3.57 g, 31.2 mmol) was added to a mixture of 3-(tert-butoxy)-3-oxopropanoic acid (10.0 g, 62.4 mmol) in THF (100 mL) at 20 C. The reaction mixture was stirred at 20 C. for 18 h under Ar. The reaction mixture was then concentrated under reduced pressure. The residue was dried under reduced pressure to afford magnesium 3-(tert-butoxy)-3-oxopropanoate. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 2.96 (s, 4H), 1.39 (s, 18H).
Preparation 2: tert-Butyl 3-(2,3-dimethoxythieno[2,3-b]pyrazin-6-yl)-3-oxopropanoate
(380) ##STR00146##
Step 1: 3-Bromo-5,6-dimethoxypyrazine-2-carbaldehyde
(381) ##STR00147##
(382) To a solution of 2,2,6,6-tetramethylpiperidine (5.12 mL, 30.1 mmol) in THF (40 mL) at 78 C. was added dropwise a solution of n-BuLi (2.5M in Hex, 11.5 mL, 28.8 mmol). The reaction mixture was stirred for 10 min at 78 C. and then warmed to 0 C. and stirred for 20 min. The reaction mixture was then cooled back to 78 C., and a solution of 5-bromo-2,3-dimethoxypyrazine (3.00 g, 13.7 mmol) in THF (10 mL) was added over 5 min. The reaction mixture was stirred at 78 C. for 1 h and then quenched with DMF (1.06 mL, 13.7 mmol). The reaction mixture was warmed to 0 C. and stirred for an additional 20 min. AcOH (3.0 mL) was added at 0 C., and the reaction mixture was warmed to RT and stirred overnight. The mixture was diluted with EtOAc (300 mL) and then washed with H.sub.2O (2150 mL) and sat aq NaCl. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting EtOAc in Hex) to afford 3-bromo-5,6-dimethoxypyrazine-2-carbaldehyde. LCMS (C.sub.7H.sub.8BrN.sub.2O.sub.3) (ES, m/z): 247, 249 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 10.19 (s, 1H), 4.17 (s, 3H), 4.14 (s, 3H).
Step 2: tert-Butyl 2,3-dimethoxythieno[2,3-b]pyrazine-6-carboxylate
(383) ##STR00148##
(384) tert-Butyl 2-sulfanylacetate (424 L, 2.92 mmol) and DMF (2.9 mL) were added to 3-bromo-5,6-dimethoxypyrazine-2-carbaldehyde (650 mg, 2.63 mmol) at RT. K.sub.2CO.sub.3 (1090 mg, 7.89 mmol) was then added portion-wise to the reaction mixture at RT. The reaction mixture was heated to 80 C. and stirred overnight. The reaction mixture was then cooled to RT, diluted with Et.sub.2O, and quenched with H.sub.2O. The reaction mixture was extracted with Et.sub.2O, and the combined organics were washed with sat aq NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting EtOAc in Hex) to yield tert-butyl 2,3-dimethoxythieno[2,3-b]pyrazine-6-carboxylate. LCMS (C.sub.13H.sub.17N.sub.2O.sub.4S) (ES, m/z): 297 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 7.89 (s, 1H), 4.02 (s, 3H), 3.99 (s, 3H), 1.55 (s, 9H).
Step 3: 2,3-Dimethoxthieno[2,3-b]pyrazine-6-carboxylic acid
(385) ##STR00149##
(386) To a stirred solution of tert-butyl 2,3-dimethoxythieno[2,3-b]pyrazine-6-carboxylate (400 mg, 1.35 mmol) in DCM (6.0 mL) was added HCl (4.0M in dioxane, 1.7 mL, 6.8 mmol) at RT. The reaction mixture was stirred overnight at RT, and then diluted by the dropwise addition of Hex (50 mL) and stirred for 1 h at RT. The reaction mixture was filtered, and the collected materials were washed with Hex (210 mL) and dried under reduced pressure to afford 2,3-dimethoxythieno[2,3-b]pyrazine-6-carboxylic acid. LCMS (C.sub.9H.sub.9N.sub.2O.sub.4S) (ES, m/z): 241 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.71 (br s, 1H), 7.90 (s, 1H), 4.03 (s, 3H), 3.99 (s, 3H).
Step 4: tert-Butyl 3-(2,3-dimethoxythieno[2,3-b]pyrazin-6-yl)-3-oxopropanoate
(387) ##STR00150##
(388) A mixture of 2,3-dimethoxythieno[2,3-b]pyrazine-6-carboxylic acid (80 mg, 0.33 mmol) and CDI (324 mg, 2.00 mmol) in THF (5.5 mL) was stirred at RT for 3 h. Magnesium bis(3-tert-butoxy-3-oxopropanoate) (628 mg, 1.83 mmol) was added to the mixture, and the resulting mixture was stirred overnight at RT. The reaction mixture was concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting (25% EtOH in EtOAc) in Hex) to afford tert-butyl 3-(2,3-dimethoxythieno[2,3-b]pyrazin-6-yl)-3-oxopropanoate. LCMS (C.sub.15H.sub.19N.sub.2O.sub.5S) (ES, m/z): 339 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.32 (s, 1H), 4.13 (s, 2H), 4.04 (s, 3H), 4.00 (s, 3H), 1.41 (s, 9H).
Preparation 3: 5,6-Dimethoxythieno[3,2-b]pyridine-2-carboxylic acid
(389) ##STR00151##
Step 1: tert-Butyl 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylate
(390) ##STR00152##
(391) K.sub.2CO.sub.3 (1180 mg, 8.56 mmol) was added to a mixture of 3-chloro-5,6-dimethoxypicolinaldehyde (575 mg, 2.86 mmol) and tert-butyl 2-sulfanylacetate (0.456 mL, 3.14 mmol) in DMF (8.3 mL) at RT. The reaction mixture was stirred and heated to 60 C. for 3 days. The reaction mixture was cooled to RT, and then diluted with Et.sub.2O and H.sub.2O. The organic layer was separated, washed with sat aq NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting EtOAc in Hex) to afford tert-butyl 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylate. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 7.95 (s, 1H), 7.84 (s, 1H), 3.93 (s, 3H), 3.87 (s, 3H), 1.54 (s, 9H).
Step 2: 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylic acid
(392) ##STR00153##
(393) HCl (4.0M in H.sub.2O, 2.1 mL, 8.4 mmol) was added to a solution of tert-butyl 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylate (493 mg, 1.67 mmol) in DCM (7.4 mL) at RT. The reaction mixture was stirred overnight at RT, and then diluted by the dropwise addition of Hex (50 mL). The mixture was stirred for 1 h and then filtered. The collected materials were washed with Hex (210 mL) and then dried under reduced pressure to afford 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylic acid. LCMS (C.sub.10H.sub.10NO.sub.4S) (ES, m/z): 240 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 7.97 (s, 1H), 7.85 (s, 1H), 3.95 (s, 3H), 3.88 (s, 3H).
Preparation 4: tert-Butyl 3-(5,6-dimethoxythieno[3,2-b]pyridin-2-yl)-3-oxopropanoate
(394) ##STR00154##
(395) CDI (508 mg, 3.13 mmol) was added to a mixture of 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylic acid (500 mg, 2.09 mmol) in THF (5 mL). The reaction mixture was stirred at RT for 3 h. The reaction mixture was added to a separate flask containing magnesium 3-(tert-butoxy)-3-oxopropanoate (1220 mg, 3.55 mmol). The reaction mixture was diluted with additional THF (4 mL) and was stirred overnight at RT. The reaction mixture was then heated to 50 C. for 1 h. The reaction mixture was cooled to RT and diluted with H.sub.2O (20 mL). Sodium citrate tribasic dihydrate (2 g) and EtOAc (50 mL) were added. The organic layer was separated, and the aqueous layer was extracted with EtOAc. The organic layers were combined, washed with sat aq NaCl, dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified via silica gel chromatography (eluting EtOAc in Hex) to afford tert-butyl 3-(5,6-dimethoxythieno[3,2-b]pyridin-2-yl)-3-oxopropanoate. LCMS (C.sub.16H.sub.20NO.sub.5S) (ES, m/z): 338 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.97 (s, 1H), 7.44 (s, 1H), 4.13 (s, 3H), 3.99 (s, 3H), 3.92 (s, 2H), 1.48 (s, 9H).
Preparation 5: C-Phos Pd G4
(396) ##STR00155##
(397) A mixture of (2-methylamino-1,1-biphenyl-2-yl)methanesulfonatopalladium (II) dimer (439 mg, 0.573 mmol) and 2-(dicyclohexylphosphino)-N2,N2,N6,N6-tetramethyl-[1,1-biphenyl]-2,6-diamine (500 mg, 1.15 mmol) in DCM (6 mL) was stirred at RT for 2 h. The solution was then diluted with Et.sub.2O (30 mL). The solution was filtered and concentrated under reduced pressure. The residue was then slurried in pentanes and again concentrated under reduced pressure to afford C-Phos Pd G4. See Bruno, N. C.; Niljianskul, N.; Buchwald, S. L. J. Org. Chem. 2014, 79, 4161.
Intermediate 1: methyl (S)-4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate
(398) ##STR00156##
Step 1: 5-Chloro-6-methoxythieno[3,2-b]pyridine-2-carbonyl chloride
(399) ##STR00157##
(400) POCl.sub.3 (1.17 mL, 12.5 mmol) was added dropwise to a stirred mixture of 5,6-dimethoxythieno[3,2-b]pyridine-2-carboxylic acid (1.00 g, 4.1 mmol) in DMF (10.45 ml) at 0 C. under N.sub.2. After 10 min, the reaction mixture was allowed to warm to RT. The reaction mixture was then heated to 100 C. and stirred for 45 min. The reaction mixture was added ice water (100 mL) and stirred. The mixture was filtered, and the collected materials were washed with water (230 mL) and Hex (50 mL). The collected materials were diluted with Et.sub.2O (50 mL) and filtered. The collected materials were dissolved in CH.sub.2Cl.sub.2 (60 mL), and the mixture was dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford 5-chloro-6-methoxythieno[3,2-b]pyridine-2-carbonyl chloride. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.32 (s, 1H), 7.60 (s, 1H), 4.06 (s, 3H).
Step 2: Methyl (S)-4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate
(401) ##STR00158##
(402) CuI (0.073 g, 0.38 mmol) was placed under vacuum and heated for 1 min with a heat gun. The flask was allowed to cool to RT and was then opened to N.sub.2. Twice more the flask was evacuated then backfilled with N.sub.2. The flask was kept under positive N.sub.2 pressure with a rubber septum and N.sub.2 inlet attached. THF (2 mL) was added to the flask, and the reaction mixture was cooled in an ice water bath. A solution of (R)-(3-methoxy-2-methyl-3-oxopropyl) zinc(II) bromide in THF (0.50M, 1.68 mL, 0.84 mmol) was added dropwise to the reaction mixture over a period of 5 min. The reaction mixture was stirred for 105 min at 0 C. A mixture of 5-chloro-6-methoxythieno[3,2-b]pyridine-2-carbonyl chloride (0.200 g, 0.763 mmol) in NMP (3 mL) was then added dropwise over 5 min. The reaction mixture was then stirred for 3 h at 0 C. The reaction mixture was then added to a stirred mixture of isopropyl acetate (50 mL) and sodium citrate (20% w/v in water, 50 mL). After stirring for 20 min, the layers were separated, and the aqueous layer was extracted with isopropyl acetate (30 mL). The organic layers were combined, washed with sat aq NaCl (250 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting EtOAc in Hex) to afford (S)-methyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.15ClNO.sub.4S) (ES, m/z): 328 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.99 (s, 1H), 7.60 (s, 1H), 4.03 (s, 3H), 3.72 (s, 3H), 3.51 (dd, J=17.2, 7.9 Hz, 1H), 3.21-3.12 (m, 1H), 3.06 (dd, J=17.2, 5.2 Hz, 1H), 1.32 (d, J=7.1 Hz, 3H).
Intermediate 2: tert-Butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(403) ##STR00159##
Step 1: tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(404) ##STR00160##
(405) tert-Butyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (1.75 g, 4.38 mmol; 81% pure) and C-Phos Pd G3 (0.177 g, 0.219 mmol) were added to a 40 mL vial with a septum-containing screw cap. The vial was evacuated and backfilled with N.sub.2 three times. THF (15.7 mL) was added to the vial under N.sub.2 with stirring. While stirring the resulting suspension at RT, (3-((tert-butyldimethyl silyl)oxy)propyl)zinc(II) bromide (0.50M in THF, 17.5 mL, 8.75 mmol) was added dropwise with stirring. The mixture was stirred at RT for 18 h. The reaction was then partitioned between EtOAc (75 mL) and 10% aq sodium citrate (75 mL) and stirred vigorously for 5 min. The layers were separated, and the aqueous layer was extracted with EtOAc (20 mL). The organic layers were combined, washed with sat aq NaCl (50 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0.fwdarw.40% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.26H.sub.40NaO.sub.5SSi) (ES, m/z): 515 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.89 (s, 1H), 7.62 (s, 1H), 7.24 (s, 1H), 3.92 (s, 3H), 3.67 (t, J=6.3 Hz, 2H), 3.28 (t, J=6.8 Hz, 2H), 2.76 (t, J=7.2 Hz, 2H), 2.72 (t, J=7.2 Hz, 2H), 1.85 (p, J=6.5 Hz, 2H), 1.46 (s, 9H), 0.94 (s, 9H), 0.08 (s, 6H).
Step 2: tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(406) ##STR00161##
(407) To a mixture of tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (1.45 g, 2.94 mmol) in MeOH (5.0 mL) was added water (5.0 mL) and HOAc (5.0 mL). The resulting suspension was stirred at RT for 18 h. The reaction was partitioned between EtOAc and aq NaCl. The layers were separated, and the aqueous layer was extracted with EtOAc. The organic layers were combined, washed with sat aq NaCl twice, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to afford a crude residue. The resulting residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.20H.sub.26NaO.sub.5S) (ES, m/z): 401 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.89 (s, 1H), 7.64 (s, 1H), 7.26 (s, 1H), 3.94 (s, 3H), 3.68 (t, J=5.5 Hz, 2H), 3.28 (t, J=6.6 Hz, 2H), 2.82 (t, J=7.3 Hz, 2H), 2.72 (t, J=6.6 Hz, 2H), 1.96-1.83 (m, 2H), 1.46 (s, 9H).
Intermediate 3: tert-butyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(408) ##STR00162##
(409) Triphenylphosphine (0.24 g, 0.91 mmol) was added to a mixture of tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (0.22 g, 0.57 mmol) in THF (2.8 mL). The resulting mixture was cooled to 0 C., and NBS (0.15 g, 0.85 mmol) was added in a single portion. After stirring for 30 min at 0 C., the reaction was diluted with sat aq AlCl.sub.3 and EtOAc. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting product was then purified by silica gel chromatography to afford tert-butyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.18BrO.sub.4S) (ES, m/z): 385, 387 [M-C.sub.4Hs].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.27 (s, 1H), 7.78 (s, 1H), 7.62 (s, 1H), 3.90 (s, 3H), 3.60-3.49 (m, 2H), 3.30-3.21 (m, 2H), 2.88-2.75 (m, 2H), 2.67-2.56 (m, 2H), 2.18-2.06 (m, 2H), 1.38 (s, 9H).
Intermediate 4: 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile
(410) ##STR00163##
Step 1: methyl 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylate
(411) ##STR00164##
(412) Concentrated H.sub.2SO.sub.4 (3.0 mL, 56 mmol) was added to a suspension of 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylic acid (5.0 g, 17 mmol) in MeOH (60 mL). The reaction mixture was heated to 70 C. for 4.5 days. The mixture was then cooled to RT and diluted with water. To the mixture was added 30% IPA in CHCl.sub.3. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to afford methyl 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylate. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.30 (s, 1H), 8.09 (s, 1H), 7.83 (s, 1H), 3.95 (s, 3H), 3.88 (s, 3H).
Step 2: (5-bromo-6-methoxybenzo[b]thiophen-2-yl)methanol
(413) ##STR00165##
(414) LAH (1.0M in THF, 2.8 mL, 2.8 mmol) was slowly added to a mixture of methyl 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylate (0.78 g, 2.3 mmol) in THF (9.0 mL) at 0 C. After 40 min, the reaction mixture was diluted with sat aq AlCl.sub.3. EtOAc was added, and the organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting material was purified by silica gel chromatography to afford (5-bromo-6-methoxybenzo[b]thiophen-2-yl)methanol. LCMS (C.sub.10H.sub.8BrOS) (ES, m/z): 255, 257 [M-OH].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.01 (s, 1H), 7.69 (s, 1H), 7.14 (s, 1H), 5.69-5.59 (m, 1H), 4.73-4.64 (m, 2H), 3.89 (s, 3H).
Step 3: 5-bromo-6-methoxybenzo[b]thiophene-2-carbaldehyde
(415) ##STR00166##
(416) Manganese dioxide (6.3 g, 73 mmol) was added to a mixture of (5-bromo-6-methoxybenzo[b]thiophen-2-yl)methanol (4.0 g, 15 mmol) in DCM (97 mL). The reaction mixture was stirred at RT for 20 h then filtered through a plug of CELITE. The filtrate was concentrated under reduced pressure. The resulting product was triturated in MeOH and the mixture was passed through a glass frit to collect 5-bromo-6-methoxybenzo[b]thiophene-2-carbaldehyde. LCMS (C.sub.10H.sub.8BrO.sub.2S) (ES, m/z): 271, 273 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 10.07 (s, 1H), 8.40 (s, 1H), 8.29 (s, 1H), 7.87 (s, 1H), 3.97 (s, 3H).
Step 4: 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile
(417) ##STR00167##
(418) ACN (0.15 mL, 2.2 mmol) was added to a suspension of 5-bromo-6-methoxybenzo[b]thiophene-2-carbaldehyde (0.30 g, 1.1 mmol), 2-mesityl-2,5,6,7-tetrahydro-pyrrolo[2,1-c][1,2,4]triazol-4-ium chloride (0.029 g, 0.1 mmol) and K.sub.3PO.sub.4 (0.24 g, 1.1 mmol) in toluene (2.2 mL). The reaction mixture was placed under Ar and stirred at RT for 18 h. The reaction mixture was then concentrated under reduced pressure, and the resulting residue was purified by silica gel chromatography to afford 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile. LCMS (C.sub.13H.sub.11BrNO.sub.2S) (ES, m/z): 324, 326 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.33-8.22 (m, 2H), 7.84 (s, 1H), 3.96 (s, 3H), 3.59-3.44 (m, 2H), 2.88-2.73 (m, 2H).
Intermediate 5: ethyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(419) ##STR00168##
Step 1: 5-Bromo-2-fluoro-4-methoxybenzaldehyde
(420) ##STR00169##
(421) 2-Fluoro-4-methoxybenzaldehyde (9.0 g, 58 mmol) was added slowly (portion-wise) to a solution of Br.sub.2 (6.0 mL, 120 mmol) in MeOH (40 mL) at 0 C. The reaction mixture was stirred at 0 C. for 2 h. A solution of NaHSO.sub.3 (24.3 g, 234 mmol) in H.sub.2O (300 mL) was added slowly to the reaction mixture at 0 C. The resulting suspension was then stirred for 30 min at 0 C. The reaction mixture was filtered, and the filtrate was washed with additional H.sub.2O (325 mL). The filtrate was then dried under reduced pressure to afford 5-bromo-2-fluoro-4-methoxybenzaldehyde. The product was used without purification. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 10.02 (s, 1H), 7.98 (d, J=7.5 Hz, 1H), 7.26 (d, J=13.0 Hz, 1H), 3.97 (s, 3H).
Step 2: tert-Butyl 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylate
(422) ##STR00170##
(423) K.sub.2CO.sub.3 (19.0 g, 137 mmol) was added slowly (portion-wise) to a solution of 5-bromo-2-fluoro-4-methoxybenzaldehyde (10.7 g, 45.8 mmol) and tert-butyl 2-mercaptoacetate (6.65 mL, 45.8 mmol) in DMF (50 mL) at 20 C. under Ar. The reaction mixture was stirred and heated to 100 C. for 16 h. The reaction mixture was then cooled to RT and diluted with Et.sub.2O (1000 mL). The mixture was then washed with H.sub.2O (500 mL, then 2250 mL), and the combined aq layers were extracted with Et.sub.2O (2200 mL). The organic layers were then combined and washed with sat aq NaCl (50 mL). The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford tert-butyl 5-bromo-6-methoxybenzo [b]thiophene-2-carboxylate. The product was used without purification. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.26 (s, 1H), 7.96 (s, 1H), 7.78 (s, 1H), 3.92 (s, 3H), 1.55 (s, 9H).
Step 3: 5-Bromo-6-methoxybenzo[b]thiophene-2-carboxylic acid
(424) ##STR00171##
(425) HCl (56 mL, 4.0M in 1,4-dioxane, 230 mmol) was added to a solution of tert-butyl 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylate (15.5 g, 45.0 mmol) in DCM (200 mL) at 20 C. The reaction mixture was stirred at 20 C. for 3 days. The reaction mixture was then diluted by the dropwise addition of Hex (500 mL). The resulting suspension was stirred for an additional 2 h post-addition at RT. The reaction mixture was filtered, and the collected material was washed with Hex (250 mL) and dried under reduced pressure to afford 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylic acid, which was used without purification. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 13.42 (s, 1H), 8.26 (s, 1H), 7.98 (s, 1H), 7.80 (s, 1H), 3.93 (s, 3H).
Step 4: 5-Bromo-6-methoxybenzo[b]thiophene-2-carbonyl chloride
(426) ##STR00172##
(427) DMF (0.049 mL, 0.63 mmol) was added slowly (dropwise) to a solution of 5-bromo-6-methoxybenzo[b]thiophene-2-carboxylic acid (6.0 g, 21 mmol) and (COCl).sub.2 (5.5 mL, 63 mmol) in THF (100 mL) at 0 C. under Ar. The reaction mixture was stirred at 0 C. for 2 h and then allowed to warm to RT. The reaction mixture was stirred for 18 h at RT. The reaction mixture was then concentrated under reduced pressure to afford 5-bromo-6-methoxybenzo[b]thiophene-2-carbonyl chloride. The product was used without purification.
Step 5: Ethyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(428) ##STR00173##
(429) A solution of (3-ethoxy-3-oxopropyl)zinc(II) bromide (13.8 mL, 0.50M in THF, 6.9 mmol) was added to an oven-dried flask containing ((thiophene-2-carbonyl)oxy)copper (1.31 g, 6.87 mmol) under Ar at 0 C. The reaction mixture was stirred for 20 min at 0 C. under Ar. An Ar-degassed solution of 5-bromo-6-methoxybenzo[b]thiophene-2-carbonyl chloride (1.52 g, 4.98 mmol) in THF (25.0 mL) was then added via cannula to the reaction mixture at 0 C.; the resulting suspension was allowed to warm to RT and was stirred for 3 h. The reaction mixture was cooled to 0 C. and quenched with sat aq NH.sub.4Cl (50 mL). The mixture was allowed to warm to RT and stirred for 10 min. The mixture was filtered, and the filtrate was diluted with EtOAc (500 mL) and sat aq NaCl (50 mL). The organic layer was separated, washed with sat aq NaCl (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (EtOAc in DCM) to afford ethyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.15H.sub.16BrO.sub.4S) (ES, m/z): 371, 373 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.27 (s, 1H), 8.26 (s, 1H), 7.81 (s, 1H), 4.07-4.02 (m, 2H), 3.94 (s, 3H), 3.35-3.25 (m, 2H), 2.68-2.64 (m, 2H), 1.20-1.14 (m, 3H).
Intermediate 6: tert-butyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(430) ##STR00174##
(431) Intermediate 6 may be prepared according to procedures analogous to those outlined for Intermediate 5 above using the appropriate starting materials, described as Preparations or as obtained from commercially available sources.
Intermediate 7: Ethyl 4-(6-methoxy-5-(3-(4,4,5,5-t ethyl-1,3,2-dioxaborolan-2-yl)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(432) ##STR00175##
Step 1: Ethyl 4-(5-allyl-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(433) ##STR00176##
(434) To a vial containing ethyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (5.0 g, 13 mmol), Pd(Ph.sub.3P).sub.4 (1.6 g, 1.3 mmol), and dioxane (15 mL), was added allyltri-n-butyltin (5.4 mL, 18 mmol). The reaction was heated to 90 C. for 18 h. Upon cooling to RT, the mixture was diluted with DCM, filtered through CELITE and added to flask containing aq KF (0.5M, 200 mL). The mixture stirred, and the organic layer was then separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (0.fwdarw.30% EtOAc gradient in Hex) to afford ethyl 4-(5-allyl-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.18H.sub.21O.sub.4S) (ES, m/z): 333 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.23 (s, 1H), 7.69 (s, 1H), 7.58 (s, 1H), 5.96 (dq, J=15.9, 6.6 Hz, 1H), 5.04 (d, J=4.5 Hz, 1H), 5.02 (s, 1H), 4.01 (q, J=7.0 Hz, 2H), 3.85 (s, 3H), 3.37 (d, J=6.3 Hz, 2H), 3.27 (dd, J=11.0, 4.3 Hz, 2H), 2.62 (t, J=6.1 Hz, 2H), 1.13 (t, J=7.1 Hz, 3H).
Step 2: Ethyl 4-(6-methoxy-5-(3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(435) ##STR00177##
(436) To a mixture of 1,4-bis(diphenylphosphino)butane (0.45 g, 1.1 mmol), chloro(1,5-cyclooctadiene)iridium(i) dimer (0.35 g, 0.53 mmol), ethyl 4-(5-allyl-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (3.5 g, 11 mmol), and THF (20 mL) was added pinacolborane (1.0M in THF, 15.8 mL, 15.8 mmol). The reaction was stirred at RT for 4 h. The solvent was then removed under reduced pressure, and the residue was purified by silica gel column chromatography (0.fwdarw.20% EtOAc gradient in Hex) to afford ethyl 4-(6-methoxy-5-(3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.21 (s, 1H), 7.66 (s, 1H), 7.53 (s, 1H), 4.02 (q, J=7.0 Hz, 2H), 3.84 (s, 3H), 3.27 (t, J=6.2 Hz, 2H), 2.62 (t, J=6.1 Hz, 2H), 2.58 (t, J=7.4 Hz, 2H), 1.58 (p, J=7.4 Hz, 2H), 1.16-1.11 (m, 15H), 0.67 (t, J=7.6 Hz, 2H).
Intermediate 8: tert-Butyl 4-(6-(3-bromopropyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(437) ##STR00178##
Step 1: Methyl 6-bromo-5-methoxybenzo[b]thiophene-2-carboxylate
(438) ##STR00179##
(439) To a stirred solution of 4-bromo-2-fluoro-5-methoxybenzaldehyde (5.00 g, 21.5 mmol) in DMF (100 mL) was added methyl 2-mercaptoacetate (2.51 g, 23.6 mmol) and K.sub.2CO.sub.3 (8.90 g, 64.4 mmol). The reaction mixture was degassed with N.sub.2 3 times. The resulting mixture was then stirred at RT for 15 h. EtOAc (500 mL) and H.sub.2O (1200 mL) were added to the reaction mixture. The organic layer was separated and washed with sat aq NaCl (2200 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (EtOAc in PE) to give methyl 6-bromo-5-methoxybenzo [b]thiophene-2-carboxylate. LCMS (C.sub.11H.sub.10BrO.sub.3S) (ES, m/z): 301, 303 [M+H].sup.+. .sup.1H NMR (400 MHz, CDCl.sub.3): =8.01 (s, 1H), 7.93 (s, 1H), 7.26 (s, 1H), 3.96 (s, 3H), 3.94 (s, 3H).
Step 2: 6-Bromo-5-methoxybenzo[b]thiophene-2-carboxylic acid
(440) ##STR00180##
(441) To a suspension of methyl 6-bromo-5-methoxybenzo[b]thiophene-2-carboxylate (1.45 g, 4.81 mmol) in MeOH (20 mL), THF (20 mL), and H.sub.2O (20 mL) was added NaOH (1.93 g, 48.1 mmol). The resulting suspension was heated to 50 C. for 0.5 h. The reaction mixture was concentrated under reduced pressure to remove the solvent. H.sub.2O (200 mL) was added to the residue, and citric acid was added to adjust the solution to pH=6. The remaining aq suspension was extracted with EtOAc (350 mL). The combined organic layers were washed with sat aq NaCl (100 mL), dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to give 6-bromo-5-methoxybenzo[b]thiophene-2-carboxylic acid, which was used without further purification. .sup.1H NMR (400 MHz, DMSO-d.sub.6): =13.52 (br s, 1H), 8.35 (s, 1H), 8.01 (s, 1H), 7.65 (s, 1H), 3.90 (s, 3H).
Step 3: 6-Bromo-5-methoxybenzo[b]thiophene-2-carbonyl chloride
(442) ##STR00181##
(443) To a stirred solution of 6-bromo-5-methoxybenzo[b]thiophene-2-carboxylic acid (800 mg, 2.79 mmol) in anhydrous THF (6 mL) was added (COCl).sub.2 (1.06 g, 8.36 mmol) dropwise at 0 C. The mixture was then heated at 75 C. for 15 h and then cooled to RT. The solvent was removed under reduced pressure to give the crude 6-bromo-5-methoxybenzo[b]thiophene-2-carbonyl chloride, which was used without further purification.
Step 4: tert-Butyl 4-(6-bromo-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(444) ##STR00182##
(445) To a round bottom flask was added CuI (0.24 g, 2.4 mmol). The flask was evacuated and then opened to N.sub.2. This was repeated three times. THF (4.0 mL) was added and the mixture was cooled to 0 C. A mixture of (3-(tert-butoxy)-3-oxopropyl)zinc(II) bromide (0.50M in THF, 9.6 mL, 4.8 mmol) was added dropwise at 0 C. over 10 min. The resulting mixture was allowed to stir for 30 min. 6-bromo-5-methoxybenzo[b]thiophene-2-carbonyl chloride (0.73 g, 2.4 mmol) was added. The mixture was removed from the ice bath and allowed to warm to RT. The mixture was stirred for 2 h. The mixture was then cooled to 0 C., and concentrated NH.sub.4OH (4.5 mL) was added. To the resulting suspension was added water (240 mL) and MeOH (60 mL). The mixture was stirred for 5 min and sonicated in a bath sonicator. The mixture was then diluted with EtOAc, and the organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The crude product residue was purified by silica gel chromatography to afford tert-butyl 4-(6-bromo-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.17H.sub.19BrO.sub.4S) (ES, m/z): 421, 423 [M+Na].sup.+.
Step 5: tert-Butyl 4-(6-(3-((tert-butyldimethylsilyl)oxy)propyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(446) ##STR00183##
(447) To a flask containing tert-butyl 4-(6-bromo-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (0.16 g, 0.40 mmol) and THF (2.0 mL) was added [(2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-amino-1,1-biphenyl)] palladium(II) methane sulfonate (C-Phos Pd G3, 16 mg, 0.020 mmol). The flask was evacuated and backfilled 3 times with N.sub.2. (3-((tert-butyldimethylsilyl)oxy)propyl)zinc(II) bromide (0.50M in THF, 2.4 mL, 1.2 mmol) was added, and the mixture was allowed to stir at RT for 2.5 h. The mixture was then quenched with a mixture of EtOAc and 10% aqueous sodium citrate. The organic layer was separated, washed with sat aq NaCl, dried over MgSO.sub.4, filtered and concentrated under reduced pressure. The crude residue was purified by silica gel chromatography to afford tert-butyl 4-(6-(3-((tert-butyldimethylsilyl)oxy)propyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.26H.sub.41O.sub.5SSi-C.sub.4H.sub.8) (ES, m/z): 437 [M-C.sub.4Hs].sup.+.
Step 6: tert-Butyl 4-(6-(3-hydroxypropyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(448) ##STR00184##
(449) To a flask containing tert-butyl 4-(6-(3-((tert-butyldimethylsilyl)oxy)propyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (0.11 g, 0.23 mmol) was added MeOH (1.5 mL), water (1.5 mL) and HOAc (1.5 mL). The mixture was allowed to stir for 4 h. The mixture was diluted with EtOAc and then washed with water (350 mL). The organic layer was dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The crude residue was purified by silica gel column chromatography to afford tert-butyl 4-(6-(3-hydroxypropyl)-5-methoxy-benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.20H.sub.27O.sub.5SC.sub.4H.sub.8) (ES, m/z): 323 [M-C.sub.4Hs].sup.+.
Step 7: tert-Butyl 4-(6-(3-bromopropyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(450) ##STR00185##
(451) To a mixture of tert-butyl 4-(6-(3-hydroxypropyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (74 mg, 0.20 mmol) and triphenylphosphine (82 mg, 0.31 mmol) in THF (1.0 mL) at 0 C. was added NBS (52 mg, 0.29 mmol). After 15 min at 0 C., the mixture was quenched with sat aq NH.sub.4Cl and diluted with EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The crude residue was purified by silica gel column chromatography to afford tert-butyl 4-(6-(3-bromopropyl)-5-methoxybenzo [b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.20H.sub.26BrO.sub.4SC.sub.4H.sub.8) (ES, m/z): 385, 387 [M-C.sub.4H.sub.8].
Intermediate 9: Methyl 4-(4-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(452) ##STR00186##
Step 1: 2-Bromo-6-fluoro-4-methoxybenzaldehyde
(453) ##STR00187##
(454) To a mixture of 1-bromo-3-fluoro-5-methoxybenzene (7.5 g, 37 mmol) in THF (120 mL) at 78 C. was added LDA (2.0M in THF, 22 mL, 44 mmol), and the mixture was allowed to stir for 30 min at 78 C. After 30 min, DMF (3.4 mL, 44 mmol) was added dropwise, and the mixture was then allowed to stir for 30 min. The mixture was then quenched with water, warmed to RT, and then EtOAc was added. The layers were separated, and the water layer was extracted with EtOAc two more times. The combined organic layers were dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The crude product residue was purified by silica gel chromatography to afford 2-bromo-6-fluoro-4-methoxybenzaldehyde. LCMS (C.sub.8H.sub.7BrFO.sub.2) (ES, m/z): 233, 235 [M+H].sup.+.
Step 2: Methyl 4-bromo-6-methoxybenzo[b]thiophene-2-carboxylate
(455) ##STR00188##
(456) To a mixture of 2-bromo-6-fluoro-4-methoxybenzaldehyde (2.5 g, 11 mmol) in DMSO (54 mL) was added TEA (3.0 mL, 21 mmol). After 10 min, methyl thioglycolate (3.1 mL, 32 mmol) was added, and the mixture was allowed to stir for 30 min at RT. After 30 min, the mixture was heated to 60 C. for 1 h. Upon cooling to RT, the mixture was diluted with sat aq NaHCO.sub.3 and EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The crude product residue was purified by silica gel chromatography (0.fwdarw.15% EtOAc gradient in Hex) to afford methyl 4-bromo-6-methoxybenzo[b]thiophene-2-carboxylate. LCMS (C.sub.11H.sub.10BrO.sub.3S) (ES, m/z): 301, 303 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 7.93 (s, 1H), 7.73 (s, 1H), 7.44-7.37 (m, 1H), 3.89 (s, 3H), 3.87 (s, 3H).
Step 3: 4-Bromo-6-methoxybenzo[b]thiophene-2-carboxylic acid
(457) ##STR00189##
(458) To a mixture of methyl 4-bromo-6-methoxybenzo[b]thiophene-2-carboxylate (1.7 g, 5.5 mmol) in THF (14 mL), MeOH (7.0 mL), and water (7.0 mL) was added LiOH (0.66 g, 28 mmol), and the mixture was heated to 40 C. for 2 h. After 2 h, the mixture was allowed to cool to RT. The mixture was quenched with aq HCl (2.0M in water, 14 mL, 28 mmol). The mixture was filtered, and the residue was washed with EtOAc. The residue was then dried under vacuum and used without further purification. LCMS (C.sub.10H.sub.8BrO.sub.3S) (ES, m/z): 287, 289 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 13.57 (s, 1H), 7.86 (s, 1H), 7.71 (s, 1H), 7.38 (d, J=1.7 Hz, 1H), 3.86 (s, 3H).
Intermediate 10: Ethyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(459) ##STR00190##
Step 1: Ethyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(460) ##STR00191##
(461) To a mixture of ethyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (13 g, 35 mmol), and C-Phos Pd G4 (1.4 g, 1.7 mmol) was added (3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)zinc(II) bromide (0.50M in THF, 100 mL, 50 mmol) at once. The reaction was heated to 40 C. for 2 h. The mixture was then allowed to cool to RT and filtered through CELITE.
(462) The filtrate was concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (0.fwdarw.30% EtOAc gradient in Hex) to afford ethyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.23H.sub.31O.sub.6S) (ES, m/z): 435 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.21 (s, 1H), 7.71 (s, 1H), 7.55 (s, 1H), 4.50 (s, 1H), 4.02 (q, J=7.0 Hz, 2H), 3.85 (s, 3H), 3.70 (t, J=8.1 Hz, 1H), 3.65-3.58 (m, 1H), 3.40-3.34 (m, 1H), 3.33-3.29 (m, 3H), 2.73-2.59 (m, 4H), 1.79 (p, J=6.7 Hz, 2H), 1.69 (d, J=8.7 Hz, 1H), 1.58 (t, J=7.9 Hz, 1H), 1.48-1.34 (m, 4H), 1.14 (t, J=7.1 Hz, 3H).
Step 2: Ethyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(463) ##STR00192##
(464) To a mixture of 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo [b]thiophen-2-yl)-4-oxobutanoate (6.2 g, 14 mmol) and DCM (100 mL) at 0 C. was added triphenylphosphine dibromide (9.03 g, 21.4 mmol) portion-wise. The mixture was allowed to warm to RT and then stirred for 1 h. The mixture was then quenched with water and diluted with DCM. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (0.fwdarw.30% EtOAc gradient in Hex) to afford ethyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate LCMS (C.sub.18H.sub.22BrO.sub.4S) (ES, m/z): 413, 415 [M+H]+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.23 (s, 1H), 7.73 (s, 1H), 7.58 (s, 1H), 4.02 (q, J=7.0 Hz, 2H), 3.86 (s, 3H), 3.50 (t, J=6.5 Hz, 2H), 3.27 (d, J=6.4 Hz, 2H), 2.75 (t, J=7.3 Hz, 2H), 2.63 (t, J=6.2 Hz, 2H), 2.07 (p, J=6.7 Hz, 2H), 1.14 (t, J=7.1 Hz, 3H).
Intermediate 11: Ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(465) ##STR00193##
Step 1: Methyl 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carboxylate
(466) ##STR00194##
(467) 1-Chi oromethyl-4-fluoro-1,4-diazoniabicyclo[2.2.2]octane bis(tetrafluoroborate) (S.sub.ELECTFLUOR, 77 mg, 0.22 mmol) was added to a mixture of methyl 5,6-dimethoxybenzo[b]thiophene-2-carboxylate (50 mg, 0.20 mmol) in ACN (1 ml) at RT. The resulting mixture was stirred at 45 C. for 15 h. The mixture was cooled to RT, diluted with sat aq NaHCO.sub.3 (10 mL), and extracted with EtOAc (310 mL). The combined organic layers were washed with sat aq NaCl (10 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO.sub.2, EtOAc in PE) to give methyl 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carboxylate. LCMS (C.sub.12H.sub.12FO.sub.4S) (ES, m/z): 293 [M+H].sup.+. .sup.1H NMR (400 MHz, CDCl.sub.3): 8.05 (s, 1H), 7.08 (s, 1H), 3.99 (s, 3H), 3.97 (s, 3H), 3.94 (s, 3H).
Step 2: 4-Fluoro-5,6-dimethoxybenzo[b]thiophene-2-carboxylic acid
(468) ##STR00195##
(469) LiOH.H.sub.2O (71.4 mg, 1.70 mmol) was added portion-wise to a mixture of methyl 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carboxylate (46 mg, 0.170 mmol) in THF (3 ml), MeOH (1 ml), and H.sub.2O (1 ml) at RT. Then, the mixture was stirred for 15 h. The mixture was adjusted to pH=5 with 1N HCl and extracted with EtOAc (310 ml). The combined organic layers were washed with sat aq NaCl (10 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC (ACN/H.sub.2O with 0.1% TFA) to give 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carboxylic acid. LCMS (C.sub.11H.sub.9FO.sub.4S) (ES, m/z): 257 [M+H].sup.+. .sup.1H NMR (400 MHz, CDCl.sub.3): 8.12 (s, 1H), 7.09 (s, 1H), 3.99 (s, 3H), 3.97 (s, 3H).
Step 3: 4-Fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride
(470) ##STR00196##
(471) To a stirred solution of 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carboxylic acid (153 mg, 0.60 mmol) in anhydrous THF (5 mL) was added (COCl).sub.2 (0.21 mL, 2.40 mmol) dropwise at 0 C. The mixture was stirred at 0 C. for 1 h and then at RT for 1 h. The solvent was removed under reduced pressure to give 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride, which was used without further purification.
Step 4: Ethyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(472) ##STR00197##
(473) A suspension of copper(I) thiophene-2-carboxylate (125 mg, 0.65 mmol) was sparged with N.sub.2 for 5 min and then cooled to 0 C. A solution of (3-ethoxy-3-oxopropyl)zinc(II) bromide (17.7 mL, 0.5M in THF, 8.83 mmol) was added under N.sub.2 at 0 C., and the reaction mixture was stirred for 20 min at 0 C. A N.sub.2-sparged solution of 4-fluoro-5,6-dimethoxybenzo [b]thiophene-2-carbonyl chloride (130 mg, 0.47 mmol) in THF (3 mL) was then added at 0 C. The resulting suspension was allowed to warm to RT and was stirred for 8 h. The mixture was poured into sat aq NH.sub.4Cl (20 mL) with stirring. The mixture was extracted with EtOAc (220 mL). The combined organic layers were washed with H.sub.2O and sat aq NaCl, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (EtOAc in Hex) to give ethyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.18FO.sub.5S) (ES, m/z): 341 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.02 (d, J=0.7 Hz, 1H), 7.10 (t, J=1.0 Hz, 1H), 4.19 (q, J=7.2 Hz, 2H), 4.05-3.97 (m, 6H), 3.36 (t, J=6.7 Hz, 2H), 2.81 (t, J=6.7 Hz, 2H), 1.29 (t, J=7.2 Hz, 3H).
Step 5: Ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(474) ##STR00198##
(475) To a mixture of ethyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (3.6 g, 11 mmol) and DCM (50 mL) was added AlCl.sub.3 (5.64 g, 42.3 mmol). The reaction mixture was allowed to stir at RT for 18 h. An addition funnel was then connected to the reaction vessel, and water (50 mL) was added slowly to the mixture with vigorous stirring followed by aq HCl (1N, 50 mL). The mixture was then diluted with 20% IPA/DCM. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (100% DCM) to afford ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.15H.sub.16FO.sub.5S) (ES, m/z): 327 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 9.53 (s, 1H), 8.25 (s, 1H), 7.47 (s, 1H), 4.06 (q, J=7.1 Hz, 2H), 3.92 (s, 3H), 3.39-3.34 (m, 2H), 2.68-2.63 (m, 2H), 1.18 (t, J=7.1 Hz, 3H).
Intermediate 12: (S)-methyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(476) ##STR00199##
Step 1: (2S)-methyl-4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl) benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(477) ##STR00200##
(478) To a mixture of (S)-methyl-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (7.0 g, 19 mmol), and C-Phos Pd G4 (0.76 g, 0.94 mmol) was added (3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)zinc(II) bromide (0.50M in THF, 100 mL, 50 mmol). The mixture was heated to 40 C. for 2 h. The mixture was then allowed to cool to RT and filtered through CELITE. The filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (0.fwdarw.30% EtOAc gradient in Hex) to afford ethyl (2S)-methyl-4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.23H.sub.31O.sub.6S) (ES, m/z): 435 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.21 (s, 1H), 7.70 (s, 1H), 7.55 (s, 1H), 4.50 (s, 1H), 3.85 (s, 3H), 3.70 (dd, J=13.2, 5.3 Hz, 1H), 3.64-3.58 (m, 1H), 3.56 (s, 3H), 3.42-3.35 (m, 2H), 3.35-3.29 (m, 1H), 3.15 (dd, J=17.4, 4.9 Hz, 1H), 2.94 (dt, J=12.9, 7.1 Hz, 1H), 2.67 (hept, J=7.6, 7.1 Hz, 2H), 1.79 (p, J=6.7 Hz, 2H), 1.69 (d, J=8.7 Hz, 1H), 1.58 (t, J=7.9 Hz, 1H), 1.48-1.35 (m, 4H), 1.18-1.11 (m, 3H).
Step 2: (S)-methyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(479) ##STR00201##
(480) To a mixture of (2S)-methyl-4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy) propyl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (2.62 g, 6.03 mmol) and MeOH (50 mL) was added pTsOH (1.72 g, 9.04 mmol). The mixture was allowed to stir at RT for 1 h. The mixture was then quenched with water and diluted with DCM. The organic layer was separated and then washed with aq sat NaHCO.sub.3. The organic layer was then dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure afford (S)-methyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.23O.sub.5S) (ES, m/z): 351 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.21 (s, 1H), 7.69 (s, 1H), 7.54 (s, 1H), 4.44 (t, J=5.0 Hz, 1H), 3.85 (s, 3H), 3.56 (s, 3H), 3.42-3.35 (m, 3H), 3.15 (dd, J=17.4, 4.9 Hz, 1H), 2.93 (h, J=7.0 Hz, 1H), 2.64 (t, J=7.6 Hz, 2H), 1.68 (p, J=6.6 Hz, 2H), 1.15 (d, J=7.1 Hz, 3H).
Intermediate 13: Methyl 4-(5-(3-bromopropyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate
(481) ##STR00202##
Step 1: Methyl 5-bromo-6-methylbenzo[b]thiophene-2-carboxylate
(482) ##STR00203##
(483) To a mixture of 5-bromo-2-fluoro-4-methylbenzaldehyde (5.0 g, 23 mmol) in DMSO (120 mL) was added TEA (6.4 mL, 46 mmol). After 10 min, methyl thioglycolate (6.7 mL, 69 mmol) was added, and the mixture was then heated to 60 C. for 18 h. After 18 h, the mixture was cooled to RT, and the mixture was diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The mixture was diluted with DCM. The mixture was filtered, and the residue was dried under vacuum. To the mother liquor was added silica gel (50 g), and the mixture was concentrated. The mixture was then purified by silica gel chromatography to afford methyl 5-bromo-6-methylbenzo[b]thiophene-2-carboxylate. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.31 (s, 1H), 8.13 (s, 1H), 8.08 (s, 1H), 3.89 (s, 3H), 2.48 (s, 3H).
Step 2: 5-Bromo-6-methylbenzo[b]thiophene-2-carboxylic acid
(484) ##STR00204##
(485) To a mixture of methyl 5-bromo-6-methylbenzo[b]thiophene-2-carboxylate (2.76 g, 9.68 mmol) in THF (24 ml), water (12 ml), and MeOH (12 ml) was added LiOH (1.16 g, 48.4 mmol), and the mixture was stirred for 30 min at RT. The mixture was then acidified to near neutral with HCl (1.0M in water, 48 ml, 48 mmol). The mixture was then diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated to afford 5-bromo-6-methylbenzo[b]thiophene-2-carboxylic acid. The product was used without purification. LCMS (C.sub.10H.sub.8BrO.sub.2S) (ES, m/z): 271, 273 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 13.56 (s, 1H), 8.29 (s, 1H), 8.05 (s, 1H), 8.04 (s, 1H), 2.47 (s, 3H).
Step 3: 5-Bromo-6-methylbenzo[b]thiophene
(486) ##STR00205##
(487) To 5-bromo-6-methylbenzo[b]thiophene-2-carboxylic acid (5.7 g, 21 mmol) was added DMA (100 mL). The mixture was then split evenly among 5 vials. DBU (1.6 mL) was added to each vial, and each vial was then irradiated in the microwave to 200 C. for 2 h. Upon completion, the five vials were combined and then diluted with EtOAc and sat aq NaHCO.sub.3. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford 5-bromo-6-methylbenzo[b]thiophene. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.15 (s, 1H), 8.00 (s, 1H), 7.75 (d, J=5.4 Hz, 1H), 7.39 (d, J=5.3 Hz, 1H), 2.45 (s, 3H).
Step 4: 4-(5-Bromo-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoic acid
(488) ##STR00206##
(489) To a mixture of 5-bromo-6-methylbenzo[b]thiophene (2.0 g, 8.8 mmol) in DCM (88 mL) at 0 C. was added succinic anhydride (1.1 g, 11 mmol) and then AlCl.sub.3 (2.3 g, 18 mmol). The mixture was warmed to RT and stirred for 18 h. The mixture was then diluted with EtOAc and HCl (1.0N in water). The organic layer was separated, dried over MgSO.sub.4 and filtered. To the filtrate was added silica gel (10 g), and the mixture was concentrated under reduced pressure. The mixture was put under vacuum for 18 h and then was purified by silica gel chromatography (0.fwdarw.50% EtOAc gradient in Hex) to afford 4-(5-bromo-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoic acid. LCMS (C.sub.13H.sub.12BrO.sub.3S) (ES, m/z): 327, 329 [M+H].sup.+.
Step 5: Methyl 4-(5-bromo-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate
(490) ##STR00207##
(491) To a mixture of 4-(5-bromo-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoic acid (0.99 g, 3.0 mmol) in DMF (20 mL) was added K.sub.2CO.sub.3 (1.0 g, 7.6 mmol). After 10 min, CH.sub.3I (0.95 mL, 15 mmol) was added, and the mixture was allowed to stir until complete by LCMS. The mixture was then diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The resulting residue was purified by silica gel chromatography to afford methyl 4-(5-bromo-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.14H.sub.14BrO.sub.3S) (ES, m/z): 341, 343 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.32 (s, 1H), 8.30 (s, 1H), 8.07 (s, 1H), 3.61 (s, 3H), 3.37 (t, J=6.3 Hz, 2H), 2.70 (t, J=6.3 Hz, 2H), 2.48 (s, 3H).
Step 6: Methyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate
(492) ##STR00208##
(493) To a flask containing methyl 4-(5-bromo-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate (0.40 g, 1.2 mmol) and THF (5.9 mL) was added C-Phos Pd G3 (47 mg, 0.059 mmol), and the mixture was evacuated and backfilled with N.sub.2 three times. (3-((tert-butyldimethylsilyl) oxy)propyl)zinc(II) bromide (0.50M in THF, 7.0 mL, 3.5 mmol) was added, and the mixture was allowed to stir at RT for 2.5 h. The mixture was then quenched with a mixture of EtOAc and 10% aq sodium citrate. The organic layer was separated, washed with sat aq NaCl, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford methyl 4-(5-(3-((tert-butyldimethylsilyl)oxy) propyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.23H.sub.35O.sub.4SSi) (ES, m/z): 435 [M+H].sup.+.
Step 7: Methyl 4-(5-(3-hydroxypropyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate
(494) ##STR00209##
(495) To a mixture of methyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate (0.23 g, 0.54 mmol) in THF (2.7 mL) was added TBAF (1.0M in THF, 1.0 mL, 1.0 mmol). After 1.5 h, the mixture was diluted with EtOAc and sat aq NH.sub.4Cl. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0.fwdarw.70% EtOAc gradient in Hex) to afford methyl 4-(5-(3-hydroxypropyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.17H.sub.21O.sub.4S) (ES, m/z): 321 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.30 (s, 1H), 7.81 (s, 1H), 7.78 (s, 1H), 4.55 (t, J=5.1 Hz, 1H), 3.61 (s, 3H), 3.51-3.46 (m, 2H), 3.38-3.34 (m, 2H), 2.77-2.66 (m, 4H), 2.41 (s, 3H), 1.79-1.67 (m, 2H).
Step 8: Methyl 4-(5-(3-bromopropyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate
(496) ##STR00210##
(497) To a stirred mixture of methyl 4-(5-(3-hydroxypropyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate (97 mg, 0.30 mmol) and Ph.sub.3P (130 mg, 0.48 mmol) in THF (1.5 mL) at 0 C. was added NBS (81 mg, 0.45 mmol) in one portion. After 30 min, the reaction was quenched with sat aq NH.sub.4Cl and EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0.fwdarw.25% EtOAc gradient in Hex) to afford methyl 4-(5-(3-bromopropyl)-6-methylbenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.17H.sub.20BrO.sub.3S) (ES, m/z): 383, 385 [M+H].sup.+.
Intermediate 14: tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(498) ##STR00211##
Step 1: tert-butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(499) ##STR00212##
(500) CuCl (0.721 g, 7.29 mmol) was added to a 250 mL round bottom flask with a stir bar. The flask was evacuated and then purged with N.sub.2 three times. THF (14.6 mL) was added to the flask, which was then stirred and cooled to 0 C. with an ice water bath. (3-(tert-butoxy)-3-oxopropyl)zinc(II) (0.50M THF, 30 mL, 15 mmol) was then added dropwise over 10 min while stirring at 0 C. The resulting mixture was stirred at 0 C. for 35 min. 5-chloro-6-methoxy thieno[3,2-b]pyridine-2-carbonyl chloride (1.91 g, 7.29 mmol) was added, followed by NMP (14.6 mL). The resulting mixture was stirred for 7 h at 0 C. Concentrated NH.sub.4OH (4 mL) was added to the reaction with rapid stirring at 0 C. To this suspension was added water:MeOH (4:1 140 mL) along with 20 g sodium citrate tribasic dihydrate. The mixture was stirred for 20 min. The resulting suspension was filtered, and the filter cake was washed with water. The cake was then slurried in Hex and filtered twice. Vacuum was pulled through the cake with N.sub.2 sweep over 72 h to afford tert-butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.19ClNO.sub.4S) (ES, m/z): 356 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.03 (s, 1H), 7.61 (s, 1H), 4.03 (s, 3H), 3.30 (t, J=6.5 Hz, 2H), 2.87-2.59 (m, 2H), 1.46 (s, 9H).
Step 2: tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(501) ##STR00213##
(502) tert-Butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (1.00 g, 2.81 mmol) and CPhos Pd G3 (0.113 g, 0.141 mmol) were added to a 40 mL vial with a septum-containing screw cap. The vial was evacuated and backfilled with N.sub.2 three times. THF (10.0 mL) was added to the vial under N.sub.2 with stirring. While stirring the resulting suspension at RT, (3-((tert-butyldimethylsilyl)oxy)propyl)zinc(II) bromide (0.50M in THF, 11.2 mL, 5.60 mmol) was added dropwise. The resulting mixture was stirred for 3 h at RT. The mixture was partitioned between EtOAc (75 mL) and 10% aqueous sodium citrate (75 mL) and stirred vigorously for 5 min. The layers were separated, and the aqueous layer was extracted with EtOAc (20 mL). The organic layers were combined, washed with sat aq NaCl (50 mL), dried over anhydrous Na.sub.2SO.sub.4, concentrated under reduced pressure to afford a crude residue. The resulting residue was purified by silica gel chromatography (0.fwdarw.40% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.25H.sub.40NO.sub.5SSi) (ES, m/z): 494 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.08 (s, 1H), 7.48 (s, 1H), 3.94 (s, 3H), 3.75 (t, J=6.5 Hz, 2H), 3.30 (t, J=6.6 Hz, 2H), 3.02-2.95 (m, 2H), 2.73 (t, J=6.6 Hz, 2H), 2.03-1.96 (m, 2H), 1.46 (s, 9H), 0.92 (s, 9H), 0.07 (s, 6H).
Step 3: tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(503) ##STR00214##
(504) To a mixture of tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (0.735 g, 1.49 mmol) in MeOH (3.0 mL) was added water (3.0 mL) and then HOAc (3.0 mL). The resulting mixture was stirred at RT for 18 h. The mixture was then partitioned between EtOAc (50 mL), water (25 mL) and sat aq NaCl (25 mL). The layers were separated, and the aqueous layer was extracted with EtOAc (50 mL). The organic layers were combined, washed with sat aq NaCl (50 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex then isocratic at 100% EtOAc) to afford tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.19H.sub.26NO.sub.5S) (ES, m/z): 380 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.06 (s, 1H), 7.51 (s, 1H), 3.95 (s, 3H), 3.73 (t, J=5.8 Hz, 2H), 3.28 (t, J=6.6 Hz, 2H), 3.10 (t, J=6.9 Hz, 2H), 2.72 (t, J=6.6 Hz, 2H), 2.06 (p, J=6.5 Hz, 2H), 1.45 (s, 9H).
Intermediate 15: tert-Butyl 4-(5-bromo-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate
(505) ##STR00215##
Step 1: Methyl 2-((3-bromo-4-methoxyphenyl)amino)-2-oxoacetate
(506) ##STR00216##
(507) Into a 5-L 4-necked round-bottom flask that was purged and maintained with an inert atmosphere of N.sub.2 was placed a mixture of 3-bromo-4-methoxyaniline (232 g, 1.15 mol) in DCM (3.0 L), DIPEA (171 g, 1.32 mol), and methyl 2-chloro-2-oxoacetate (148 g, 1.21 mol). The resulting mixture was stirred for 1 h at RT. The mixture was then quenched by the addition of water/ice (2 L). The resulting mixture was extracted with DCM (31 L). The organic layers were combined and concentrated under reduced pressure to afford methyl 2-((3-bromo-4-methoxyphenyl)amino)-2-oxoacetate, which was used without purification or characterization.
Step 2: O-Methyl 2-((3-bromo-4-methoxyphenyl)amino)-2-oxoethanethiolate
(508) ##STR00217##
(509) Into a 3-L 4-necked round-bottom flask that was purged and maintained with an inert atmosphere of N.sub.2 was placed a mixture of methyl 2-((3-bromo-4-methoxyphenyl)amino)-2-oxoacetate (111 g, 386 mmol) in toluene (1.5 L) and Lawesson's reagent (86.4 g, 214 mmol). The resulting mixture was heated to 85 C. for 16 h. The reaction mixture was then cooled to RT. The resulting materials were removed by filtration and washed with DCM (3500 mL). The filtrate was concentrated under reduced pressure, and the residue was purified by silica gel chromatography (EtOAc/PE (1:20)) to afford O-methyl 2-((3-bromo-4-methoxyphenyl)amino)-2-oxoethanethioate, which was used without characterization.
Step 3: 5-Bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid, potassium salt and 7-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid, potassium salt (2:1 mixture of isomers)
(510) ##STR00218##
(511) Into a 2-L 4-necked round-bottom flask that was purged and maintained with an inert atmosphere of N.sub.2, was placed methyl O-methyl 2-((3-bromo-4-methoxyphenyl)amino)-2-oxoethanethiolate (84.5 g, 278 mmol). A mixture of KOH (50 g, 90 mmol) in H.sub.2O (500 mL) was added to the reaction mixture over a period of 10 min. A mixture of potassium ferricyanide (III) hydrate (242 g, 735 mmol) in H.sub.2O (2 L) was then added to the reaction mixture over a period of 10 min. The pH of the resulting mixture was adjusted to 2 with aq HCl (2.0M). Water (500 mL) was then added. The resulting mixture was allowed to stir for 1 h at RT. The resulting product was then collected by filtration and washed with DCM (1 L). The cake was slurried in aq KOH (2.0M, 500 mL, 1 mol) for 0.5 h. The resulting product was then collected by filtration and washed with H.sub.2O (2500 mL) to afford a 2:1 a mixture of 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid, potassium salt and 7-bromo-6-methoxybenzo[d] thiazole-2-carboxylic acid, potassium salt. Characterization data for 5-bromo-6-methoxybenzo [d]thiazole-2-carboxylic acid, potassium salt (major isomer): .sup.1H NMR (400 MHz, DMSO-d.sub.6, ppm) 8.13 (s, 1H), 7.70 (s, 1H), 3.80 (s, 3H). Characterization data 7-bromo-6-methoxybenzo [d]thiazole-2-carboxylic acid, potassium salt (minor isomer): .sup.1H NMR (400 MHz, DMSO-d.sub.6, ppm) 7.90 (d, J=8.9 Hz, 1H), 7.26 (d, J=8.9 Hz, 1H), 3.91 (s, 3H).
Step 4: 5-Bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid and 7-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid (2:1 mixture of isomers)
(512) ##STR00219##
(513) To a 1 L flask were added 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid, potassium salt and 7-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid, potassium salt (2:1 mixture of isomers) (22.4 g, 49.4 mmol), water (300 mL), ACN (180 mL), MeOH (120 mL), and TFA (11.4 mL, 148 mmol). The mixture was stirred vigorously for 15 min at RT. The resulting product were collected by filtration and washed with water (220 mL), MeOH (25 mL), and Et.sub.2O (210 mL) to afford a 2:1 mixture of 5-bromo-6-methoxybenzo[d] thiazole-2-carboxylic acid and 7-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid. Characterization data for 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid (major isomer): .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.45 (s, 1H), 7.97 (s, 1H), 3.96 (s, 3H). Characterization data for 7-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid (minor isomer): .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.21 (d, J=9.0 Hz, 1H), 7.51 (d, J=9.0 Hz, 1H), 4.00 (s, 3H).
Step 5: Methyl 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylate
(514) ##STR00220##
(515) To a 250 mL flask was added 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid and 7-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid (2:1 mixture of isomers) (17.2 g, 41.8 mmol) and MeOH (150 mL). The mixture was stirred vigorously and cooled to 0 C. To the stirring mixture was added SOCl.sub.2 (6.1 mL, 84 mmol) dropwise over a period of 10 min. The mixture was then heated to reflux for 18 h. Upon cooling to RT, the resulting product was collected by filtration and washed with MeOH (220 mL). The product was purified by silica gel chromatography (0.fwdarw.30% EtOAc gradient in DCM) to afford methyl 5-bromo-6-methoxybenzo [d]thiazole-2-carboxylate as a single isomer. LCMS (C.sub.10H.sub.9BrNO.sub.3S) (ES, m/z): 302, 304 (M+H).sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.42 (s, 1H), 7.40 (s, 1H), 4.09 (s, 3H), 4.02 (s, 3H).
Step 6: 5-Bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid
(516) ##STR00221##
(517) To a 500 mL round bottom flask was added methyl 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylate (7.3 g, 24 mmol) and MeOH (150 mL). To the vigorously stirring mixture was added aq NaOH (2.0M, 37 mL, 74 mmol). The mixture was heated to reflux for 30 min. Upon cooling to RT, aq HCl (2.0M, 37 mL, 74 mmol) was added dropwise. The mixture was stirred vigorously at RT for 18 h. The resulting product was collected by filtration and washed with water (250 mL) and MeOH (220 mL) to afford 5-bromo-6-methoxybenzo[d] thiazole-2-carboxylic acid. LCMS (C.sub.9H.sub.7BrNO.sub.3S) (ES, m/z): 288, 290 (M+H). .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.45 (s, 1H), 7.97 (s, 1H), 3.96 (s, 3H).
Step 7: 5-Bromo-6-methoxybenzo[d]thiazole-2-carbonyl chloride
(518) ##STR00222##
(519) To a 100 mL round bottom flask was added 5-bromo-6-methoxybenzo[d]thiazole-2-carboxylic acid (1.46 g, 5.07 mmol), DCM (25 mL), and DMF (0.080 mL, 1.0 mmol). To the mixture was added (COCl).sub.2 (5.32 mL, 10.6 mmol) dropwise over 1 min, and the mixture was vigorously stirred at RT for 15 min. The mixture was then filtered through CELITE. The filtrate was concentrated under reduced pressure to afford 5-bromo-6-methoxybenzo[d]thiazole-2-carbonyl chloride used without further purification or characterization.
Step 8: tert-Butyl 4-(5-bromo-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate
(520) ##STR00223##
(521) To a 250 mL round bottom flask was added CuCl (0.45 g, 4.6 mmol). The flask was evacuated and refilled with N.sub.2 three times. THF (10 mL) was added, and the mixture was stirred and cooled to 0 C. To the mixture was added (3-(tert-butoxy)-3-oxopropyl)zinc(II) bromide (0.50M in THF, 18 mL, 9.0 mmol). After 10 min, a mixture of 5-bromo-6-methoxy-benzo[d]thiazole-2-carbonyl chloride (1.4 g, 4.6 mmol) in NMP (30 mL) was added dropwise over a period of 5 min. After 5 min, the mixture was allowed to warm to RT and was then stirred for 1 h. To the mixture was added water (30 mL) and concentrated aq NH.sub.4OH (15 mL). The mixture was extracted with EtOAc (125 mL), and the organic layer was washed with water (275 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0.fwdarw.75% EtOAc gradient in Hex) to afford tert-butyl 4-(5-bromo-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.18BrNO.sub.4S+Na) (ES, m/z): 422, 424 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.38 (s, 1H), 7.40 (s, 1H), 4.02 (s, 3H), 3.51 (t, J=6.6 Hz, 2H), 2.75 (t, J=6.6 Hz, 2H), 1.46 (s, 9H).
Intermediate 16: tert-butyl 4-(5-(3-bromopropyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate
(522) ##STR00224##
Step 1: tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate
(523) ##STR00225##
(524) To a 4 mL vial was added tert-butyl 4-(5-bromo-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate (233 mg, 0.581 mmol) and C-Phos Pd G3 (14 mg, 0.018 mmol). The vial was evacuated and refilled with N.sub.2 three times. To the vial was added THF (0.60 mL) followed by (3-((tert-butyldimethylsilyl)oxy)propyl)zinc(II) bromide (0.50M in THF, 2.90 mL, 1.45 mmol). The mixture was stirred at RT for 20 min. To the mixture was added additional (3-((tert-butyl dimethylsilyl)oxy)-propyl)zinc(II) bromide (0.50M in THF, 1.4 mL, 0.73 mmol). After 30 min, the mixture was diluted in EtOAc (30 mL) and washed with 10% aq tribasic sodium citrate (30 mL). The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel chromatography (0.fwdarw.40% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy) propyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate. LCMS (C.sub.25H.sub.40NO.sub.5SSi) (ES, m/z): 494 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.93 (s, 1H), 7.31 (s, 1H), 3.94 (s, 3H), 3.70 (t, J=6.3 Hz, 2H), 3.53 (t, J=6.6 Hz, 2H), 2.86-2.78 (m, 2H), 2.74 (t, J=6.6 Hz, 2H), 1.94-1.84 (m, 2H), 1.45 (s, 9H), 0.93 (s, 9H).
Step 2: tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate
(525) ##STR00226##
(526) To a 100 mL flask was added tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy) propyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate (229 mg, 0.464 mmol), MeOH (5.0 mL), water (5.0 mL), and AcOH (5.0 mL). The mixture was allowed to stir at RT for 4 h. The mixture was then diluted with EtOAc (50 mL) and washed with water (350 mL). The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to afford tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate. LCMS (C.sub.19H.sub.26NO.sub.5S) (ES, m/z): 380 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.95 (s, 1H), 7.34 (s, 1H), 3.96 (s, 3H), 3.70 (t, J=6.3 Hz, 2H), 3.52 (t, J=6.7 Hz, 2H), 2.87 (t, J=7.5 Hz, 2H), 2.75 (t, J=6.6 Hz, 2H), 2.00-1.90 (m, 2H), 1.46 (s, 9H).
Step 3: tert-butyl 4-(5-(3-bromopropyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate
(527) ##STR00227##
(528) To a 4 mL vial was added CBr.sub.4 (72 mg, 0.22 mmol), triphenylphosphine (62 mg, 0.24 mmol), and tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate (69 mg, 0.18 mmol). The vial was cooled to 0 C., and the DCM (1.0 mL) was added. The mixture was allowed to warm to RT for 90 min. The mixture was then directly purified by silica gel chromatography (0.fwdarw.30% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-bromopropyl)-6-methoxybenzo[d]thiazol-2-yl)-4-oxobutanoate. LCMS (C.sub.19H.sub.25BrNO.sub.4S) (ES, m/z): 442, 444 [M+H].sup.+. .sup.1H NMR (499 MHz, CDCl.sub.3) 7.96 (s, 1H), 7.33 (s, 1H), 3.52 (t, J=6.6 Hz, 2H), 3.95 (s, 3H), 3.45 (t, J=6.6 Hz, 2H), 2.93 (t, J=7.2 Hz, 2H), 2.75 (t, J=6.6 Hz, 2H), 2.30-2.19 (m, 2H), 1.46 (s, 9H).
Intermediate 17: tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(529) ##STR00228##
(530) To a mixture of RockPhos Pd G3 (0.105 g, 0.125 mmol), benzaldoxime (3.03 g, 25.0 mmol), tert-butyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (5.0 g, 13 mmol), and Cs.sub.2CO.sub.3 (12.2 g, 37.6 mmol) was added DMF (40 mL). The reaction was heated to 80 C. for 18 h. The reaction mixture was then allowed to cool to RT and poured into a flask containing aq HCl (0.5M, 100 mL). The resulting mixture was extracted with DCM. The organic layer was then dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (0.fwdarw.50% EtOAc gradient in Hex) to afford tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.17H.sub.20O.sub.5SNa) (ES, m/z): 359 [M+Na].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 9.35 (s, 1H), 8.12 (s, 1H), 7.49 (s, 1H), 7.27 (s, 1H), 3.83 (s, 3H), 3.18 (t, J=6.2 Hz, 2H), 2.52 (t, J=6.2 Hz, 2H), 1.33 (s, 9H).
Intermediate 18: Ethyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(531) ##STR00229##
(532) To a mixture ethyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl) benzo[b]thiophen-2-yl)-4-oxobutanoate (5.0 g, 12 mmol) and EtOH (100 mL) was added pTsOH (4.4 g, 23 mmol). The reaction was allowed to stir at RT for 1 h. The reaction was then quenched with water and diluted with DCM. The organic layer was separated and then washed with aq sat NaHCO.sub.3. The organic layer was then dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to afford ethyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.18H.sub.23O.sub.5S) (ES, m/z): 351 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.21 (s, 1H), 7.70 (s, 1H), 7.55 (s, 1H), 4.44 (t, J=5.0 Hz, 1H), 4.02 (q, J=7.0 Hz, 2H), 3.85 (s, 3H), 3.40 (q, J=6.0 Hz, 2H), 3.27 (d, J=6.4 Hz, 2H), 2.63 (q, J=7.0, 5.9 Hz, 4H), 1.68 (p, J=6.6 Hz, 2H), 1.14 (t, J=7.1 Hz, 3H).
Intermediate 19: methyl (2S)-4-[5-(2-aminoethyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate
(533) ##STR00230##
Step 1: methyl (2S)-4-(5-{2-[(tert-butoxycarbonyl)amino]ethyl}-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate
(534) ##STR00231##
(535) To the stirred mixture of methyl (2S)-4-(5-bromo-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (124 mg, 0.334 mmol), tris(trimethylsilyl)silane (103 L, 0.334 mmol), and anhydrous Na.sub.2CO.sub.3 (71 mg, 0.67 mmol) in degassed DME (1.7 mL) under N.sub.2, was added a mixture of Ir(2-(2,4-difluorophenyl)-5-(trifluoromethyl) pyridine).sub.2 (4,4-di-tert-butyl-2,2-bipyridine)PF.sub.6 (3.8 mg, 3.3 mol) in degassed DME (1.2 mL). A suspension of Nickel(II) chloride ethylene glycol dimethyl ether complex (0.37 mg, 1.7 mol) and 4,4-di-tert-butyl-2,2-bipyridine (0.45 mg, 1.7 mol) in degassed DME (445 L) was added, and the resulting mixture was stirred under N.sub.2 for 15 min at RT. tert-butyl N-(2-bromoethyl)carbamate (150 mg, 0.67 mmol) was added in one portion under N.sub.2, and the reaction mixture was stirred and irradiated with two 34 W blue LED lamps (7 cm away on each side) for 18 h at RT. The mixture was then directly purified by silica gel flash column chromatography (EtOAc in Hex) to afford methyl (2S)-4-(5-{2-[(tert-butoxycarbonyl)amino] ethyl}-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.22H.sub.30NO.sub.6S) (ES, m/z): 436 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.25 (s, 1H), 7.70 (s, 1H), 7.60 (s, 1H), 6.86 (br, 1H), 3.88 (s, 3H), 3.59 (s, 3H), 3.43 (dd, J=17.5, 8.6 Hz, 1H), 3.19 (dd, J=17.5, 5.0 Hz, 1H), 3.15 (t, J=7.0 Hz, 2H), 3.01-2.93 (m, 1H), 2.77 (t, J=7.0 Hz, 2H), 1.34 (s, 9H), 1.19 (d, J=7.1 Hz, 3H).
Step 2: methyl (2S)-4-[5-(2-amino]ethyl)-6-methoxy-1-benzothiophen-2-yl-2-methyl-4-oxobutanoate
(536) ##STR00232##
(537) To the stirred solution of methyl (2S)-4-(5-{2-[(tert-butoxycarbonyl)amino] ethyl}-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (54 mg, 0.12 mmol) in CH.sub.2Cl.sub.2 (2.8 mL) was added TFA (476 L, 6.18 mmol) in one portion at RT, and the reaction mixture was stirred at RT for 2 h. The mixture was concentrated, and the residue was dissolved in CH.sub.3CN and water and lyophilized overnight to afford methyl (2S)-4-[5-(2-aminoethyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate. LCMS (C.sub.17H.sub.22NO.sub.4S) (ES, m/z): 336 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.29 (s, 1H), 7.80 (br, 2H), 7.79 (s, 1H), 7.68 (s, 1H), 3.91 (s, 3H), 3.60 (s, 3H), 3.45-3.39 (m, 1H), 3.20 (dd, J=17.5, 5.0 Hz, 1H), 3.10-3.01 (m, 2H), 3.01-2.93 (m, 1H), 2.95 (t, J=7.0 Hz, 2H), 1.20 (d, J=7.1 Hz, 3H).
Intermediate 20: Ethyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(538) ##STR00233##
(539) To a mixture of ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate(0.065 g, 0.2 mmol), Cs.sub.2CO.sub.3 (0.326 g, 1.00 mmol), and ACN (2 mL) was added 1,3-dibromopropane (1.0 mL, 9.9 mmol). The mixture was heated to 65 C. for 2 h. Upon cooling to RT, the mixture was filtered, and the filtered material was washed with THF. The filtrate was diluted with Hex, and the mixture was then concentrated under reduced pressure to afford ethyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.18H.sub.21BrFO.sub.5S) (ES, m/z): 447, 449 [M+H].sup.+.
(540) Intermediates 21 through 23 and 62 through 86, as shown in Table 1 below, were or may be prepared according to procedures analogous to those outlined in Intermediate 20 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(541) TABLE-US-00001 TABLE 1 Mass Intermediate Structure Name [M + H].sup.+ 21
Intermediate 24: (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(542) ##STR00262##
Step 1: (S)-methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(543) ##STR00263##
(544) To a mixture of 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride (4.3 g, 16 mmol), C-Phos Pd G4 (0.26 g, 0.31 mmol), and THF (25 mL) was added (R)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (0.50M in THF, 25.0 mL, 12.5 mmol). The reaction was allowed to stir for 2 h at RT. The reaction was then quenched with aq sat NH.sub.4Cl and diluted with DCM. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (0.fwdarw.50% EtOAc gradient in Hex) to afford (S)-methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thio phen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18FO.sub.5S) (ES, m/z): 341 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.33 (s, 1H), 7.58 (s, 1H), 3.92 (s, 3H), 3.86 (s, 3H), 3.60 (s, 3H), 3.50 (dd, J=17.7, 8.7 Hz, 1H), 3.25 (dd, J=17.7, 5.0 Hz, 1H), 3.00-2.92 (m, 1H), 1.20 (d, J=7.3 Hz, 3H).
Step 2: (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(545) ##STR00264##
(546) To a mixture of (S)-methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (4.0 g, 12 mmol), and DCM (50 mL), was added AlCl.sub.3 (6.27 g, 47.0 mmol). The reaction mixture was allowed to stir at RT for 18 h. An addition funnel was then added to the reaction, and water (50 mL) was added slowly to the mixture with vigorous stirring followed by aq HCl (1N, 50 mL). The mixture was then poured into a separatory funnel, and 20% IPA/DCM was added. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered, and the filtrate was concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (100% DCM) to afford (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxy benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.16FO.sub.5S) (ES, m/z): 327 [M+H]+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 9.53 (s, 1H), 8.25 (s, 1H), 7.47 (s, 1H), 3.92 (s, 3H), 3.60 (s, 3H), 3.48 (dd, J=17.7, 8.7 Hz, 1H), 3.24 (dd, J=17.7, 5.0 Hz, 1H), 3.01-2.89 (m, 1H), 1.19 (d, J=7.2 Hz, 3H).
Intermediate 25: methyl (R)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(547) ##STR00265##
Step 1: 5,6-Dimethoxybenzo[b]thiophene-2-carbonyl chloride
(548) ##STR00266##
(549) To a stirring solution of 5,6-dimethoxybenzo[b]thiophene-2-carboxylic acid (5.0 g, 21 mmol) in THF (200 mL) at 0 C. under Ar was added (COCl).sub.2 (5.5 ml, 63 mmol) followed by DMF (0.1 ml, 1.3 mmol). The reaction mixture was stirred at 0 C. for 1 h and then allowed to warm to RT and stirred overnight. The reaction mixture was concentrated under reduced pressure, and the resulting 5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride was used without purification. .sup.1H NMR (600 MHz, CH.sub.3CN-d.sub.3): 8.25 (s, 1H), 7.46 (s, 1H), 7.45 (s, 1H), 3.92 (s, 3H), 3.88 (s, 3H).
Step 2: Methyl (S)-4-(5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(550) ##STR00267##
(551) To an oven-dried, Ar-purged, round-bottomed flask containing copper (I) thiophene-2-carboxylate (797 mg, 4.2 mmol) at 0 C. was added (R)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (7.8 mL, 0.5M in THF, 3.9 mmol) dropwise. The reaction mixture was stirred at 0 C. for 20 min. A suspension of 5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride (777 mg, 3.0 mmol) in THF (15 mL) was added dropwise to the reaction mixture. The reaction mixture was allowed to warm to RT and stirred for 6 h. The reaction mixture was diluted with sat aq NH.sub.4Cl solution (15 mL), followed by DCM (30 mL). Precipitates were removed by filtration prior to extraction. The layers were separated, and the aq layer was extracted with DCM (330 mL). The combined organic layers were concentrated under reduced pressure. The residue was purified by silica gel column chromatography ((25% EtOH in EtOAc) in Hex) to afford methyl (S)-4-(5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.19O.sub.5S) (ES, m/z): 323 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3): 7.89 (s, 1H), 7.26 (s, 2H), 4.00 (s, 3H), 3.97 (s, 3H), 3.72 (s, 3H), 3.48 (dd, J=16.9, 7.6 Hz, 1H), 3.22-3.16 (m, 1H), 3.05 (dd, J=16.9, 6.0 Hz, 1H), 1.31 (d, J=7.2 Hz, 3H).
Step 3: methyl (R)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(552) ##STR00268##
(553) AlCl.sub.3 (1.0 g, 7.5 mmol) was added to (R)-methyl 4-(5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.0 g, 3.0 mmol) in CH.sub.2Cl.sub.2 (40 mL) at 0 C. The reaction mixture was allowed to warm to RT for 18 h. The reaction mixture was then cooled to 0 C., and MeOH (85 mL) was added. The mixture was allowed to stir at 0 C. for 30 min. The mixture was then allowed to warm to RT and concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (EtOAc gradient in Hex) to afford impure methyl (R)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. The mixture was then purified by chiral-SFC (Column AD-H (21250 mm), 30% MeOH with 0.25% DMEA in CO.sub.2) to afford methyl (R)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate with a retention time of 4.7 min. LCMS (C.sub.15H.sub.17O.sub.5S) (ES, m/z): 309 [M+H].sup.+. .sup.1H NMR (DMSO-d.sub.6) : 9.41 (s, 1H), 8.17 (s, 1H), 7.54 (s, 1H), 7.31 (s, 1H), 3.87 (s, 3H), 3.60 (s, 3H), 3.40 (dd, J=17.4, 8.6 Hz, 1H), 3.17 (dd, J=17.5, 5.1 Hz, 1H), 3.02-2.91 (m, 1H), 1.19 (d, J=7.1 Hz, 3H).
(554) Intermediates 26 through 27, as shown in Table 2 below, were or may be prepared according to procedures analogous to those outlined in Intermediate 25 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(555) TABLE-US-00002 TABLE 2 Mass Intermediate Structure Name [M + H].sup.+ 26
Intermediate 28: methyl (S)-4-(5-(2-chloroethoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(556) ##STR00271##
Step 1: methyl (S)-4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(557) ##STR00272##
(558) A flask containing CuCl (2.5 g, 25 mmol) was sparged with Ar and then cooled to 0 C. 3-Methoxy-(2R)-(+)-methyl-3-oxopropylzinc bromide (0.50M in THF, 50 mL, 25 mmol) was added dropwise. A mixture of 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride (5.0 g, 20 mmol) in THF (25 mL) and NMP (25 mL) was added dropwise to the stirring reaction mixture. The reaction mixture was then allowed to warm to RT for 18 h. The reaction mixture was then quenched with sat aq NH.sub.4Cl (100 mL) and extracted with EtOAc (3100 mL). The combined organics were dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The resulting residue was purified by normal phase silica column chromatography (EtOAc in Hex) to afford (S)-methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18FO.sub.5S) (ES, m/z): 341 [M+H].sup.+. .sup.1H NMR (CDCl.sub.3) : 7.99 (s, 1H), 7.09 (s, 1H), 4.00 (s, 3H), 3.98 (s, 3H), 3.73 (s, 3H), 3.51 (dd, J=17.0, 7.9 Hz, 1H), 3.24-3.12 (m, 1H), 3.06 (dd, J=17.0, 5.6 Hz, 1H), 1.32 (d, J=7.1 Hz, 3H).
Step 2: (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(559) ##STR00273##
(560) To a mixture of methyl (S)-4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.0 g, 2.9 mmol) and CHCCl.sub.2 (40 mL) was added AlCl.sub.3 (1.0 g, 7.5 mmol). The reaction mixture was allowed to stir at RT for 18 h. The reaction mixture was then cooled to 0 C. and diluted with MeOH (40 mL). The mixture was then allowed to warm to RT and then concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (EtOAc in Hex) to afford (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.16FO.sub.5S) (ES, m/z): 327 [M+H].sup.+. .sup.1H NMR (methanol-d.sub.4) : 8.11 (s, 1H), 7.29 (s, 1H), 3.98 (s, 3H), 3.69 (s, 3H), 3.50 (dd, J=17.5, 8.6 Hz, 1H), 3.23-3.16 (m, 1H), 3.11-3.02 (m, 1H), 1.28 (d, J=7.2 Hz, 3H).
Step 3: methyl (S)-4-(5-(2-chloroethoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(561) ##STR00274##
(562) K.sub.2CO.sub.3 (170 mg, 1.2 mmol) was added to a stirring mixture of(S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (200 mg, 0.61 mmol) and DMF (2.7 mL). 1-Bromo-2-chloroethane (50 L, 0.6 mmol) was added to the stirring reaction mixture, and the reaction mixture was then heated to 80 C. for 18 h. Upon cooling to RT, the reaction mixture was concentrated under reduced pressure. The resulting residue was purified by silica gel column chromatography (EtOAc in Hex) to afford methyl (S)-4-(5-(2-chloroethoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.17H.sub.19ClFO.sub.5S) (ES, m/z): 389 [M+H].sup.+.
(563) Intermediates 29 through 31 and 87, as shown in Table 3 below, were or may be prepared according to procedures analogous to those outlined in Intermediate 28 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(564) TABLE-US-00003 TABLE 3 Mass Intermediate Structure Name [M + H].sup.+ 29
Intermediate 32: tert-butyl 4-(5-(2-hydroxyethyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate, acetate salt
(565) ##STR00279##
Step 1: tert-butyl 4-(6-methoxy-5-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethyl)thieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(566) ##STR00280##
(567) To a 4 mL vial was added bis(di-tert-butyl(4-dimethylaminophenyl)phosphine) dichloro-palladium(II) (5.0 mg, 7.0 mol), Cs.sub.2CO.sub.3 (137 mg, 0.422 mmol), tert-butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (50.0 mg, 0.141 mmol), and potassium trifluoro(2-((tetrahydro-2H-pyran-2-yl)oxy)ethyl)borate (39.8 mg, 0.169 mmol). To the vial was added toluene (0.50 mL) and water (0.10 mL). The vial was degassed with N.sub.2 for 5 min. The mixture was heated to 100 C. for 18 h. Upon cooling to RT, the mixture was filtered through CELITE, and the CELITE was washed with EtOAc. The filtrate was concentrated under reduced pressure, and the resulting residue was purified by silica gel chromatography (0.fwdarw.75% EtOAc gradient in Hex) to afford tert-butyl 4-(6-methoxy-5-(2-((tetrahydro-2H-pyran-2-yl)oxy) ethyl)thieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.23H.sub.32NO.sub.6S) (ES, m/z): 450 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.45 (s, 1H), 7.80 (s, 1H), 4.71 (s, 1H), 4.26-4.15 (m, 1H), 4.04 (s, 3H), 3.78 (t, J=8.3 Hz, 1H), 3.65-3.42 (m, 4H), 3.33 (t, J=6.3 Hz, 2H), 2.73 (t, J=6.3 Hz, 2H), 1.64-1.48 (m, 6H), 1.46 (s, 9H).
Step 2: tert-butyl 4-(5-(2-hydroxyethyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate, acetate salt
(568) ##STR00281##
(569) To a 4 mL vial was added tert-butyl 4-(6-methoxy-5-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethyl)-thieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (28 mg, 0.062 mmol), HOAc (0.50 mL), MeOH (0.50 mL), and water (0.5 mL). The mixture was heated to 50 C. for 75 min. Upon cooling to RT, the mixture was diluted with EtOAc (30 mL) and washed with water (230 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford tert-butyl 4-(5-(2-hydroxyethyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate, acetate salt. LCMS (C.sub.18H.sub.24NO.sub.5S) (ES, m/z): 366 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.22 (s, 1H), 7.68 (s, 1H), 4.13 (t, J=5.4 Hz, 2H), 4.01 (s, 3H), 3.39-3.22 (m, 4H), 2.74 (t, J=6.5 Hz, 2H), 1.46 (s, 9H).
Intermediate 33: tert-butyl 4-(5-(3-hydroxypropyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(570) ##STR00282##
Step 1: tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(571) ##STR00283##
(572) tert-Butyl 4-(5-bromobenzo[b]thiophen-2-yl)-4-oxobutanoate (0.207 g, 0.561 mmol) and chloro(2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) (0.022 g, 0.028 mmol) were placed in a 20 mL screw cap vial with a magnetic stir bar. The vial was evacuated and backfilled with N.sub.2 3 times. The vial was capped with a N.sub.2 inlet and then THF (2.0 mL) was added. (3-((tert-butyldimethylsilyl)oxy)propyl) zinc(II) bromide (0.50M in THF, 3.4 mL, 1.7 mmol) was added dropwise with stirring. After the addition was complete, the reaction was stirred at RT under N.sub.2 for 1.5 h. The reaction was then partitioned between EtOAc (50 mL) and 10% aqueous sodium citrate (10 mL) and stirred for 30 min. The layers were then separated, and the organic layer was washed with sat aq NaCl, dried over anhydrous MgSO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel chromatography (0.fwdarw.55% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.25H.sub.38NaO.sub.4SSi) (ES, m/z): 485 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.96 (s, 1H), 7.78 (d, J=8.2 Hz, 1H), 7.70 (s, 1H), 7.33 (d, J=8.2 Hz, 1H), 3.66 (t, J=5.8 Hz, 2H), 3.31 (t, J=6.5 Hz, 2H), 2.82 (t, J=7.5 Hz, 2H), 2.73 (t, J=6.5 Hz, 2H), 1.93-1.86 (m, 2H), 1.47 (s, 9H), 0.94 (s, 9H), 0.08 (s, 6H).
Step 2: tert-butyl 4-(5-(3-hydroxypropyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(573) ##STR00284##
(574) TBAF (1.0M in THF, 0.44 mL, 0.44 mmol) was added to a stirred mixture of tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate (102 mg, 0.220 mmol) in THF (1.3 mL) at RT under N.sub.2. The resulting mixture was stirred at RT for 4.5 h. The reaction was then partitioned between Et.sub.2O and sat aq NH.sub.4Cl and stirred at RT for 1 h. The layers were separated, and the organic layer was washed with sat aq NaCl, dried over anhydrous MgSO.sub.4, filtered and concentrated under reduced pressure to afford a crude residue. The resulting residue was purified by silica gel chromatography (0.fwdarw.60% EtOAc gradient in Hex) to afford tert-butyl 4-(5-(3-hydroxypropyl)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.19H.sub.24NaO.sub.4S) (ES, m/z): 371 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.95 (s, 1H), 7.77 (d, J=8.3 Hz, 1H), 7.70 (s, 1H), 7.33 (d, J=8.3 Hz, 1H), 3.71 (t, J=6.3 Hz, 2H), 3.30 (t, J=6.7 Hz, 2H), 2.84 (t, J=7.7 Hz, 2H), 2.72 (t, J=6.7 Hz, 2H), 1.98-1.91 (m, 2H), 1.46 (s, 9H).
Intermediate 34: (S)-methyl 4-(4-fluoro-5-(3-hydroxypropoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(575) ##STR00285##
(576) To a mixture of (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (0.065 g, 0.2 mmol) and Cs.sub.2CO.sub.3 (0.33 g, 1.0 mmol) in ACN (2.0 mL) was added (3-bromopropoxy)(tert-butyl)dimethylsilane (0.10 mL, 0.20 mmol). The reaction was then heated to 65 C. for 2 h. Upon cooling to RT, the mixture was then filtered and washed with THF (5 mL). Water (2 mL) was added to the resulting filtrate followed by MP-TsOH (4.38 mmol/g loading, 1.00 g, 4.38 mmol). The mixture was then heated to 60 C. for 30 min. Upon cooling to RT, the mixture was filtered and washed with THF. The filtrate was concentrated under reduced pressure to afford (S)-methyl 4-(4-fluoro-5-(3-hydroxypropoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate that was used without further purification. LCMS (C.sub.18H.sub.22FO.sub.6S) (ES, m/z): 385 [M+H]+.
(577) Intermediates 35 through 36, as shown in Table 4 below, were or may be prepared according to procedures analogous to those outlined in Intermediate 34 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(578) TABLE-US-00004 TABLE 4 Mass Intermediate Structure Name [M + H].sup.+ 35
Intermediate 37: methyl (2S)-4-[5-(3-bromopropyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate
(579) ##STR00288##
(580) To the stirred mixture of methyl (2S)-4-[5-(3-hydroxypropyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate (187 mg, 0.534 mmol) and Ph.sub.3P (224 mg, 0.854 mmol) in THF (2.7 mL) at 0 C. was added NBS (142 mg, 0.800 mmol) in one portion under N.sub.2. The reaction mixture was stirred for 20 min at 0 C. The mixture was directly purified by silica gel flash column chromatography (EtOAc in Hex) to afford methyl (2S)-4-[5-(3-bromopropyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.22BrO.sub.4S) (ES, m/z): 413, 415 [M+H]V. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.27 (s, 1H), 7.76 (s, 1H), 7.62 (s, 1H), 3.89 (s, 3H), 3.59 (s, 3H), 3.54 (t, J=6.8 Hz, 2H), 3.43 (dd, J=17.5, 8.6 Hz, 1H), 3.19 (dd, J=17.5, 5.0 Hz, 1H), 3.02-2.92 (m, 1H), 2.79 (t, J=7.0 Hz, 2H), 2.10 (pentet, J=6.9 Hz, 2H), 1.19 (d, J=7.1 Hz, 3H).
Intermediate 38: tert-butyl 4-(5-(3-hydroxypropoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(581) ##STR00289##
Step 1: tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(582) ##STR00290##
(583) tert-Butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (265 mg, 0.745 mmol), 3-((tert-butyldimethylsilyl)oxy)propan-1-ol (156 mg, 0.819 mmol), RockPhos Pd G3 (31 mg, 0.037 mmol) and Cs.sub.2CO.sub.3 (364 mg, 1.12 mmol) were added to a 20 mL screw-cap vial with a magnetic stir bar. The vial was capped, and a N.sub.2 inlet needle was inserted. Via this needle, the vial was evacuated and backfilled with N.sub.2 three times. Under N.sub.2, toluene (2.5 mL) was added, the N.sub.2 inlet was removed, and the sealed vial was heated to 110 C. for 18 h. The reaction was allowed to cool to RT, and MeOH (3.0 mL), water (3.0 mL) and HOAc (3.0 mL) were added. The reaction mixture was stirred for 7 h at RT, then partitioned between EtOAc and sat aq NaCl. The layers were separated, and the aqueous layer was extracted with EtOAc. The organic layers were combined, washed with aq NaCl, dried over anhydrous Na.sub.2 SO.sub.4, filtered, and concentrated under reduced pressure afford a crude residue. The residue was purified by silica gel chromatography (0.fwdarw.100% 3:1 EtOAc:EtOH gradient in Hex) to afford tert-butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy) propoxy)-6-methoxythieno [3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.25H.sub.40NO.sub.6SSi) (ES, m/z): 510 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.95 (s, 1H), 7.39 (s, 1H), 4.56 (t, J=6.5 Hz, 2H), 3.94 (s, 3H), 3.83 (t, J=6.0 Hz, 2H), 3.26 (t, J=6.7 Hz, 2H), 2.70 (t, J=6.7 Hz, 2H), 2.12-2.05 (m, 2H), 1.44 (s, 9H), 0.89 (s, 9H), 0.07 (s, 6H).
Step 2: tert-butyl 4-(5-(3-hydroxypropoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(584) ##STR00291##
(585) To a vial containing tert-Butyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (83 mg, 0.16 mmol) was added MeOH (1.0 mL), water (1.0 mL) and then HOAc (1.0 mL). The resulting mixture was stirred for 30 min at RT. MeOH (1.0 mL) was added and stirring was continued. After 30 min, THF (1.0 mL) was added, and the mixture was allowed to stir for 18 h at RT. The mixture was partitioned between EtOAc (25 mL) and aq NaCl (25 mL) and stirred. The layers were separated, and the aqueous layer was extracted with EtOAc. The organic layers were combined, washed with sat aq NaCl twice, dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford a crude residue. The resulting residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex, then isocratic at 100% EtOAc) to afford tert-butyl 4-(5-(3-hydroxypropoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.19H.sub.26NO.sub.6S) (ES, m/z): 396 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 7.93 (s, 1H), 7.44 (s, 1H), 4.69 (t, J=5.6 Hz, 2H), 3.97 (s, 3H), 3.80-3.76 (m, 2H), 3.31-3.20 (m, 2H), 2.71 (t, J=6.5 Hz, 2H), 2.14-2.07 (m, 2H), 1.46 (s, 9H).
(586) Intermediate 39, as shown in Table 5 below, was or may be prepared according to procedures analogous to those outlined in Intermediate 38 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(587) TABLE-US-00005 TABLE 5 Mass Intermediate Structure Name [M + H].sup.+ 39
Intermediate 40: Methyl 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(588) ##STR00293##
Step 1: 6-(Benzyloxy)benzo[b]thiophene
(589) ##STR00294##
(590) K.sub.2CO.sub.3 (2.62 g, 19.0 mmol) was added to a mixture of benzo[b]thiophen-6-ol (1.9 g, 13 mmol) and benzyl bromide (1.51 mL, 12.7 mmol) in DMF (10.0 mL) at 20 C. under Ar. The reaction mixture was stirred and heated to 50 C. for 18 h. Upon cooling to RT, the reaction mixture was then diluted with EtOAc (500 mL) and water (100 mL). The organic layer was separated, washed with water (50 mL) and then sat aq NaCl (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford 6-(benzyloxy)benzo[b]thiophene. LCMS (C.sub.15H.sub.13OS) (ES, m/z): 241 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 7.77 (d, J=8.6 Hz, 1H), 7.67 (s, 1H), 7.54 (d, J=5.2 Hz, 1H), 7.49 (d, J=7.2 Hz, 2H), 7.44-7.38 (m, 2H), 7.37-7.32 (m, 2H), 7.08 (d, J=8.5 Hz, 1H), 5.17 (s, 2H).
Step 2: 6-(Benzyloxy)benzo[b]thiophene-2-carbaldehyde
(591) ##STR00295##
(592) LDA (2.0M in THF, 7.3 mL, 15 mmol) was added to a mixture of 6-(benzyloxy) benzo[b]thiophene (2.92 g, 12.2 mmol) in THF (10.0 mL) at 78 C. under Ar. The reaction mixture was stirred at 78 C. for 20 min. DMF (2.4 mL, 30 mmol) was added to the reaction mixture at 78 C., and the reaction mixture was then allowed to warm slowly to RT. The reaction mixture was stirred for 15 min at RT. The reaction mixture was quenched with citric acid (1.0M in water, 24 mL, 24 mmol) at 0 C. and then diluted with EtOAc (200 mL). The suspension was stirred for 15 min. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford the crude residue. The crude residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford 6-(benzyloxy)benzo [b]thiophene-2-carbaldehyde. LCMS (C.sub.16H.sub.13O.sub.2S) (ES, m/z): 269 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 10.05 (s, 1H), 8.34 (s, 1H), 8.01 (d, J=8.8 Hz, 1H), 7.78 (s, 1H), 7.50 (d, J=7.3 Hz, 2H), 7.42 (t, J=7.3 Hz, 2H), 7.40-7.33 (m, 1H), 7.20 (d, J=8.4 Hz, 1H), 5.23 (s, 2H).
Step 3: tert-Butyl 4-(6-(benzyloxy)benzo[b]thiophen-2-yl)-4-oxobutanoate
(593) ##STR00296##
(594) A mixture of 6-(benzyloxy)benzo[b]thiophene-2-carbaldehyde (2.02 g, 7.53 mmol), 2-mesityl-6,7-dihydro-5H-pyrrolo[2,1-c][1,2,4]triazol-2-ium chloride (0.099 g, 0.38 mmol), and potassium phosphate tribasic (1.6 g, 7.5 mmol) was flushed with Ar for 5 min at 20 C. Toluene (15 mL) and tert-butyl acrylate (2.2 mL, 15 mmol) were then added at 20 C. The reaction mixture was allowed to stir for 18 h at 20 C. The reaction mixture was then diluted with EtOAc (200 mL) and filtered to remove inorganic salts. The filtrate was concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford tert-butyl 4-(6-(benzyl oxy)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.23H.sub.25O.sub.4S) (ES, m/z): 397 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.35 (s, 1H), 7.96 (d, J=7.0 Hz, 1H), 7.75 (s, 1H), 7.56-7.39 (m, 2H), 7.47-7.33 (m, 3H), 7.25-7.15 (m, 1H), 5.24 (s, 2H), 3.34-3.23 (m, 2H), 2.65-2.55 (m, 2H), 1.40 (s, 9H).
Step 4: 4-(6-Hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid
(595) ##STR00297##
(596) HCl (37% in water, 19.6 mL, 238 mmol) was added to a mixture of tert-butyl 4-(6-(benzyloxy)benzo[b]thiophen-2-yl)-4-oxobutanoate (2.36 g, 5.96 mmol) in dioxane (100 mL). The reaction mixture heated to 90 C. for 2 days. The reaction mixture was cooled to RT and diluted with EtOAc (500 mL). The organic layer was separated, washed with water (3100 mL) and then sat aq NaCl (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid, which was used without further purification. LCMS (C.sub.12H.sub.11O.sub.4S) (ES, m/z): 251 [M+H].sup.+.
Step 5: Methyl 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(597) ##STR00298##
(598) TMS-diazomethane (2.0M in Hex, 3.0 mL, 6.0 mmol) was added to a mixture of 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid (1.5 g, 6.0 mmol) in DCM (25 mL) and MeOH (25 mL) at 0 C. The reaction mixture was stirred at 0 C. for 15 min (until gas evolution ceased). HOAc (several drops) was added to quench any remaining TMS-diazomethane. The reaction mixture was then concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford methyl 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.13H.sub.13O.sub.4S) (ES, m/z): 265 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 10.17 (s, 1H), 8.26 (s, 1H), 7.84 (d, J=8.7 Hz, 1H), 7.30 (s, 1H), 6.97 (d, J=8.2 Hz, 1H), 3.76-3.65 (m, 1H), 3.60 (s, 3H), 3.54-3.44 (m, 1H), 2.72-2.67 (m, 2H).
(599) Intermediate 41, as shown in Table 6 below, was or may be prepared according to procedures analogous to those outlined in Intermediate 40 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(600) TABLE-US-00006 TABLE 6 Mass Intermediate Structure Name [M + H].sup.+ 41
Intermediate 42: Methyl (S)-4-(6-(3-chloropropoxy)-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(601) ##STR00300##
Step 1: 6-(Benzyloxy)-5-methoxybenzo[b]thiophene-2-carboxylic acid
(602) ##STR00301##
(603) A mixture of 4-(benzyloxy)-2-bromo-5-methoxybenzaldehyde (13 g, 41 mmol), K.sub.2CO.sub.3 (11 g, 81 mmol), 18-Crown-6 (2.1 g, 8.1 mmol) and methyl 2-mercaptoacetate (6.0 mL, 67 mmol) in DMF (150 mL) was heated to 90 C. under Ar for 14 h. Upon cooling to RT, the reaction mixture was quenched with water (400 mL), acidified with 1N HCl to pH-5, and extracted with EtOAc (3250 mL). The combined organic layers were washed with 10% aq LiCl (350 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced. The residue was diluted with EtOAc/MeOH (50 mL/50 mL) and treated with aq LiOH (2.0M, 80 mL, 160 mmol) at 20 C. The reaction mixture was heated to 60 C. for 2 h. Upon cooling to RT, the mixture was concentrated under reduced pressure. The residue was diluted with aq NaOH (1.0M, 50 mL, 50 mmol), water (300 mL), and EtOAc (300 mL). The layers were separated, and the aqueous layer was washed with EtOAc (3200 mL). The aqueous layer was then acidified with 6N HCl to pH5, and extracted with EtOAc (3300 mL). The organics were combined, washed with sat aq NaCl (50 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was triturated with 1:1 EtOAc/PE (330 mL) and 1:1 DCM/PE (330 mL) to afford 6-(benzyloxy)-5-methoxybenzo[b]thiophene-2-carboxylic acid. LCMS (C.sub.17H.sub.15O.sub.4S) (ES, m/z): 315 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) 13.16 (br s, 1H), 7.95 (s, 1H), 7.69 (s, 1H), 7.51 (s, 1H), 7.50-7.46 (m, 2H), 7.44-7.32 (m, 3H), 5.17 (s, 2H), 3.83 (s, 3H).
Step 2: 6-(Benzyloxy)-5-methoxybenzo[b]thiophene-2-carbonyl chloride
(604) ##STR00302##
(605) DMF (0.023 mL, 0.29 mmol) was added to a mixture of 6-(benzyloxy)-5-methoxybenzo[b]thiophene-2-carboxylic acid (3.05 g, 9.70 mmol) and (COCl).sub.2 (2.55 mL, 29.1 mmol) in THF (50 mL) at 0 C. under Ar. The mixture was stirred at 0 C. for 30 min and then warmed to RT. The reaction mixture was then stirred for 2 h at RT. The reaction mixture was concentrated under reduced pressure to afford 6-(benzyloxy)-5-methoxybenzo[b]thiophene-2-carbonyl chloride, which was used without purification.
Step 3: Methyl (S)-4-(6-(benzyloxy)-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(606) ##STR00303##
(607) A mixture of (R)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (0.50M in THF, 25 mL, 13 mmol) was added slowly to a flask containing ((thiophene-2-carbonyl)oxy) copper (2.38 g, 12.5 mmol) under Ar at 0 C. The reaction mixture was stirred for 20 min at 0 C. under Ar. An Ar-degassed mixture of 6-(benzyloxy)-5-methoxybenzo[b]thiophene-2-carbonyl chloride (3.2 g, 9.6 mmol) in THF (50 mL) was then added slowly via cannula to the mixture at 0 C. The mixture was allowed to warm to RT, and then stirred for 16 h at RT. The reaction mixture was cooled to 0 C. and quenched by adding sat aq NH.sub.4Cl (50 mL), water (100 mL), and EtOAc (500 mL). The resulting biphasic mixture was warmed to RT and stirred for 1 h at RT. The mixture was then filtered through a CELITE frit, and the filtrate was partitioned in a separatory funnel. The organic layer was separated, washed with sat aq NaCl (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0.fwdarw.50% EtOAc gradient in Hex) to afford the desired product, which was repurified by silica gel chromatography (eluting 0.fwdarw.50% EtOAc in DCM) to afford (S)-methyl 4-(6-(benzyloxy)-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.22H.sub.23O.sub.5S) (ES, m/z): 399 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.22 (s, 1H), 7.72 (s, 1H), 7.52-7.47 (m, 3H), 7.42 (t, J=7.3 Hz, 2H), 7.38-7.34 (m, 1H), 5.19 (s, 2H), 3.85 (s, 3H), 3.60 (s, 3H), 3.42 (dd, J=17.5, 8.6 Hz, 1H), 3.19 (dd, J=17.4, 4.9 Hz, 1H), 3.04-2.91 (m, 1H), 1.20 (d, J=7.1 Hz, 3H).
Step 4: Methyl (S)-4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(608) ##STR00304##
(609) A mixture of (S)-methyl 4-(6-(benzyloxy)-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.60 g, 4.02 mmol) and Pd/C (1.07 g, 1.00 mmol) was degassed with Ar. EtOAc (50 mL), MeOH (50 mL), and HCl (37% in water, 0.66 mL, 8.0 mmol) were added slowly to the mixture under Ar stream. The headspace above the reaction mixture was degassed via vacuum and backfilled with H.sub.2. The reaction mixture was stirred under H.sub.2 for 3 h. The reaction mixture was filtered through CELITE, washing with EtOAc. The filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting 0.fwdarw.100% EtOAc in Hex) to afford (S)-methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.17O.sub.5S) (ES, m/z): 309 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.93 (s, 1H), 8.17 (s, 1H), 7.44 (s, 1H), 7.30 (s, 1H), 3.85 (s, 3H), 3.60 (s, 3H), 3.44-3.38 (m, 1H), 3.16 (dd, J=17.3, 4.7 Hz, 1H), 3.01-2.92 (m, 1H), 1.19 (d, J=7.0 Hz, 3H).
Step 5: Methyl (S)-4-(6-(3-chloropropoxy)-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(610) ##STR00305##
(611) A mixture of (S)-methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (141 mg, 0.457 mmol), 1-bromo-3-chloropropane (360 mg, 2.3 mmol), and K.sub.2CO.sub.3 (379 mg, 2.74 mmol) was degassed with Ar. ACN (4.0 mL) was added to the mixture, and the reaction mixture was heated to 50 C. for 18 h. Upon cooling to RT, the reaction mixture was then diluted with DCM (25 mL) and filtered. The filtrate was concentrated under reduced pressure and then purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in DCM) to afford (S)-methyl 4-(6-(3-chloropropoxy)-5-methoxybenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.22ClO.sub.5S) (ES, m/z): 385 [M+H].sup.+.
(612) Intermediate 43, as shown in Table 7 below, was or may be prepared according to procedures analogous to those outlined in Intermediate 42 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(613) TABLE-US-00007 TABLE 7 Mass Intermediate Structure Name [M + H].sup.+ 43
Intermediate 44: methyl (2S)-4-[5-(2-hydroxyethyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate
(614) ##STR00307##
(615) To the stirred mixture of methyl (2S)-4-(5-bromo-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (1.24 g, 3.34 mmol), tris(trimethylsilyl)silane (1.0 mL, 3.3 mmol), and anhydrous Na.sub.2CO.sub.3 (708 mg, 6.68 mmol) in degassed DME (16.5 mL) under N.sub.2, was added a mixture of Ir(2-(2,4-difluorophenyl)-5-(trifluoromethyl)pyridine).sub.2 (4,4-di-tert-butyl-2,2-bipyridine)PF.sub.6 (38 mg, 33 mol) in degassed DME (12 mL). A suspension of Nickel(II) chloride ethylene glycol dimethyl ether complex (3.7 mg, 17 mol) and 4,4-di-tert-butyl-2,2-bipyridine (4.5 mg, 17 mol) in degassed DME (4.5 mL) was added, and the resulting mixture was stirred under N.sub.2 for 15 min at RT. 2-Bromoethanol (835 mg, 6.68 mmol) was added in one portion under N.sub.2, and the reaction mixture was stirred and irradiated in a photo-reactor with 20% light intensity for 24 h at RT. The mixture was then filtered, and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel flash column chromatography (EtOAc in Hex) to afford methyl (2S)-4-[5-(2-hydroxyethyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate. LCMS (C.sub.17H.sub.21O.sub.5S) (ES, m/z): 337 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.26 (s, 1H), 7.76 (s, 1H), 7.58 (s, 1H), 4.64 (t, J=5.2 Hz, 1H), 3.88 (s, 3H), 3.64-3.55 (m, 2H), 3.59 (s, 3H), 3.42 (dd, J=17.5, 8.6 Hz, 1H), 3.19 (dd, J=17.5, 5.0 Hz, 1H), 3.01-2.92 (m, 1H), 2.81 (t, J=6.9 Hz, 2H), 1.19 (d, J=7.1 Hz, 3H).
Intermediate 45: tert-butyl 4-(6-methoxy-5-(3-oxopropyl)benzo[b]thiophen-2-yl)-4-oxobutanoate
(616) ##STR00308##
(617) To a 4 mL vial was added tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (30 mg, 0.079 mmol), Dess-Martin periodinane (1,1,1-Triacetoxy-1,1-dihydro-1,2-benziodoxol-3(1H)-one; 50 mg, 0.1 mmol), and DCM (1.0 mL). The mixture was stirred at RT for 1 h. The mixture was purified by silica gel chromatography (0.fwdarw.55% EtOAc gradient in Hex) to afford tert-butyl 4-(6-methoxy-5-(3-oxopropyl)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.20H.sub.24O.sub.5SNa) (ES, m/z): 399 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 9.85 (s, 1H), 7.89 (s, 1H), 7.64 (s, 1H), 3.27 (t, J=6.8 Hz, 2H), 3.05 (t, J=7.4 Hz, 2H), 2.80 (t, J=7.2 Hz, 2H), 2.72 (t, J=6.7 Hz, 2H), 1.46 (s, 9H).
Intermediate 46: tert-butyl 4-(5-amino-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(618) ##STR00309##
Step 1: tert-butyl 4-(5-((diphenylmethylene)amino)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(619) ##STR00310##
(620) To a 4 mL vial was added Cs.sub.2CO.sub.3 (252 mg, 0.773 mmol), diphenylmethanimine (129 L, 0.773 mmol), tert-butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (138 mg, 0.387 mmol), Rac BINAP Pd G3 (19 mg, 0.019 mmol), and toluene (2.0 mL). The mixture was heated to 120 C. for 3.5 h. Upon cooling to RT, the mixture was directly purified by silica gel chromatography (0.fwdarw.50% EtOAc gradient in Hex) to afford tert-butyl 4-(5-((diphenylmethylene) amino)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.29H.sub.29N.sub.2O.sub.4S) (ES, m/z): 501 [M+H].sup.+.
Step 2: tert-butyl 4-(5-amino-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(621) ##STR00311##
(622) To a 20 mL vial was added tert-butyl 4-(5-((diphenylmethylene)amino)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (146 mg, 0.291 mmol), AcOH (2.0 mL), MeOH (2.0 mL), water (2.0 mL), and THF (6.0 mL). The mixture was heated to 50 C. for 1 h. Upon cooling to RT, the mixture was then allowed to stir at RT for 24 h. The mixture was then diluted with EtOAc (50 mL) and washed with aq sat NaHCO.sub.3 (50 mL) and water (50 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The resulting residue was purified by silica gel chromatography (0.fwdarw.50% EtOAc gradient in Hex) to afford tert-butyl 4-(5-amino-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.21N.sub.2O.sub.4S) (ES, m/z): 337 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.02 (s, 1H), 7.53 (s, 1H), 4.11 (s, 3H), 3.24 (t, J=6.4 Hz, 2H), 2.74-2.70 (m, 2H), 1.46 (s, 9H).
Intermediate 47: Methyl (S)-4-(6-(3-hydroxypropoxy)-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(623) ##STR00312##
(624) A mixture of (S)-methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (25 mg, 0.081 mmol), 3-chloropropan-1-ol (10 mg, 0.1 mmol), and K.sub.2CO.sub.3 (22 mg, 0.16 mmol) was degassed with Ar. DMF (0.50 mL) was added to the mixture, and the reaction mixture was irradiated in a microwave to 100 C. for 1 h. The reaction mixture was allowed to cool to RT and then diluted with EtOAc (25 mL) and water (5 mL). The organic layer was separated, washed with additional water (5 mL) and then sat aq NaCl (5 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (eluting 0-100% [5% MeOH in EtOAc] in DCM) to afford (S)-methyl 4-(6-(3-hydroxypropoxy)-5-methoxybenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.23O.sub.6S) (ES, m/z): 367 [M+H].sup.+.
(625) Intermediate 48, as shown in Table 8 below, was or may be prepared according to procedures analogous to those outlined in Intermediate 47 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(626) TABLE-US-00008 TABLE 8 Inter- Mass mediate Structure Name [M + H].sup.+ 48
Intermediate 49: tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(627) ##STR00314##
Step 1: tert-butyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propoxy)benzo[b]thiophen-2-yl)-4-oxobutanoate
(628) ##STR00315##
(629) To a mixture of tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (3.0 g, 8.9 mmol), K.sub.2CO.sub.3 (7.4 g, 54 mmol) and ACN (20 mL) was added 2-(3-bromopropoxy)tetrahydro-2H-pyran (3.8 mL, 22 mmol). The reaction was heated to 65 C. for 4 h. Upon cooling to RT, the mixture was filtered, washed with ACN, and then the solvent was removed under reduced pressure. The resulting residue was dissolved in DCM (10 mL), and Hex (100 mL) was slowly added. The resulting precipitate was filtered, washed with Hex, and air dried to afford tert-butyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propoxy)benzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.25H.sub.34O.sub.7SNa) (ES, m/z): 501 [M+Na].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.16 (s, 1H), 7.56 (s, 1H), 7.46 (s, 1H), 4.54 (s, 1H), 4.06 (t, J=6.2 Hz, 2H), 3.83 (s, 3H), 3.78 (dt, J=9.6, 6.4 Hz, 1H), 3.69 (dd, J=13.5, 5.5 Hz, 1H), 3.52-3.45 (m, 1H), 3.41-3.35 (m, 1H), 3.20 (t, J=6.2 Hz, 2H), 2.54 (t, J=6.2 Hz, 2H), 2.02-1.95 (m, 2H), 1.71-1.62 (m, 1H), 1.58 (t, J=7.8 Hz, 1H), 1.47-1.39 (m, 3H), 1.36-1.33 (m, 10H).
Step 2: tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(630) ##STR00316##
(631) To a mixture of tert-butyl 4-(6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy) propoxy)benzo[b]thiophen-2-yl)-4-oxobutanoate (3.78 g, 7.90 mmol) and EtOH (50 mL) was added pTsOH (2.2 g, 12 mmol), and the mixture was allowed to stir at RT for 2 h. The mixture was then diluted with DCM and quenched with aq sat NaHCO.sub.3. The organic layer was then separated, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.20H.sub.26O.sub.6SNa) (ES, m/z): 417 [M+Na].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.15 (s, 1H), 7.55 (s, 1H), 7.44 (s, 1H), 4.53 (t, J=4.7 Hz, 1H), 4.05 (t, J=6.2 Hz, 2H), 3.83 (s, 3H), 3.55 (q, J=5.4 Hz, 2H), 3.20 (t, J=6.1 Hz, 2H), 2.54 (t, J=6.1 Hz, 2H), 1.88 (p, J=5.8 Hz, 2H), 1.33 (s, 9H).
(632) Intermediate 50, as shown in Table 9 below, was or may be prepared according to procedures analogous to those outlined in Intermediate 49 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(633) TABLE-US-00009 TABLE 9 Inter- Mass mediate Structure Name [M + H].sup.+ 50
Intermediate 51: Methyl 4-(5-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(634) ##STR00318##
(635) A mixture of tert-butyl 4-(5-(benzyloxy)benzo[b]thiophen-2-yl)-4-oxobutanoate (1.43 g, 3.60 mmol) and Pd/C (10% w/w, 1.5 g, 1.4 mmol) was degassed with Ar. MeOH (25 mL), EtOAc (25 mL), and HCl (37% in water, 0.59 mL, 7.2 mmol) were added slowly to the mixture under Ar stream. The headspace above the reaction mixture was degassed via vacuum and backfilled with H.sub.2. The resulting mixture was stirred under H.sub.2 for 24 h. The reaction mixture was then filtered through CELITE, and the CELITE was washed with EtOAc. The filtrate was concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford methyl 4-(5-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.13H.sub.13O.sub.4S) (ES, m/z): 265 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 9.74 (s, 1H), 8.28 (s, 1H), 7.85 (d, J=8.5 Hz, 1H), 7.36 (s, 1H), 7.07 (d, J=8.0 Hz, 1H), 3.63 (s, 3H), 2.75-2.67 (m, 2H); 2 aliphatic protons buried under solvent peak and not apparent.
Intermediate 52: methyl (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate
(636) ##STR00319##
Step 1: (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoic acid
(637) ##STR00320##
(638) To a stirred solution of (2S)-4-(5,6-dimethoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoic acid (2.0 g, 6.5 mmol) in DCM (65 mL) was added BBr.sub.3 (1M in DCM, 19.5 mL, 19.5 mmol) at 0 C. The reaction mixture was allowed to warm to RT for 2.5 h. The mixture was then cooled to 0 C., treated with water, and concentrated under reduced pressure. The residue was filtered, washed with water, and dried under high vacuum to afford (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoic acid, which was used without further purification. LCMS (C.sub.13H.sub.13O.sub.5S) ES, m/z): 281 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.18 (s, 1H), 9.78 (brs, 1H), 9.49 (brs, 1H), 8.12 (s, 1H), 7.28 (s, 1H), 7.24 (s, 1H), 3.39-3.33 (m, 1H), 3.03 (dd, J=17.2, 5.2 Hz, 1H), 2.91-2.84 (m, 1H), 1.16 (d, J=7.1 Hz, 3H).
Step 2: methyl (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate
(639) ##STR00321##
(640) To a stirred solution of (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoic acid (1.35 g, 4.82 mmol) in DCM (24 mL) and MeOH (24 mL) was added TMS-diazomethane (2M in Hex, 3.6 mL, 7.2 mmol). The mixture was left to stir for 30 min, treated with HOAc (0.28 mL, 4.8 mmol) and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0.fwdarw.10% MeOH gradient in DCM) to afford methyl (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.15O.sub.5S) (ES, m/z): 295 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 9.85 (s, 1H), 9.45 (s, 1H), 8.13 (s, 1H), 7.28 (s, 1H), 7.25 (s, 1H), 3.59 (s, 3H), 3.41-3.34 (m, 1H), 3.17-3.11 (m, 1H), 2.98-2.91 (m, 1H), 1.17 (d, J=7.1 Hz, 3H).
Intermediate 53: Methyl (2S)-4-[5,6-bis(3-hydroxypropoxy)-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate
(641) ##STR00322##
(642) A mixture of methyl (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (230 mg, 0.78 mmol), 3-chloro-1-propanol (196 L, 2.34 mmol), and K.sub.2CO.sub.3 (432 mg, 3.13 mmol) in DMF (7.8 mL) was irradiated in a microwave to 100 C. for 1 h. Upon cooling to RT, the mixture was diluted with EtOAc and sat aq NaCl. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered and then concentrated under reduced pressure. The resulting residue was purified by flash chromatography (0.fwdarw.10% MeOH gradient in DCM) to afford methyl (2S)-4-[5,6-bis(3-hydroxypropoxy)-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate. LCMS (C.sub.20H.sub.27O.sub.7S) (ES, m/z): 411 [M+H].sup.+
Intermediate 54: methyl (2S)-4-[6-(difluoromethoxy)-5-hydroxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate
(643) ##STR00323##
(644) To a frozen mixture of methyl (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (177 mg, 0.601 mmol) and KOH (1.0M in water, 120 L, 1.2 mmol) in ACN (5.5 mL) and water (0.55 mL) at 78 C. was added diethyl (bromodifluoromethyl) phosphonate (170 L, 0.96 mmol). The cooling bath was removed, and the reaction mixture was left to stir for 4 h. The mixture was diluted with EtOAc and water. The layers were separated, and the water layer was re-extracted EtOAc (3). The combined organics were dried over Na.sub.2SO.sub.4, filtered, and then concentrated under reduced pressure. The resulting mixture was purified by flash chromatography (0.fwdarw.50% EtOAc in DCM) to afford crude methyl (2S)-4-[6-(difluoromethoxy)-5-hydroxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate. The desired fractions were purified by SFC (15% MeOH (+0.25% DMEA) in CO.sub.2) to afford methyl (2S)-4-[6-(difluoromethoxy)-5-hydroxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate with a retention time of 4.4 min. LCMS (C.sub.15H.sub.15F.sub.2O.sub.5S) (ES, m/z): 345 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 10.25 (s, 1H), 8.28 (s, 1H), 7.83 (s, 1H), 7.50 (s, 1H), 7.18 (t, J=74.4 Hz, 1H), 3.59 (s, 3H), 3.44 (dd, J=17.6, 8.7 Hz, 1H), 3.20 (dd, J=17.6, 4.9 Hz, 1H), 3.01-2.94 (m, 1H), 1.19 (d, J=7.1 Hz, 3H).
Intermediate 55: Methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoate
(645) ##STR00324##
Step 1: 4-(4-Fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoic acid
(646) ##STR00325##
(647) 3,3-dimethyldihydrofuran-2,5-dione (4.6 g, 36 mmol) was added to a mixture of 4-fluoro-5,6-dimethoxybenzo[b]thiophene (3.8 g, 18 mmol) and AlCl.sub.3 (3.1 g, 23 mmol) in DCM (100 mL) at 0 C. under Ar. The reaction mixture was stirred at 0 C. for 2 h and then warmed to RT and stirred for 16 h. The reaction mixture was then quenched by slowly adding the reaction mixture to a mixture of water (200 mL) and EtOAc (500 mL) at 0 C. The resulting mixture was stirred for 1 h at 20 C. and then diluted with HCl (2.0M in water, 36 mL, 72 mmol). The organic layer was separated, washed with sat aq NaCl (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The mixture was then purified by silica gel chromatography to afford 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoic acid. LCMS (C.sub.16H.sub.18FO.sub.5S) (ES, m/z): 341 [M+H].sup.+.
Step 2: Methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoate
(648) ##STR00326##
(649) To a mixture of 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoic acid (2.3 g, 6.8 mmol) in DMF (45 mL) was added K.sub.2CO.sub.3 (2.3 g, 17 mmol). After 10 min, CH.sub.3I (2.1 mL, 34 mmol) was added, and the mixture was stirred for 18 h at RT. The mixture was then diluted with water and Et.sub.2O. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The mixture was then purified by silica gel chromatography to afford methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoate. LCMS (C.sub.17H.sub.20FO.sub.5S) (ES, m/z): 355 [M+H]+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.32 (s, 1H), 7.59 (s, 1H), 3.92 (s, 3H), 3.85 (s, 3H), 3.57 (s, 3H), 3.44 (s, 2H), 1.23 (s, 6H).
Step 3: Methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoate
(650) ##STR00327##
(651) To a mixture of methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoate (1.1 g, 3.1 mmol) and DCM (20 mL) was added AlCl.sub.3 (1.7 g, 12 mmol). The reaction mixture was stirred at RT for 18 h. The reaction mixture was poured into a flask containing ice and 1N HCl and stirred for 5 min. EtOAc was then added. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The mixture was then purified by silica gel chromatography to afford methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2,2-dimethyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18F.sub.5OS) (ES, m/z): 341 [M+H].sup.+. 1H NMR (500 MHz, DMSO-d.sub.6) 9.55 (s, 1H), 8.24 (s, 1H), 7.47 (s, 1H), 3.91 (s, 3H), 3.57 (s, 3H), 3.43 (s, 2H), 1.23 (s, 6H).
Intermediate 56: tert-Butyl (1S,2R and 1R,2S)-2-(5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropane-1-carboxylate
(652) ##STR00328##
Step 1: (1S,2R and 1R,2S)-2-(5-Bromo-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropane-1-carboxylic acid
(653) ##STR00329##
(654) 3-Oxabicyclo[3.1.0]hexane-2,4-dione (3.78 g, 33.7 mmol) was added to a mixture of 5-bromo-6-methoxybenzo[b]thiophene (4.1 g, 17 mmol) and AlCl.sub.3 (2.92 g, 21.9 mmol) in DCM (100 mL) at 0 C. under Ar. The reaction mixture was stirred at 0 C. for 2 h and then allowed to warm to RT. The reaction mixture was stirred at RT for 16 h. The reaction mixture was then quenched by slowly adding the reaction mixture to a mixture of water (200 mL) and EtOAc (500 mL) at 0 C. The resulting mixture was allowed to warm to RT and stirred for 1 h. The mixture was then diluted with HCl (2.0M in water, 34 mL, 68 mmol). The organic layer was separated, washed with sat aq NaCl (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (eluting 0-100% [5% MeOH in EtOAc] in DCM) to afford (1S,2R and 1R,2S)-2-(5-bromo-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropane carboxylic acid. LCMS (C.sub.14H.sub.12BrO.sub.4S) (ES, m/z): 355, 357 [M+H].sup.+.
Step 2: tert-Butyl (1S,2R and 1R, 2S)-2-(5-bromo-6-methoxybenzo[b]thiophene-2-carbonyl) cyclopropane-1-carboxylate
(655) ##STR00330##
(656) tert-Butanol (25.8 mL, 270 mmol) was added to a mixture of BOC-anhydride (6.3 mL, 27 mmol), DMAP (0.33 g, 2.7 mmol), and (1S,2R and 1R,2S)-2-(5-bromo-6-methoxy benzo[b]thiophene-2-carbonyl)cyclopropanecarboxylic acid (4.8 g, 14 mmol) in DCE (30 mL) at RT under Ar. The reaction mixture was stirred and heated to 50 C. for 2 h. The reaction mixture was then cooled to RT and concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in Hex) to afford (1S,2R and 1R,2S)-tert-butyl 2-(5-bromo-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropanecarboxylate. LCMS (C.sub.18H.sub.20BrO.sub.4SC.sub.4H.sub.8) (ES, m/z): 355, 357 [M+H-tBu].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 8.33 (s, 1H), 8.26 (s, 1H), 7.81 (s, 1H), 3.95 (s, 3H), 3.10-3.03 (m, 1H), 2.32-2.25 (m, 1H), 1.57-1.52 (m, 1H), 1.32-1.28 (m, 1H), 1.14 (s, 9H).
Step 3: tert-Butyl (1S,2R and 1R,2S)-2-(5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl) cyclopropane-1-carboxylate
(657) ##STR00331##
(658) A mixture of (1 S,2R and 1R,2S)-tert-butyl 2-(5-bromo-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropanecarboxylate (1.64 g, 3.99 mmol), RockPhos Pd G3 (0.100 g, 0.120 mmol), Cs.sub.2CO.sub.3 (3.90 g, 12.0 mmol), and (E)-benzaldehyde oxime (0.725 g, 5.98 mmol) was degassed with Ar for 5 min. DMF (10.0 mL) was added under Ar, and the mixture was then degassed with Ar for 5 min. The reaction mixture was stirred and heated to 80 C. for 18 h. The reaction mixture was cooled to RT and diluted with water (100 mL) and EtOAc (250 mL). The organic layer was separated, washed with water (50 mL) and then sat aq NaCl (50 mL). The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.75% EtOAc gradient in Hex) to afford (1 S,2R and 1R,2S)-tert-butyl 2-(5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl) cyclopropanecarboxylate. LCMS (C.sub.18H.sub.20O.sub.5SNa) (ES, m/z): 371 [M+Na]+.
Intermediate 57: (S)-Methyl-4-(5-amino-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoatexylate
(659) ##STR00332##
Step 1: Methyl (S)-4-(5-((diphenylmethylene)amino)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(660) ##STR00333##
(661) A mixture of (S)-methyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (0.50 g, 1.4 mmol), benzophenone imine (0.45 mL, 2.7 mmol), Rac BINAP Pd G3 (0.067 g, 0.067 mmol), and Cs.sub.2CO.sub.3 (0.878 g, 2.69 mmol) was degassed with Ar for 5 min. Toluene (10.0 mL) was added at 20 C. under Ar, and the mixture was then degassed with Ar for 5 min. The reaction mixture was stirred and heated to 110 C. for 18 h under Ar. The reaction mixture was then cooled to RT and diluted with DCM (25 mL). The mixture was filtered, and the filtrate was concentrated under reduced pressure to afford methyl (S)-4-(5-((diphenylmethylene) amino)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate, which was used without purification. LCMS (C.sub.28H.sub.26NO.sub.4S) (ES, m/z): 472 [M+H].sup.+.
Step 2: (S)-Methyl 4-(5-amino-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(662) ##STR00334##
(663) TFA (2.1 mL, 27 mmol) was added to a mixture of (S)-methyl 4-(5-((diphenyl methylene)amino)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (635 mg, 1.35 mmol) in DCM (5.0 mL) at 20 C. The resulting mixture was stirred at 20 C. for 30 min. The reaction mixture was then concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc gradient in DCM) to afford (S)-methyl 4-(5-amino-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.8NO.sub.4S) (ES, m/z): 308 [M+H].sup.+.
Intermediate 58: tert-Butyl 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(664) ##STR00335##
(665) A mixture of tert-butyl 4-(6-(benzyloxy)benzo[b]thiophen-2-yl)-4-oxobutanoate (256 mg, 0.646 mmol) and Pd/C (172 mg, 0.161 mmol) was degassed with Ar. EtOAc (5.0 mL), MeOH (5.0 mL), and HCl (37% in water, 0.053 mL, 0.65 mmol) were added slowly to the mixture under Ar. The headspace above the reaction mixture was degassed via vacuum and backfilled with H.sub.2. The resulting mixture was stirred under H.sub.2 for 24 h. The reaction mixture was then filtered through CELITE, washing with EtOAc. The filtrate was concentrated under reduced pressure to afford the crude product residue. The crude product residue was purified by silica gel chromatography (eluting 0.fwdarw.100% EtOAc in Hex) to afford tert-butyl 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.19O.sub.4SC.sub.4H.sub.8) (ES, m/z): 251 [M+H-tBu].sup.+.
Intermediate 59: tert-butyl 4-(5-bromobenzo[b]thiophen-2-yl)-4-oxobutanoate
(666) ##STR00336##
Step 1: 5-bromobenzo[b]thiophene-2-carbonyl chloride
(667) ##STR00337##
(668) (COCl).sub.2 (0.30 mL, 3.4 mmol) was added dropwise with stirring to a 0 C. mixture of 5-bromobenzo[b]thiophene-2-carboxylic acid (0.750 g, 2.92 mmol) in CH.sub.2Cl.sub.2 (15 mL) over 3 min. To the reaction was added DMF (0.023 mL, 0.29 mmol) followed by additional (COCl).sub.2 (0.20 mL, 2.3 mmol). The reaction mixture was then stirred at 0 C. for 1 h. The reaction flask was removed from the ice water bath, and stirring was continued at RT for 1.5 h. The reaction was concentrated to afford 5-bromobenzo[b]thiophene-2-carbonyl chloride, which was used without further purification or characterization.
Step 2: tert-butyl 4-(5-bromobenzo[b]thiophen-2-yl)-4-oxobutanoate
(669) ##STR00338##
(670) CuCl (0.269 g, 2.72 mmol) was added to a 100 mL round bottom flask with a stir bar. The flask was evacuated and then backfilled with N.sub.2 three times. THF (6.0 mL) was added to the flask, which was then stirred and cooled to 0 C. with an ice water bath. (3-(tert-butoxy)-3-oxopropyl)zinc(II) bromide (0.50M in THF, 11 mL, 5.5 mmol) was added dropwise with stirring at 0 C. over a period of 3 min to the CuCl mixture. The resulting mixture was stirred at 0 C. for 30 min. A mixture of 5-bromobenzo[b]thiophene-2-carbonyl chloride (0.75 g, 2.7 mmol) in NMP (24 mL) was added dropwise to the mixture over a period of 7 min at 0 C. with stirring. The resulting mixture was stirred at 0 C. for 2 h. The reaction mixture was then partitioned between isopropyl acetate (300 mL) and 10% aq. sodium citrate (300 mL). The resulting mixture was stirred for 20 min. The layers were separated, and the aqueous layer was extracted with isopropyl acetate (150 mL). The organic layers were combined, washed with aq NaCl, then sat aq NaCl, dried over anhydrous MgSO.sub.4, and filtered, and the filtrate was allowed to stand overnight. The filtrate was then filtered, and the filtrate concentrated to afford a crude residue. The crude residue was loaded onto a silica gel column with acetone. The column was dried by blowing pressurized N.sub.2 through it. The dried column was then subjected to a 0.fwdarw.30% EtOAc gradient with Hex. All product-containing fractions were collected, concentrated, and purified by silica gel chromatography (0.fwdarw.25% EtOAc gradient in Hex). The product-containing fractions were concentrated and purified by achiral SFC (Phenomenex biphenyl, 21 mm250 mm column, 90:10 CO.sub.2:MeOH w/0.25% DMEA, 70 mL/min, 100 bar outlet pressure, 18.5 mg/mL in MeOH/MeCN loading concentration, 1.6 mL injection volume, 215 nm detection) to afford tert-butyl 4-(5-bromobenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.17BrNaO.sub.3S) (ES, m/z): 391, 393 [M+Na].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.05 (s, 1H), 7.94 (s, 1H), 7.75 (d, J=8.6 Hz, 1H), 7.57 (d, J=8.6 Hz, 1H), 3.31 (t, J=6.6 Hz, 2H), 2.74 (t, J=6.6 Hz, 2H), 1.46 (s, 9H).
Intermediate 60: tert-Butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate
(671) ##STR00339##
(672) A flask containing CuCl (0.76 g, 7.6 mmol) was evacuated and then purged three times with N.sub.2. THF (15 mL) was added, and the mixture was cooled to 0 C. (3-(tert-butoxy)-3-oxopropyl)zinc(II) bromide (0.50M in THF, 31 mL, 16 mmol) was added dropwise over 10 min. After 30 min, 5-chloro-6-methoxythieno[3,2-b]pyridine-2-carbonyl chloride (2.0 g, 7.6 mmol) was added followed by NMP (15 mL). The mixture was then allowed to warm to RT. After 1 h, the mixture was cooled to 0 C., and concentrated aq NH.sub.4OH (4.5 mL) was added. To this mixture was added water (240 mL) and MeOH (60 mL). The mixture was stirred for 5 min and sonicated in a water bath sonicator. The resulting mixture was filtered, and the precipitates were washed with water and then Hex. The precipitates were isolated and dried under vacuum. The precipitates were then partitioned between EtOAc and 10% aqueous sodium citrate. The layers were separated, and the aqueous layer was washed with EtOAc. The combined organic layers were dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. During the concentration, precipitation occurred, and the precipitates were collected via filtration, washed with EtOAc, and dried under vacuum to afford tert-butyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate. LCMS (C.sub.16H.sub.19ClNO.sub.4S) (ES, m/z): 356 [M+H].sup.+. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.03 (s, 1H), 7.62 (s, 1H), 4.04 (s, 3H), 3.30 (t, J=6.4 Hz, 2H), 2.74 (t, J=6.4 Hz, 2H), 1.46 (s, 9H).
Intermediate 61: methyl (S)-4-(2-(3-bromopropyl)-4-methoxythieno[2,3:5,6]benzo[1,2-d]oxazol-7-yl)-2-methyl-4-oxobutanoate
(673) ##STR00340##
Step 1: methyl (S)-4-(5-hydroxy-6-methoxy-4-nitrobenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(674) ##STR00341##
(675) To a 20 mL vial was added (S)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (100 mg, 0.21 mmol) and EtOAc (3.0 mL). HNO.sub.3 (0.017 mL, 0.27 mmol) was added, and the mixture was allowed to stir for 1 h. After 1 h, the mixture was concentrated under reduced pressure and then triturated with Et.sub.2O (3.0 mL). The resulting materials were collected by filtration to afford (S)-methyl 4-(5-hydroxy-6-methoxy-4-nitrobenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoate. .sup.1H NMR (500 MHz, CDCl.sub.3) 12.08 (s, 1H), 8.75 (s, 1H), 7.53 (s, 1H), 4.07 (s, 3H), 3.74 (s, 3H), 3.59 (dd, J=17.1, 7.9 Hz, 1H), 3.23-3.16 (m, 1H), 3.16-3.09 (m, 1H), 1.35 (d, J=7.1 Hz, 3H).
Step 2: methyl (S)-4-(2-(3-bromopropyl)-4-methoxythieno[2,3:5,6]benzo[1,2-d]oxazol-7-yl)-2-methyl-4-oxobutanoate
(676) ##STR00342##
(677) To a 4 mL vial was added (S)-methyl 4-(5-hydroxy-6-methoxy-4-nitrobenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (45 mg, 0.13 mmol), Pd (0.040 g, 0.038 mmol), and MeOH (0.60 mL). To the mixture was added 4-bromo-1,1,1-trimethoxybutane (0.61 mL, 3.8 mmol). The mixture was stirred under H.sub.2 for 1 h. The mixture was then filtered, and the filtrate was concentrated under reduced pressure. The resulting residue was purified by silica gel chromatography (0.fwdarw.70% EtOAc gradient in Hex) to afford (S)-methyl 4-(2-(3-bromopropyl)-4-methoxythieno[2,3:5,6]benzo[1,2-d]oxazol-7-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.19H.sub.21BrNO.sub.5S) (ES, m/z): 454, 456 [M+H].sup.+. 1H NMR (500 MHz, CDCl.sub.3) 8.36 (s, 1H), 7.25 (s, 1H), 4.11 (s, 3H), 3.73 (s, 3H), 3.62 (t, J=6.4 Hz, 2H), 3.55 (dd, J=16.7, 7.5 Hz, 1H), 3.24 (t, J=7.3 Hz, 2H), 3.18 (dd, J=13.5, 6.8 Hz, 1H), 3.12 (dd, J=16.7, 5.8 Hz, 1H), 2.53 (p, J=6.8 Hz, 2H), 1.32 (d, J=7.0 Hz, 3H).
Intermediate 88: Methyl (S)-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methylbutanoate
(678) ##STR00343##
(679) To a cooled solution of methyl (S)-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (0.637 g, 1.72 mmol) in ACN (15 mL) was added TMS-Cl (1.32 mL, 10.3 mmol). Sodium cyanoborohydride (0.65 g, 10 mmol) was added, and the reaction mixture was stirred at 0 C. for 2 h. The reaction mixture was quenched with sat. aq. NH.sub.4Cl and extracted with DCM. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/hexanes) to afford methyl (S)-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methylbutanoate. .sup.1H NMR (600 MHz, DMSO-.sub.6) 7.96 (s, 1H), 7.66 (s, 1H), 7.04 (s, 1H), 3.88 (s, 3H), 3.61 (s, 3H), 2.87-2.83 (m, 2H), 2.57-2.52 (m, 1H), 2.00-1.94 (m, 1H), 1.82-1.73 (m, 1H), 1.14 (d, J=7.0 Hz, 3H).
(680) Intermediates 89 through 93, as shown in Table 10 below, was or may be prepared according to procedures analogous to those outlined in Intermediate 88 above using the appropriate starting materials, described as Preparations or as obtained from commercial sources.
(681) TABLE-US-00010 TABLE 10 Inter- Mass mediate Structure Name [M + H].sup.+ 89
Intermediate 94: Methyl (2S)-4-(5-(3-hydroxy-2-methylpropoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(682) ##STR00349##
(683) A mixture of 2-methylpropane-1,3-diol (146 mg, 1.62 mmol), (S)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (50 mg, 0.16 mmol), (E)-bis(4-chlorobenzyl) diazene-1,2-dicarboxylate (60 mg, 0.16 mmol), and triphenylphosphine (43 mg, 0.16 mmol) in NMP (0.30 mL) was degassed with Ar and then stirred and heated to 100 C. for 3 h. The reaction mixture was cooled to RT and purified directly by reverse phase HPLC (ACN/water with 0.1% TFA) to afford (2S)-methyl 4-(5-(3-hydroxy-2-methylpropoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.19H.sub.25O.sub.6S) (ES, m/z): 381 [M+H].sup.+.
Intermediate 95: 4-(5-(3-Bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile
(684) ##STR00350##
Step 1: 4-(5-(3-((tert-Butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile
(685) ##STR00351##
(686) 4-(5-Bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile (161 mg, 0.496 mmol) and CPhos Pd G3 (20 mg, 0.025 mmol) were added to THF (2.5 mL). The reaction mixture was sealed, and the headspace above the reaction mixture was evacuated and backfilled with nitrogen (3). 3-(tert-Butyldimethylsiloxy)propylzinc bromide (0.50M in THF, 3.0 mL, 1.5 mmol) was added to the reaction mixture, and the reaction mixture was stirred at RT for 96 h. The reaction mixture was diluted with EtOAc and then extracted with aq NaHCO.sub.3. The aqueous layer was separated and extracted with EtOAc (3). The organic layers were combined, washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxy-benzo[b]thiophen-2-yl)-4-oxobutanenitrile. LCMS (C.sub.22H.sub.32NO.sub.3SSi) (ES, m/z): 418 [M+H].sup.+.
Step 2: 4-(5-(3-Hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile
(687) ##STR00352##
(688) 4-(5-(3-((tert-Butyldimethyl silyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile (165 mg, 0.395 mmol) was suspended in a mixture of MeOH (2.0 mL), water (2.0 mL), and HOAc (2.0 mL). The resulting suspension was stirred at RT for 19 h. The reaction mixture was diluted with aq NaHCO.sub.3 and then extracted with EtOAc (3). The organic layers were combined, washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile. LCMS (C.sub.16H.sub.18NO.sub.3S) (ES, m/z): 304 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.27 (s, 1H), 7.75 (s, 1H), 7.61 (s, 1H), 4.50-4.47 (m, 1H), 3.90 (s, 3H), 3.53-3.40 (m, 4H), 2.79 (t, J=6.5 Hz, 2H), 2.68 (t, J=7.4 Hz, 2H), 1.79-1.66 (m, 2H).
Step 3: 4-(5-(3-Bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile
(689) ##STR00353##
(690) Triphenylphosphine (39 mg, 0.15 mmol) was added to a solution of 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile (45 mg, 0.15 mmol) in THF (1.0 mL). The mixture was cooled to 0 C., and then NBS (26 mg, 0.15 mmol) was added. After 1 h additional triphenylphosphine (23 mg, 0.089 mmol) and NBS (13 mg, 0.074 mmol) were added to the reaction mixture. The mixture was stirred for an additional 10 min at 0 C. The reaction mixture was quenched with aq sat NH.sub.4Cl and then diluted with EtOAc. The organic layer was separated, washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford 4-(5-(3-bromopropyl)-6-methoxy-benzo[b]thiophen-2-yl)-4-oxobutanenitrile. LCMS (C.sub.16H.sub.17BrNO.sub.2SNa) (ES, m/z): 388, 390 [M+Na].sup.+.
Intermediate 96: Methyl (S)-4-(6-(3-chloropropoxy)-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate
(691) ##STR00354##
Step 1: 6-Bromothieno[3,2-b]pyridine
(692) ##STR00355##
(693) AcOH (50 mL) was added to a mixture of 2-bromomalonaldehyde (3.56 g, 23.6 mmol) and tert-butyl thiophen-3-ylcarbamate (4.70 g, 23.6 mmol) at RT under air atmosphere. The reaction mixture was stirred and heated to 100 C. for 24 h. The reaction mixture was then cooled to RT and diluted with EtOAc (300 mL). Sat aq NaHCO.sub.3 was added until gas evolution ceased. The organic layer was separated, washed with brine (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting EtOAc in Hex) to afford 6-bromothieno[3,2-b]pyridine. LCMS (C.sub.7H.sub.5BrNS) (ES, m/z): 214, 216 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.86 (s, 1H), 8.74 (s, 1H), 8.18 (d, J=5.4 Hz, 1H), 7.58 (d, J=5.4 Hz, 1H).
Step 2: 6-Bromothieno[3,2-b]pyridine 4-oxide
(694) ##STR00356##
(695) mCPBA (1.49 g, 6.63 mmol) was added to a mixture of 6-bromothieno[3,2-b]pyridine (1.42 g, 6.63 mmol) in DCM (50 mL) at 0 C. under Ar. The reaction mixture was then allowed to warm to RT and stirred for an additional 24 h. The reaction mixture was then concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting [5% MeOH in EtOAc] in DCM) to afford 6-bromothieno[3,2-b]pyridine 4-oxide. LCMS (C.sub.7H.sub.5BrNOS) (ES, m/z): 230, 232 [M+H].sup.+.
Step 3: 6-Bromothieno[3,2-b]pyridin-5-yl acetate
(696) ##STR00357##
(697) Acetic anhydride (20 mL, 210 mmol) was added to 6-bromothieno[3,2-b]pyridine 4-oxide (1.38 g, 6.00 mmol) at RT under N.sub.2(g). The reaction mixture was then heated to 140 C. and stirred for 4 h. The reaction mixture was then cooled to RT and diluted with EtOAc (200 mL) and H.sub.2O (200 mL). NaHCO.sub.3 was slowly added portionwise to the reaction mixture until all gas evolution ceased. The organic layer was separated, washed with brine (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting [5% MeOH in EtOAc] in DCM) to afford 6-bromothieno[3,2-b] pyridin-5-yl acetate. LCMS (C.sub.9H.sub.7BrNO.sub.2SC.sub.2H.sub.2O) (ES, m/z): 230, 232 [M+H-acetate].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.04 (s, 1H), 8.29 (d, J=5.2 Hz, 1H), 7.54 (d, J=5.4 Hz, 1H), 2.41 (s, 3H).
Step 4: 6-Bromothieno[3,2-b]pyridin-5-ol
(698) ##STR00358##
(699) NaOH (2.0M in H.sub.2O, 4.0 mL, 8.0 mmol) was added to a solution of 6-bromothieno [3,2-b]pyridin-5-yl acetate (431 mg, 1.58 mmol) in MeOH (5.0 mL) at 20 C. under N.sub.2(g). The reaction mixture was then stirred for 1 h at 20 C. The reaction mixture was quenched with HCl (1.0M in H.sub.2O, 8.0 mL, 8.0 mmol) and then diluted by the addition of H.sub.2O (10 mL). The reaction mixture was stirred for 30 min and then filtered. The collected material was washed with additional H.sub.2O (10 mL) and then dried under reduced pressure to afford 6-bromothieno[3,2-b]pyridin-5-ol. LCMS (C.sub.7H.sub.5BrNOS) (ES, m/z): 230, 232 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 12.65 (s, 1H), 8.59 (s, 1H), 7.91 (d, J=5.3 Hz, 1H), 6.99 (d, J=5.1 Hz, 1H).
Step 5: 6-Bromo-5-chlorothieno[3,2-b]pyridine
(700) ##STR00359##
(701) Phosphorus oxychloride (15.2 mL, 163 mmol) was added to 6-bromothieno[3,2-b]pyridin-5-ol (375 mg, 1.63 mmol) at 20 C. under N.sub.2(g). The reaction mixture was then stirred and heated to 100 C. for 2 days. The reaction mixture was cooled to RT and quenched by the dropwise addition of the reaction mixture to a solution of aq sat NaHCO.sub.3 solution. The reaction mixture was further diluted with EtOAc (250 mL) and stirred. The organic layer was separated, washed with brine (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford 6-bromo-5-chlorothieno[3,2-b]pyridine which was used without purification. LCMS (C.sub.7H.sub.4BrClNS) (ES, m/z): 248, 250 [M+H].sup.+.
Step 6: 6-Bromo-5-methoxythieno[3,2-b]pyridine
(702) ##STR00360##
(703) NaOMe (25% in MeOH, 3.24 mL, 14 mmol) was added to a mixture of 6-bromo-5-chlorothieno[3,2-b]pyridine (352 mg, 1.42 mmol) in MeOH (10 mL) at 20 C. under N.sub.2(g). The reaction mixture was stirred and heated to 100 C. for 1 h in a microwave reactor. The reaction mixture was quenched with citric acid (1.0M in H.sub.2O, 28 mL, 28 mmol) and diluted with EtOAc (250 mL). The organic layer was separated, washed with brine (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (eluting [5% MeOH in EtOAc] in DCM) to afford 6-bromo-5-methoxythieno [3,2-b]pyridine. LCMS (C.sub.8H.sub.7BrNOS) (ES, m/z): 244, 246 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.78 (s, 1H), 8.09 (d, J=5.3 Hz, 1H), 7.44 (d, J=5.2 Hz, 1H), 3.99 (s, 3H).
Step 7: 6-Bromo-5-methoxythieno[3,2-b]pyridine-2-carboxylic acid
(704) ##STR00361##
(705) LDA (2.0M in THF, 12.3 mL, 24.6 mmol) was added to a solution of 6-bromo-5-methoxythieno[3,2-b]pyridine (5.0 g, 20 mmol) in THF (100 mL) at 78 C. The mixture was aged for 15 min, and was then quenched by the addition of CO.sub.2(g) at 78 C. The reaction mixture was then warmed to 0 C. over 10 min. The reaction mixture was quenched with HCl (2.0M in water, 12.3 mL, 24.6 mmol) at 0 C. and then diluted with EtOAc (500 mL). The organic layer was separated, washed with brine (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was suspended in DCM (90 mL) and stirred for 1 h. Hex (250 mL) were then added dropwise via an addition funnel over a period of 4 h at RT. The resulting suspension was then stirred for an additional 16 h at RT. The suspension was then filtered, and the residue was washed with a 4:1 mixture of Hex/DCM (50 mL). The residue was dried under vacuum to afford 6-bromo-5-methoxythieno[3,2-b]pyridine-2-carboxylic acid. LCMS (C.sub.9H.sub.7BrNO.sub.3S) (ES, m/z): 288, 290 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 13.79 (s, 1H), 8.87 (s, 1H), 7.93 (s, 1H), 4.01 (s, 3H).
Step 8: 6-Bromo-5-methoxythieno[3,2-b]pyridine-2-carbonyl chloride
(706) ##STR00362##
(707) DMF (8 l, 0.1 mmol) was added to a solution of 6-bromo-5-methoxythieno[3,2-b]pyridine-2-carboxylic acid (1.05 g, 3.64 mmol) and oxalyl chloride (0.64 mL, 7.3 mmol) in THF (40 mL) at 0 C. under Ar. The reaction mixture was stirred at 0 C. for 1 h. The reaction mixture was concentrated under reduced pressure to afford 6-bromo-5-methoxythieno[3,2-b]pyridine-2-carbonyl chloride, which was used directly in the subsequent step.
Step 9: Methyl (S)-4-(6-bromo-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate
(708) ##STR00363##
(709) A solution of (R)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (0.5M in THF, 14.6 mL, 7.29 mmol) was added slowly to an oven-dried flask containing copper(I) chloride (0.361 g, 3.64 mmol) under Ar at 0 C. The reaction mixture was stirred for 20 min at 0 C. under Ar. An Ar-degassed solution of 6-bromo-5-methoxythieno[3,2-b]pyridine-2-carbonyl chloride (1.12 g, 3.64 mmol) in THF (10 mL) and NMP (5.0 mL) was then added slowly via cannula to the reaction mixture at 0 C.; the resulting solution was warmed to RT and was stirred for an additional 18 h at RT. The reaction mixture was cooled to 0 C. and quenched by the addition of a solution of sat aq NH.sub.4Cl (50 mL) and EtOAc (100 mL). The resulting biphasic mixture was warmed to RT and stirred for an additional 1 h. The mixture was then filtered, and the filtrate was diluted with additional EtOAc (250 mL) and brine (50 mL). The organic layer was separated, washed with additional brine (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford (S)-methyl 4-(6-bromo-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.15BrNO.sub.4S) (ES, m/z): 372, 374 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.87 (s, 1H), 8.37 (s, 1H), 4.02 (s, 3H), 3.59 (s, 3H), 3.52 (dd, J=17.9, 8.7 Hz, 1H), 3.27 (dd, J=18.0, 4.5 Hz, 1H), 3.03-2.91 (m, 1H), 1.20 (d, J=7.1 Hz, 3H).
Step 10: (S)-(5-Methoxy-2-(4-methoxy-3-methyl-4-oxobutanoyl)thieno[3,2-b]pyridin-6-yl)boronic acid
(710) ##STR00364##
(711) A mixture of (S)-methyl 4-(6-bromo-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate (700 mg, 1.88 mmol), 4,4,4,4,5,5,5,5-octamethyl-2,2-bi(1,3,2-dioxaborolane) (597 mg, 2.351 mmol), Pd.sub.2(dba).sub.3 (43 mg, 0.047 mmol), tricyclohexylphosphine (53 mg, 0.19 mmol), and potassium acetate (oven dried) (295 mg, 3.01 mmol) was degassed with Ar for 5 min. Dioxane (15 mL) was added at RT, and the resulting mixture was degassed with Ar for 5 min. The reaction mixture was then heated to 80 C. and stirred for 18 h under Ar. The reaction mixture was cooled to RT and then diluted with EtOAc (20 mL). The suspension was stirred at RT for 10 min, and then filtered through CELITE, washing with EtOAc (20 mL). The filtrate was concentrated under reduced pressure to afford (S)-(5-methoxy-2-(4-methoxy-3-methyl-4-oxobutanoyl)thieno[3,2-b]pyridin-6-yl)boronic acid, which was used without purification in the subsequent step. LCMS (C.sub.14H.sub.17BNO.sub.6S) (ES, m/z): 338 [M+H].sup.+.
Step 11: Methyl (S)-4-(6-hydroxy-5-methoxythieno f3,2-b/pyridin-2-yl)-2-methyl-4-oxobutanoate
(712) ##STR00365##
(713) A solution of OXONE (KHSO.sub.5.KHSO.sub.4.K.sub.2SO.sub.4; 0.2M in water, 14.10 mL, 2.82 mmol) was added to a mixture of (S)-(5-methoxy-2-(4-methoxy-3-methyl-4-oxobutanoyl) thieno[3,2-b]pyridin-6-yl)boronic acid (634 mg, 1.88 mmol) in acetone (20 mL) at RT. The reaction mixture was stirred at RT for 30m. The reaction mixture was quenched by the addition of a solution of sodium bisulfite (587 mg, 5.64 mmol) in water (5 mL) and then stirred for 5 min. The reaction mixture was diluted with DCM (200 mL). The organic layer was separated, and the aqueous layer was washed with additional DCM (250 mL). The organic layers were combined, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford (S)-methyl 4-(6-hydroxy-5-methoxythieno [3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.16NO.sub.5S) (ES, m/z): 310 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 10.46 (s, 1H), 8.23 (s, 1H), 7.66 (s, 1H), 3.97 (s, 3H), 3.60 (s, 3H), 3.44 (dd, J=17.5, 8.6 Hz, 1H), 3.20 (dd, J=17.5, 5.0 Hz, 1H), 3.00-2.92 (m, 1H), 1.19 (d, J=7.2 Hz, 3H).
Step 12: Methyl (S)-4-(6-(3-chloropropoxy)-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate
(714) ##STR00366##
(715) 1-Bromo-3-chloropropane (244 mg, 1.55 mmol) was added to a mixture of (S)-methyl 4-(6-hydroxy-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate (96 mg, 0.31 mmol) and potassium carbonate (257 mg, 1.86 mmol) in DMF (1.0 mL) at RT. The reaction mixture was stirred and heated to 50 C. for 4 h. The reaction mixture was cooled to RT and filtered, and then the solvate was purified directly by silica gel chromatography (EtOAc/DCM) to afford (S)-methyl 4-(6-(3-chloropropoxy)-5-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.17H.sub.21ClNO.sub.5S) (ES, m/z): 386 [M+H].sup.+.
Intermediate 97: Methyl (S)-4-(5-(3-bromopropyl)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(716) ##STR00367##
Step 1: Methyl (S)-4-(4-fluoro-6-methoxy-5-(((trifluoromethyl)sulfonyl)oxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(717) ##STR00368##
(718) Methyl (S)-4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (750 mg, 2.30 mmol), DCM (10 mL), Hunig's base (2.0 mL, 11 mmol), and trifluoromethanesulfonic anhydride (1.0M in DCM, 3.5 mL, 3.5 mmol) were combined. The reaction mixture was stirred at RT for 20 min. The reaction mixture was then quenched with water and diluted with DCM. The organic layer was separated, washed with sat NaHCO.sub.3, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford (S)-methyl 4-(4-fluoro-6-methoxy-5-(((trifluoromethyl)sulfonyl)oxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.15F.sub.4O.sub.7S.sub.2) (ES, m/z): 459 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.52 (s, 1H), 7.93 (s, 1H), 4.03 (s, 3H), 3.61 (s, 3H), 3.53 (dd, J=17.8, 8.7 Hz, 1H), 3.27 (dd, J=17.8, 5.0 Hz, 1H), 3.05-2.92 (m, 1H), 1.21 (d, J=7.2 Hz, 3H).
Step 2: Methyl (2S)-4-(4-fluoro-6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(719) ##STR00369##
(720) (S)-Methyl 4-(4-fluoro-6-methoxy-5-(((trifluoromethyl)sulfonyl)oxy)benzo-[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.00 g, 2.18 mmol), CPhos Pd G4 (0.088 g, 0.11 mmol), and (3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)zinc(II) bromide (0.50M in THF, 8.7 mL, 4.4 mmol) were combined in a vial. The reaction mixture was heated at 40 C. for 2 h. The reaction mixture was filtered through CELITE and then concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (2S)-4-(4-fluoro-6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.23H.sub.30FO.sub.6S) (ES, m/z): 453 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.31 (s, 1H), 7.52 (s, 1H), 4.54 (t, J=3.4 Hz, 1H), 3.92 (s, 3H), 3.75-3.70 (m, 1H), 3.69-3.62 (m, 1H), 3.60 (s, 3H), 3.49 (dd, J=17.7, 8.7 Hz, 1H), 3.44-3.39 (m, 1H), 3.38-3.28 (m, 1H), 3.25 (dd, J=17.6, 5.0 Hz, 1H), 3.02-2.92 (m, 1H), 2.80-2.70 (m, 2H), 1.84-1.76 (m, 2H), 1.76-1.67 (m, 1H), 1.63-1.57 (m, 1H), 1.50-1.40 (m, 4H), 1.20-1.17 (m, 3H).
Step 3: Methyl (S)-4-(5-(3-bromopropyl)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(721) ##STR00370##
(722) Methyl (2S)-4-(4-fluoro-6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy) propyl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (350 mg, 0.773 mmol) and DCM (5 mL) were combined in a vial. Triphenylphosphine dibromide (653 mg, 1.55 mmol) was to the reaction mixture and stirred for 30 min. The reaction mixture was quenched with water. The organic layer was separated, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(5-(3-bromopropyl)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.21BrFO.sub.4S) (ES, m/z): 431, 433 [M+H].sup.+.
Intermediate 98: Methyl (S)-4-(4-fluoro-5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(723) ##STR00371##
(724) Methyl (2S)-4-(4-fluoro-6-methoxy-5-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl) benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (350 mg, 0.773 mmol), MeOH (5 mL) and Mp-TsOH (1.00 g, 4.33 mmol) were combined in a vial. The reaction mixture was shaken for 2 h. The reaction mixture was then filtered, washed with MeOH, and concentrated under reduced pressure to afford methyl (S)-4-(4-fluoro-5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.22FO.sub.5S) (ES, m/z): 369 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.31 (s, 1H), 7.51 (s, 1H), 3.92 (s, 3H), 3.60 (s, 3H), 3.50 (dd, J=17.7, 8.7 Hz, 1H), 3.44 (t, J=6.5 Hz, 2H), 3.25 (dd, J=17.4, 4.7 Hz, 1H), 3.02-2.93 (m, 1H), 2.71 (t, J=7.4 Hz, 2H), 1.69-1.63 (m, 2H), 1.20 (d, J=7.0 Hz, 3H).
Intermediate 99: Methyl 2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl) cyclopropane-1-carboxylate
(725) ##STR00372##
Step 1: 2-(4-Fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclopropane-1-carboxylic acid
(726) ##STR00373##
(727) Aluminum chloride (0.923 g, 6.92 mmol) was added to a mixture of 4-fluoro-5,6-dimethoxybenzo[b]thiophene (1.13 g, 5.32 mmol) and 3-oxabicyclo[3.1.0]hexane-2,4-dione (1.19 g, 10.7 mmol) in DCM (20.0 mL) at 0 C. The reaction mixture was warmed to RT and then stirred for 18 h. The reaction mixture was cooled to 0 C. and quenched with water (50 mL). The mixture was then diluted with EtOAc (500 mL). The organic layer was separated, washed with brine, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclopropane-1-carboxylic acid, which was used without purification in the subsequent step. LCMS (C.sub.15H.sub.14FO.sub.5S) (ES, m/z): 325 [M+H].sup.+.
Step 2: Methyl 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclopropane-1-carboxylate
(728) ##STR00374##
(729) TMS-diazomethane (2.0M in diethyl ether, 4.3 mL, 8.6 mmol) was added dropwise to a mixture of 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclopropanecarboxylic acid (1.40 g, 4.32 mmol) in DCM (20 mL) and MeOH (20 mL) at 0 C. The reaction mixture was stirred at 0 C. for 15 min. The reaction mixture was quenched with HOAc. The reaction mixture was then concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford methyl 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclopropanecarboxylate. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.37 (s, 1H), 7.59 (s, 1H), 3.93 (s, 3H), 3.87 (s, 3H), 3.48 (s, 3H), 3.31-3.25 (m, 1H), 2.47-2.41 (m, 1H), 1.62-1.58 (m, 1H), 1.44-1.40 (m, 1H).
Step 3: Methyl 2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropane-1-carboxylate
(730) ##STR00375##
(731) Aluminum chloride (2.66 g, 20.0 mmol) was added portionwise to a mixture of methyl 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclopropanecarboxylate (1.50 g, 4.43 mmol) in DCM (40 mL) at RT. The reaction mixture was stirred at RT for 6 h under Ar. The reaction mixture was cooled to 0 C. and then quenched slowly with water (50 mL). The reaction mixture was diluted with additional DCM (250 mL). The organic layer was separated, washed with brine (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford methyl 2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclopropanecarboxylate. LCMS (C.sub.15H.sub.14FO.sub.5S) (ES, m/z): 325 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.55 (s, 1H), 8.29 (s, 1H), 7.48 (s, 1H), 3.92 (s, 3H), 3.48 (s, 3H), 3.30-3.23 (m, 1H), 2.45-2.39 (m, 1H), 1.61-1.57 (m, 1H), 1.43-1.38 (m, 1H).
Intermediate 100: Methyl (R)-4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(732) ##STR00376##
Step 1: Methyl (R)-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(733) ##STR00377##
(734) 5-Bromo-6-methoxybenzo[b]thiophene-2-carbonyl chloride (3.00 g, 9.82 mmol) and THF (98 ml) were combined. The reaction mixture was then degassed with Ar for 10 min. CPhos Pd G4 (0.081 g, 0.098 mmol) was added to the reaction mixture, and the mixture was cooled to 0 C. (S)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (0.50M in THF, 21 mL, 11 mmol) was then added to the reaction mixture via addition funnel. The mixture was stirred at 0 C. for 1 h. The reaction mixture was quenched with sat aq NH.sub.4Cl and diluted with EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/hex) to afford methyl (R)-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.16BrO.sub.4S) (ES, m/z): 371, 373 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.28-8.26 (m, 2H), 7.82 (s, 1H), 3.95 (s, 3H), 3.60 (s, 3H), 3.44 (dd, J=17.6, 8.6 Hz, 1H), 3.21 (dd, J=17.6, 5.1 Hz, 1H), 3.03-2.93 (m, 1H), 1.20 (d, J=7.2 Hz, 3H).
Step 2: Methyl (R)-4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(735) ##STR00378##
(736) CPhos Pd G3 (174 mg, 0.215 mmol) and then (3-((tert-butyldimethylsilyl)oxy) propyl)zinc(II) bromide (0.50M in THF, 9.7 mL, 4.9 mmol) were added to a mixture of (R)-methyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.00 g, 2.69 mmol) in THE (13.5 mL). The reaction mixture was heated at 40 C. for 3 h. The reaction mixture was cooled to RT, quenched with water, and diluted with EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (R)-4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.24H.sub.37O.sub.5SSi) (ES, m/z): 465 [M+H].sup.+.
Step 3: Methyl (R)-4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(737) ##STR00379##
(738) (R)-Methyl 4-(5-(3-((tert-butyldimethylsilyl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.04 g, 2.24 mmol) was suspended in a mixture of MeOH (4 mL), water (4 mL) and HOAc (4 mL). The reaction mixture was stirred at RT for 3.5 h. The reaction mixture was diluted with EtOAc and water. The aqueous layer was separated and extracted with additional EtOAc (3). The organic layers were combined, washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (R)-4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.23O.sub.5S) (ES, m/z): 351 [M+H].sup.+.
Step 4: Methyl (R)-4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(739) ##STR00380##
(740) NBS (518 mg, 2.91 mmol) was added to a mixture of (R)-methyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (680 mg, 1.94 mmol) and triphenylphosphine (814 mg, 3.10 mmol) in THF (9.7 mL) at 0 C. After 1.5 h, the reaction mixture was quenched with sat aq NH.sub.4Cl and then diluted with EtOAc. The organic layer was separated, washed with brine, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (R)-4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.22BrO.sub.4S) (ES, m/z): 413, 415 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.27 (s, 1H), 7.77 (s, 1H), 7.62 (s, 1H), 3.90 (s, 3H), 3.60 (s, 3H), 3.55 (t, J=6.6 Hz, 2H), 3.43 (dd, J=17.5, 8.6 Hz, 1H), 3.20 (dd, J=17.5, 5.1 Hz, 1H), 3.04-2.94 (m, 1H), 2.83-2.77 (m, 2H), 2.14-2.08 (m, 2H), 1.20 (d, J=7.2 Hz, 3H).
Intermediates 101, 102, 103, and 104: Methyl (1R,2R or 1S,2S)-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate, methyl (1R,2R or 1S,2S)-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate, methyl (1R,2R or 1S,2S)-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate, methyl (1R,2R or 1S,2S)-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate
(741) ##STR00381##
Step 1: (cis)-2-(4-Fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylic acid
(742) ##STR00382##
(743) Aluminum chloride (776 mg, 5.82 mmol) was added to a mixture of 4-fluoro-5,6-dimethoxybenzo[b]thiophene (950 mg, 4.48 mmol) and 3-oxabicyclo[3.2.0]heptane-2,4-dione (1130 mg, 8.95 mmol) in DCM (20.0 mL) at 0 C. The reaction mixture was warmed to RT and then stirred for 18 h. The reaction mixture was cooled to 0 C. and then quenched by the dropwise addition of water (50 mL). The mixture was then diluted with additional DCM (200 mL). The organic layer was separated, washed with brine, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford (cis)-2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylic acid, which was used without purification in the next step. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+.
Step 2: Methyl (cis)-2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate
(744) ##STR00383##
(745) TMS-diazomethane (2.0M in diethyl ether, 4.0 mL, 8.0 mmol) was added dropwise to a mixture of (cis)-2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane carboxylic acid (1.35 g, 3.99 mmol) in DCM (20 mL) and MeOH (20 mL) at 0 C. The reaction mixture was stirred at 0 C. for 15 min. The reaction mixture was quenched with HOAc. The reaction mixture was then concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford (cis)-methyl 2-(4-fluoro-5,6-dimethoxybenzo [b]thiophene-2-carbonyl)cyclobutanecarboxylate. LCMS (C.sub.17H.sub.18FO.sub.5S) (ES, m/z): 353 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.15 (s, 1H), 7.58 (s, 1H), 4.59-4.50 (m, 1H), 3.93 (s, 3H), 3.86 (s, 3H), 3.68 (q, J=8.9, 8.5 Hz, 1H), 3.41 (s, 3H), 2.34-2.10 (m, 4H).
Step 3: (trans)-2-(4-Fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylic acid
(746) ##STR00384##
(747) NaOH (5.0M, 1.8 mL, 9.0 mmol) was added to a mixture of (cis)-methyl 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutanecarboxylate (650 mg, 1.85 mmol) in MeOH (25 mL) at RT. The reaction mixture was stirred at RT for 4 h. The reaction mixture was quenched with TFA (0.85 mL, 11 mmol) and then diluted with DCM (250 mL). The organic layer was separated, washed with brine (50 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (MeOH/DCM) to afford (trans)-2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutanecarboxylic acid. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+.
Step 4: Methyl (trans)-2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate
(748) ##STR00385##
(749) TMS-diazomethane (2.0M in diethyl ether, 1.7 mL, 3.4 mmol) was added dropwise to a mixture of (trans)-2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutane carboxylic acid (570 mg, 1.69 mmol) in DCM (20 mL) and MeOH (20 mL) at 0 C. The reaction mixture was stirred at 0 C. for 15 min. The reaction mixture was quenched with HOAc. The reaction mixture was then concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford (trans)-methyl 2-(4-fluoro-5,6-dimethoxy benzo[b]thiophene-2-carbonyl)cyclobutanecarboxylate. LCMS (C.sub.17H.sub.18FO.sub.5S) (ES, m/z): 353 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.22 (s, 1H), 7.60 (s, 1H), 4.42 (q, J=9.0 Hz, 1H), 3.93 (s, 3H), 3.86 (s, 3H), 3.63 (s, 3H), 3.58-3.48 (m, 1H), 2.38-2.30 (m, 1H), 2.26-2.18 (m, 1H), 2.17-2.10 (m, 2H).
Step 5: Methyl (1R,2R or 1S,2S)-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate, methyl (1R,2R or 1S,2S)-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate, methyl (1R,2R or 1S,2S)-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate, methyl (1R,2R or 1S,2S)-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate
(750) ##STR00386##
(751) AlCl.sub.3 (1.10 g, 8.27 mmol) was added to a mixture of (trans)-methyl 2-(4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl)cyclobutanecarboxylate (530 mg, 1.50 mmol) in DCM (40 mL) at RT. The reaction mixture was stirred at RT for 6 h under Ar. The reaction mixture was cooled to 0 C. and then quenched slowly with water (50 mL). The reaction mixture was then diluted with additional DCM (250 mL). The organic layer was separated, washed with brine (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford a mixture of (+/trans)-methyl-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate and (+/trans)-methyl-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate. The mixture of racemic regioisomers was purified by chiral SFC (CCA column, 20% [MeOH with 0.25% DMEA] in CO.sub.2) to afford:
(752) Peak 1 (3.0 min): methyl (1R,2R or 1S,2S)-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 10.58 (br s, 1H), 8.15 (s, 1H), 7.24 (s, 1H), 4.45-4.34 (m, 1H), 3.86 (s, 3H), 3.62 (s, 3H), 3.56-3.47 (m, 1H), 2.36-2.24 (m, 1H), 2.25-2.16 (m, 1H), 2.16-2.07 (m, 2H).
(753) Peak 2 (3.5 min): methyl (1R,2R or 1S,2S)-2-(4-fluoro-6-hydroxy-5-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+.
(754) Peak 3 (3.9 min): methyl (1R,2R or 1S,2S)-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.55 (s, 1H), 8.14 (s, 1H), 7.48 (s, 1H), 4.45-4.38 (m, 1H), 3.92 (s, 3H), 3.62 (s, 3H), 3.58-3.49 (m, 1H), 2.38-2.27 (m, 1H), 2.25-2.19 (m, 1H), 2.17-2.09 (m, 2H).
(755) Peak 4 (5.0 min): methyl (1R,2R or 1S,2S)-2-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophene-2-carbonyl)cyclobutane-1-carboxylate. LCMS (C.sub.16H.sub.16FO.sub.5S) (ES, m/z): 339 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.54 (s, 1H), 8.14 (s, 1H), 7.48 (s, 1H), 4.44-4.38 (m, 1H), 3.92 (s, 3H), 3.62 (s, 3H), 3.55-3.49 (m, 1H), 2.38-2.26 (m, 1H), 2.26-2.17 (m, 1H), 2.17-2.10 (m, 2H).
Intermediate 105: Methyl (R)-4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(756) ##STR00387##
Step 1: Methyl (R)-4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(757) ##STR00388##
(758) A mixture of 4-fluoro-5,6-dimethoxybenzo[b]thiophene-2-carbonyl chloride (1.00 g, 3.64 mmol) and THF (36.4 mL) was degassed with Ar for 10 min. CPhos Pd G4 (0.030 g, 0.036 mmol) was added to the mixture, and the reaction mixture was cooled to 0 C. (S)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (0.50M in THF, 8.0 mL, 4.0 mmol) was then added to the reaction mixture via an addition funnel. The mixture was stirred at 0 C. for 1 h. The reaction mixture was quenched with sat aq NH.sub.4Cl and then diluted with EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (R)-4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18FO.sub.5S) (ES, m/z): 341 [M+H].sup.+.
Step 2: Methyl (R)-4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(759) ##STR00389##
(760) AlCl.sub.3 (1.16 g, 8.72 mmol) was added to a mixture of (R)-methyl 4-(4-fluoro-5,6-dimethoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (0.742 g, 2.18 mmol) in DCM (22 mL) at RT. The reaction mixture was stirred for 18 h. The reaction mixture was then cooled to 0 C. and quenched by the addition of water (50 mL) and HCl (1.0M in water, 50 mL, 50 mmol). The reaction mixture was then diluted with EtOAc. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford methyl (R)-4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate which was used without purification. LCMS (C.sub.15H.sub.16FO.sub.5S) (ES, m/z): 327 [M+H].sup.+.
Intermediate 106: Methyl (S)-4-(4-chloro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(761) ##STR00390##
(762) NCS (11 mg, 0.081 mmol) was added to a mixture of (S)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (25 mg, 0.081 mmol) in DMF (0.25 mL) at RT. The reaction mixture was then heated to 40 C. and stirred for 2 h. The reaction mixture was cooled to RT and purified directly by silica gel chromatography (EtOAC/Hex) to afford (S)-methyl 4-(4-chloro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.16ClO.sub.5S) (ES, m/z): 343 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.78 (s, 1H), 8.16 (s, 1H), 7.63 (s, 1H), 3.94 (s, 3H), 3.60 (s, 3H), 3.50 (dd, J=17.8, 8.7 Hz, 1H), 3.31-3.23 (m, 1H), 3.02-2.92 (m, 1H), 1.20 (d, J=7.2 Hz, 3H).
Intermediate 107: Methyl (S)-4-(4-bromo-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(763) ##STR00391##
(764) NBS (14 mg, 0.081 mmol) was added to a mixture of (S)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (25 mg, 0.081 mmol) in DMF (0.25 mL) at RT. The reaction mixture was then heated to 40 C. and stirred for 2 h. The reaction mixture was cooled to RT and purified directly by silica gel chromatography (EtOAc/DCM) to afford (S)-methyl 4-(4-bromo-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.16BrO.sub.5S) (ES, m/z): 387, 389 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.82 (s, 1H), 8.08 (s, 1H), 7.66 (s, 1H), 3.94 (s, 3H), 3.60 (s, 3H), 3.50 (dd, J=17.8, 8.7 Hz, 1H), 3.31-3.24 (m, 1H), 3.03-2.92 (m, 1H), 1.21 (d, J=7.2 Hz, 3H).
Intermediate 108: Methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(765) ##STR00392##
Step 1: Methyl 4-(5,6-dimethoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(766) ##STR00393##
(767) TMS-diazomethane (2.0M in diethyl ether, 5.5 mL, 11 mmol) was added dropwise to a mixture of 4-(5,6-dimethoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid (2.15 g, 7.30 mmol) in DCM (50 mL) and MeOH (50 mL) at 0 C. The reaction mixture was stirred at 0 C. for 1 h. The reaction mixture was quenched with HOAc. The reaction mixture was concentrated under reduced pressure to afford methyl 4-(5,6-dimethoxybenzo[b]thiophen-2-yl)-4-oxobutanoate, which was used without purification in the next step. LCMS (C.sub.15H.sub.17O.sub.5S) (ES, m/z): 309 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.22 (s, 1H), 7.61 (s, 1H), 7.49 (s, 1H), 3.87 (s, 3H), 3.84 (s, 3H), 3.61 (s, 3H), 3.35-3.30 (m, 2H), 2.71-2.66 (m, 2H).
Step 2: Methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate and methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(768) ##STR00394##
(769) AlCl.sub.3 (5.71 g, 42.8 mmol) was added to a mixture of methyl 4-(5,6-dimethoxy benzo[b]thiophen-2-yl)-4-oxobutanoate (2.20 g, 7.13 mmol) in DCM (250 mL) at RT. The reaction mixture was stirred at RT for 24 h. The reaction mixture was cooled to 0 C. and quenched with water (50 mL, added dropwise via addition funnel). The reaction mixture was then warmed to RT and diluted with additional DCM (250 mL). The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/DCM) to afford an inseparable mixture of methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (77%) and methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (23%). LCMS (C.sub.14H.sub.15O.sub.5S) (ES, m/z): 295 [M+H].sup.+.
Step 3: Methyl 4-(5-(((benzyloxy)carbonyl)oxy)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate and methyl 4-(6-(((benzyloxy)carbonyl)oxy)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(770) ##STR00395##
(771) CBZCl (1.06 mL, 7.42 mmol) was added to a mixture of methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (77%) and methyl 4-(5-hydroxy-6-methoxy benzo[b]thiophen-2-yl)-4-oxobutanoate (23%) (1.82 g, 6.18 mmol) and TEA (1.29 mL, 9.28 mmol) in DCM (30 mL) at 0 C. The reaction mixture was then warmed to RT and stirred for an additional 2 h. The reaction mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography (EtOAc/Hex) to afford:
(772) Peak 1: methyl 4-(5-(((benzyloxy)carbonyl)oxy)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.22H.sub.21O.sub.7S) (ES, m/z): 429 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.30 (s, 1H), 7.89 (s, 1H), 7.84 (s, 1H), 7.48-7.38 (m, 5H), 5.30 (s, 2H), 3.87 (s, 3H), 3.61 (s, 3H), 3.40-3.33 (m, 2H), 2.69 (t, J=6.4 Hz, 2H).
(773) Peak 2: methyl 4-(6-(((benzyloxy)carbonyl)oxy)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.22H.sub.21O.sub.7S) (ES, m/z): 429 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.32 (s, 1H), 8.01 (s, 1H), 7.71 (s, 1H), 7.47-7.37 (m, 5H), 5.31 (s, 2H), 3.85 (s, 3H), 3.62 (s, 3H), 3.41-3.36 (m, 2H), 2.74-2.68 (m, 2H).
Step 4: Methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(774) ##STR00396##
(775) 1-Methylpiperazine (1.4 mL, 13 mmol) was added to a mixture of methyl 4-(6-(((benzyloxy)carbonyl)oxy)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (1.84 g, 4.29 mmol) in DMF (5 mL) and MeOH (5 mL) at RT. The reaction mixture was then heated to 50 C. and stirred for an additional 30 min. The reaction mixture was cooled to RT and partially concentrated under reduced pressure. The crude mixture was purified by silica gel chromatography (EtOAc/DCM) to afford methyl 4-(6-hydroxy-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.14H.sub.15O.sub.5S) (ES, m/z): 295 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.88 (s, 1H), 8.18 (s, 1H), 7.47 (s, 1H), 7.32 (s, 1H), 3.86 (s, 3H), 3.61 (s, 3H), 3.33-3.29 (m, 2H), 2.71-2.66 (m, 2H).
Intermediate 109: tert-Butyl (S)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(776) ##STR00397##
Step 1: (S)-4-(5-Hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(777) ##STR00398##
(778) To a mixture of (S)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (3.00 g, 9.73 mmol) in MeOH (97 mL) and THF (97 mL) was added NaOH (5.0M in water, 39 mL, 200 mmol). The mixture was heated to 50 C. for 1.5 h. The reaction mixture was cooled to RT and acidified to a pH-3 with HCl (2.0M in water, 100 ml, 200 mmol). The mixture was diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford (S)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.14H.sub.15O.sub.5S) (ES, m/z): 295 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 12.18 (s, 1H), 9.39 (s, 1H), 8.17 (s, 1H), 7.54 (s, 1H), 7.32 (s, 1H), 3.88 (s, 3H), 3.38 (dd, J=17.3, 8.5 Hz, 1H), 3.07 (dd, J=17.3, 5.3 Hz, 1H), 2.94-2.83 (m, 1H), 1.18 (d, J=7.2 Hz, 3H).
Step 2: tert-Butyl (S)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(779) ##STR00399##
(780) 2-tert-Butyl-1,3-diisopropylisourea (2.3 mL, 10 mmol) was added to a mixture of (S)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid (1.00 g, 3.40 mmol) in DMF (6.8 mL) at RT. The reaction mixture was stirred at RT for 2 h. The mixture was diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford tert-butyl (S)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.23O.sub.5S+Na) (ES, m/z): 373 [M+Na].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.40 (s, 1H), 8.17 (s, 1H), 7.54 (s, 1H), 7.31 (s, 1H), 3.88 (s, 3H), 3.36-3.30 (m, 1H), 3.05 (dd, J=17.1, 5.0 Hz, 1H), 2.90-2.79 (m, 1H), 1.35 (s, 9H), 1.16 (d, J=7.2 Hz, 3H).
Intermediate 110: Methyl (S)-4-(4,7-dichloro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(781) ##STR00400##
(782) NCS (433 mg, 3.24 mmol) was added to a mixture of (S)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (500 mg, 1.62 mmol) in DMF (4.0 mL) at 20 C. The reaction mixture was then heated to 40 C. and stirred for 2 h. The reaction mixture was cooled to RT and diluted with EtOAc (100 mL). The mixture was washed with water (325 mL) and brine (125 mL). The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) followed by additional purification by silica gel chromatography (EtOAc/DCM) to afford methyl (S)-4-(4,7-dichloro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.15Cl.sub.2O.sub.5S) (ES, m/z): 377, 379 [M+H].sup.+.
Intermediate 111: Methyl (S)-4-(5-(3-bromo-2,2-dimethylpropoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(783) ##STR00401##
(784) 1,3-Dibromo-2,2-dimethylpropane (176 mg, 0.766 mmol) was added to a mixture of (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (25 mg, 0.077 mmol) and potassium carbonate (42 mg, 0.3 mmol) in DMF (0.5 mL) at RT. The reaction mixture was then stirred and heated to 100 C. for 24 h. The reaction mixture was cooled to RT, diluted with DCM (2 mL), and filtered. The filtrate was directly purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(5-(3-bromo-2,2-dimethylpropoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.20H.sub.25BrFO.sub.5S) (ES, m/z): 475, 477 [M+H]+.
Intermediate 112: Methyl (S)-4-(5-((1-(bromomethyl)cyclopropyl)methoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(785) ##STR00402##
(786) 1,1-Bis(bromomethyl)cyclopropane (175 mg, 0.766 mmol) was added to a mixture of (S)-methyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (25 mg, 0.077 mmol) and potassium carbonate (42 mg, 0.3 mmol) in DMF (0.5 mL) at RT. The reaction mixture was then stirred and heated to 40 C. for 4 h. The reaction mixture was cooled to RT, diluted with DCM (2 mL), and filtered. The filtrate was directly purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(5-((1-(bromomethyl) cyclopropyl)methoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.20H.sub.23BrFO.sub.5S) (ES, m/z): 473, 475 [M+H].sup.+.
Intermediate 113: Methyl (S)-4-(5-hydroxy-6-(methoxymethyl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(787) ##STR00403##
Step 1: Methyl (S)-4-(5-bromo-6-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(788) ##STR00404##
(789) AlCl.sub.3 (3.23 g, 24.2 mmol) was added to a mixture of methyl (S)-4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.50 g, 4.04 mmol) in DCM (35 mL) at RT. The reaction mixture was stirred and heated to 35 C. for 24 h. The reaction mixture was cooled to 0 C. and then quenched by the slow addition of water (10 mL). The mixture was then warmed to RT and stirred for an additional 15 min. The reaction mixture was diluted with DCM (250 mL), and the organic layer was separated. The organic layer was washed with brine (50 mL). The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(5-bromo-6-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.14BrO.sub.4S) (ES, m/z): 357, 359 [M+H].sup.+.
Step 2: Methyl (S)-4-(5-bromo-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(790) ##STR00405##
(791) MOM-Cl (0.91 mL, 12 mmol) was added to a mixture of methyl (S)-4-(5-bromo-6-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.42 g, 3.98 mmol) and Hunig's base (4.2 mL, 24 mmol) in DCM (25 mL) at 0 C. The reaction mixture was stirred at 0 C. for 1 h and then warmed to RT and stirred for an additional 24 h. The reaction mixture was quenched by the addition of sat aq NaHCO.sub.3 (10 mL) and then diluted with EtOAc (250 mL) and water (50 mL). The organic layer was separated, washed with brine (25 mL), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(5-bromo-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18BrO.sub.5S) (ES, m/z): 401, 403 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.30 (s, 1H), 8.28 (s, 1H), 7.87 (s, 1H), 5.41 (s, 2H), 3.60 (s, 3H), 3.48-3.42 (m, 1H), 3.45 (s, 3H), 3.22 (dd, J=17.6, 5.1 Hz, 1H), 3.04-2.93 (m, 1H), 1.20 (d, J=7.4 Hz, 3H).
Step 3: Methyl (S)-4-(6-(methoxymethoxy)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(792) ##STR00406##
(793) A mixture of methyl (S)-4-(5-bromo-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (1.57 g, 3.91 mmol), 4,4,4,4,5,5,5,5-octamethyl-2,2-bi(1,3,2-dioxaborolane) (1.19 g, 4.70 mmol), Pd.sub.2(dba).sub.3 (0.179 g, 0.196 mmol), tricyclohexylphosphine (0.219 g, 0.783 mmol), and potassium acetate (0.614 g, 6.26 mmol) was degassed with Ar for 5 min. Dioxane (20 mL) was added at RT, and the resulting mixture was degassed with Ar for 5 min. The reaction mixture was then heated to 90 C. and stirred for 6 h under Ar. The reaction mixture was cooled to RT and then diluted with EtOAc (50 mL). The suspension was stirred at RT for 10 min, and then filtered through CELITE, washing with EtOAc (50 mL). The filtrate was concentrated under reduced pressure to afford methyl (S)-4-(6-(methoxymethoxy)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate, which was used without purification in the subsequent step. LCMS (C.sub.22H.sub.30BO.sub.7S) (ES, m/z): 449 [M+H].sup.+.
Step 4: Methyl (S)-4-(5-hydroxy-6-(methoxymethoxy) benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(794) ##STR00407##
(795) A solution of O
Intermediate 114: Methyl (S)-4-(4-chloro-5-hydroxy-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(796) ##STR00408##
(797) NCS (99 mg, 0.74 mmol) was added to a mixture of methyl (S)-4-(5-hydroxy-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (250 mg, 0.74 mmol) in DMF (2.0 mL) at RT. The reaction mixture was stirred and heated to 40 C. for 2 h. The reaction mixture was cooled to RT and then directly purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(4-chloro-5-hydroxy-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18ClO.sub.6S) (ES, m/z): 373 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 9.83 (s, 1H), 8.17 (s, 1H), 7.67 (s, 1H), 5.35 (s, 2H), 3.60 (s, 3H), 3.51 (dd, J=17.8, 8.7 Hz, 1H), 3.46 (s, 3H), 3.27 (dd, J=17.8, 5.0 Hz, 1H), 3.02-2.91 (m, 1H), 1.20 (d, J=7.2 Hz, 3H).
Intermediate 115: Methyl (S)-4-(5-(3-bromopropoxy)-4-fluoro-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(798) ##STR00409##
Step 1: (S)-4-(4-Fluoro-5,6-dihydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(799) ##STR00410##
(800) Boron tribromide (1.0M in DCM, 31 ml, 31 mmol) was added to a mixture of methyl (S)-4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (2.0 g, 6.1 mmol) in DCM (100 ml) at 0 C. The reaction mixture was stirred and heated to 30 C. for 2 h. The reaction mixture was cooled to 0 C. and then quenched by the dropwise addition of MeOH (10 ml). The reaction mixture was stirred for an additional 15 min. The reaction mixture was then diluted with water (100 ml) and additional DCM (500 ml). The organic layer was separated, washed with brine (50 ml), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford (S)-4-(4-fluoro-5,6-dihydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid, which was used without purification in the subsequent step. LCMS (C.sub.13H.sub.12FO.sub.5S) (ES, m/z): 299 [M+H]+.
Step 2: Methyl (S)-4-(4-fluoro-5,6-dihydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(801) ##STR00411##
(802) TMS-diazomethane (2.0 M in diethyl ether, 3.1 ml, 6.2 mmol) was added to a mixture of (S)-4-(4-fluoro-5,6-dihydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid (1.83 g, 6.14 mmol) in DCM (10 ml) and MeOH (10 ml) at 0 C. The reaction mixture was then stirred at 0 C. for 15 min. The reaction mixture was quenched with HOAc and then concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford the desired product. The isolated material was purified by silica gel chromatography ([25% EtOH in EtOAc]/Hex) to afford methyl (S)-4-(4-fluoro-5,6-dihydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.14FO.sub.5S) (ES, m/z): 313 [M+H].sup.+.
Step 3: Methyl (S)-4-(4-fluoro-5-hydroxy-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate and methyl (S)-4-(4-fluoro-6-hydroxy-5-(methoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(803) ##STR00412##
(804) MOM-Cl (0.12 ml, 1.6 mmol) was added to a mixture of methyl (S)-4-(4-fluoro-5,6-dihydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (460 mg, 1.47 mmol) and Hunig's base (0.52 ml, 3.0 mmol) in DCM (25 ml) at 0 C. The reaction mixture was stirred at 0 C. for 1 h and then warmed to RT and stirred for an additional 24 h. The reaction mixture was quenched by the addition of sat aq NaHCO.sub.3 (10 ml) and then diluted with EtOAc (250 ml) and water (50 ml). The organic layer was separated, washed with brine (25 ml), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford an inseparable mixture of methyl (S)-4-(4-fluoro-5-hydroxy-6-(methoxy methoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate and methyl (S)-4-(4-fluoro-6-hydroxy-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. The mixture was used in the subsequent reaction without further purification. LCMS (C.sub.18H.sub.18FO.sub.6S) (ES, m/z): 357 [M+H].sup.+.
Step 4: Methyl (S)-4-(6-(3-bromopropoxy)-4-fluoro-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate and methyl (S)-4-(5-(3-bromopropoxy)-4-fluoro-6-(methoxymethoxy) benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(805) ##STR00413##
(806) 1,3-dibromopropane (0.58 ml, 5.6 mmol) was added to a mixture of methyl (S)-4-(4-fluoro-5-hydroxy-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate and methyl (S)-4-(4-fluoro-6-hydroxy-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (270 mg, 0.75 mmol) and potassium carbonate (260 mg, 1.9 mmol) in DMF (2.0 ml) at RT. The mixture was stirred at RT for 18 h. The reaction mixture was diluted with EtOAc (250 ml) and water (50 ml). The organic layer was separated, washed with brine (50 ml), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/hexanes) to afford a mixture of the regioisomers. The mixture of regioisomers was purified by reverse phase HPLC (ACN/water with 0.1% TFA) to afford:
(807) First eluting peak on HPLC: methyl (S)-4-(6-(3-bromopropoxy)-4-fluoro-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.19H.sub.23BrFO.sub.6S) (ES, m/z): 477, 479 [M+H].sup.+.
(808) Second eluting peak on HPLC: methyl (S)-4-(5-(3-bromopropoxy)-4-fluoro-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.19H.sub.23BrFO.sub.6S) (ES, m/z): 477, 479 [M+H].sup.+.
Intermediate 116: Methyl (S)-4-(5-hydroxy-6-(methylamino)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(809) ##STR00414##
Step 1: Methyl (S)-4-(6-bromo-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoateoate
(810) ##STR00415##
(811) 6-bromo-5-methoxybenzo[b]thiophene-2-carbonyl chloride (5.96 g, 19.5 mmol) and CPhos Pd G4 (0.160 g, 0.195 mmol) were combined in a flask and degassed with Ar for 5 min. THF (75 ml) was added under Ar stream, and the mixture was cooled to 0 C. (R)-(3-methoxy-2-methyl-3-oxopropyl)zinc(II) bromide (0.50 M in THF, 40 ml, 20 mmol) was then added dropwise, and the resulting mixture was stirred at 0 C. for 2 h and then warmed to RT. The mixture was stirred at RT for 3 days.
(812) The reaction mixture was quenched with sat aq NH.sub.4Cl (25 ml) and then diluted with EtOAc (500 ml). The organic layer was separated, washed with brine (50 ml), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/hexanes) to afford methyl (S)-4-(6-bromo-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.16BrO.sub.4S) (ES, m/z): 371, 373 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.39 (s, 1H), 8.30 (s, 1H), 7.65 (s, 1H), 3.94 (s, 3H), 3.61 (s, 3H), 3.52-3.43 (m, 1H), 3.28-3.18 (m, 1H), 3.05-2.95 (m, 1H), 1.23-1.18 (m, 3H).
Step 2: Methyl (S)-4-(6-bromo-5-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(813) ##STR00416##
(814) AlCl.sub.3 (366 mg, 2.75 mmol) was added to a mixture of methyl (S)-4-(6-bromo-5-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (170 mg, 0.458 mmol) in DCM (35 ml) at RT. The reaction mixture was stirred and heated to 45 C. for 3 days. The reaction mixture was cooled to 0 C. and then quenched by the slow addition of water (10 ml). The mixture was then warmed to RT and stirred for an additional 15 min. The reaction mixture was diluted with DCM (250 ml), and the organic layer was separated. The organic layer was washed with brine (50 ml). The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(6-bromo-5-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.14H.sub.14BrO.sub.4S) (ES, m/z): 357, 359 [M+H].sup.+.
Step 3: Methyl (S)-4-(6-bromo-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(815) ##STR00417##
(816) Hunig's base (0.44 ml, 2.5 mmol) was added to a mixture of methyl (S)-4-(6-bromo-5-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (150 mg, 0.42 mmol) and MOM-Cl (0.096 ml, 1.3 mmol) in DCM (5.0 ml) at 0 C. The reaction mixture was stirred at 0 C. for 1 h. The reaction mixture was directly purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(6-bromo-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.16H.sub.18BrO.sub.5S) (ES, m/z): 401, 403 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.42 (s, 1H), 8.33 (s, 1H), 7.77 (s, 1H), 5.38 (s, 2H), 3.61 (s, 3H), 3.53-3.42 (m, 4H), 3.23 (dd, J=17.7, 3.0 Hz, 1H), 3.07-2.95 (m, 1H), 1.21 (d, J=5.0 Hz, 3H).
Step 4: Methyl (S)-4-(6-((tert-butoxycarbonyl)(methyl)amino)-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(817) ##STR00418##
(818) To an Ar-degassed mixture of methyl (S)-4-(6-bromo-5-(methoxymethoxy)benzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoate (144 mg, 0.359 mmol), tert-butyl methylcarbamate (71 mg, 0.54 mmol), Pd.sub.2(dba).sub.3 (16 mg, 0.018 mmol), XANTPHOS (31 mg, 0.054 mmol), and cesium carbonate (234 mg, 0.718 mmol) was added dioxane (4.0 ml) at RT while degassing with Ar. The mixture was stirred for 5 min while degassing with Ar, after which the mixture was heated to 90 C. and stirred under Ar for 18 h. The reaction mixture was cooled to RT and diluted with EtOAc (20 ml). The resulting suspension was filtered through CELITE. The filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford the product. LCMS (C.sub.22H.sub.30NO.sub.7S) (ES, m/z): 452 [M+H].sup.+.
Step 5: Methyl (S)-4-(5-hydroxy-6-(methylamino)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(819) ##STR00419##
(820) TFA (1.0 ml, 13 mmol) was added to a mixture of methyl (S)-4-(6-((tert-butoxycarbonyl)(methyl)amino)-5-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (18 mg, 0.040 mmol) in DCM (2.0 ml) at RT. The reaction mixture was stirred at RT for 2 h. The reaction mixture was diluted with EtOAc (10 ml) and quenched slowly by the addition of sat aq NaHCO.sub.3 solution (10 ml). The resulting mixture was stirred for 10 min. The organic layer was separated, washed with brine (5 ml), dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford methyl (S)-4-(5-hydroxy-6-(methylamino)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.15H.sub.18NO.sub.4S) (ES, m/z): 308 [M+H].sup.+.
Example 1 (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid) and
Example 2: (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid)
(821) ##STR00420##
Step 1: Methyl (2S)-4-[6-methoxy-5-(prop-2-en-1-yl)-1-benzothiphen-2-yl]-2-methyl-4-oxobutanoate
(822) ##STR00421##
(823) To the stirred mixture of methyl (2S)-4-(5-bromo-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (120 mg, 0.32 mmol), bis(dibenzylideneacetone)palladium (7.1 mg, 12 mol), and allyltributylstannane (120 L, 0.39 mmol) in toluene (0.49 mL) was added tri-tert-butylphosphine (1.0M in toluene, 26 L, 26 mol) under N.sub.2. The reaction mixture was heated to 65 C. for 18 h. Upon cooling to RT, the mixture was diluted with Et.sub.2O, and then CsF was added. The crude mixture was stirred for 5 min at RT. The mixture was then filtered, and the filtrate was directly purified by silica gel column chromatography (EtOAc in Hex) to afford methyl (2S)-4-[6-methoxy-5-(prop-2-en-1-yl)-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate. LCMS (C.sub.18H.sub.21O.sub.1S) (ES, m/z): 333 [M+H]. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.27 (s, 1H), 7.72 (s, 1H), 7.62 (s, 1H), 6.06-5.94 (m, 1H), 5.07 (d, J=12.5 Hz, 2H), 3.89 (s, 3H), 3.59 (s, 3H), 3.46-3.38 (m, 3H), 3.19 (dd, J=17.5, 5.0 Hz, 1H), 3.02-2.92 (m, 1H), 1.19 (d, J=7.1 Hz, 3H).
Step 2: dimethyl (2S,2S)-4,4-[but-2-ene-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-[prop-1-ene-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate)
(824) ##STR00422##
(825) To a mixture of methyl (2S)-4-[6-methoxy-5-(prop-2-en-1-yl)-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate (44 mg, 0.13 mmol) in CH.sub.2Cl.sub.2 (1.3 mL) was added Grubbs catalyst 2G (11 mg, 0.013 mmol) in CH.sub.2Cl.sub.2 (1.3 mL) in one portion under N.sub.2. The reaction mixture was heated to 65 C. for 18 h. Upon cooling to RT, the mixture was directly purified by silica gel column chromatography (EtOAc in Hex) to afford a mixture of dimethyl (2S,2S)-4,4-[but-2-ene-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-[prop-1-ene-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate). Characterization of dimethyl (2S,2S)-4,4-[but-2-ene-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate): LCMS (C.sub.34H.sub.37O.sub.8S.sub.2) (ES, m/z): 637 [M+H].sup.+. Characterization of dimethyl (2S,2S)-4,4-[prop-1-ene-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate): LCMS (C.sub.33H.sub.35O.sub.8S.sub.2) (ES, m/z): 623 [M+H].sup.+.
Step 3: dimethyl (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate)
(826) ##STR00423##
(827) To a mixture of dimethyl (2S,2S)-4,4-[but-2-ene-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-[prop-1-ene-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) (57.0 mg, 3/2 mixture by .sup.1H-NMR) in EtOAc (0.5 mL) under N.sub.2 was added 10% Pd/C (6.0 mg, 5.4 mol) in one portion at RT. The reaction mixture was degassed and backfilled with H.sub.2 (three times), and stirred under H.sub.2 (balloon) for 18 h at RT. The mixture was then concentrated under reduced pressure to afford a crude mixture of dimethyl (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis (2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate). The mixture was used without further purification or characterization.
Step 4: (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid) and (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid)
(828) ##STR00424##
(829) To a mixture of dimethyl (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoate) (57 mg) in THF (1.0 mL), MeOH (1.0 mL) and water (0.20 mL) was added LiOH (26 mg, 1.1 mmol) in one portion at RT. The reaction mixture was stirred at RT for 1 h and then quenched with aq HCl (2N, 0.52 mL). The mixture was diluted with DMSO, and the resulting mixture was filtered. The filtrate was purified by RP-HPLC [C18 column, water (0.1% TFA)-CH.sub.3CN] to afford (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid) and (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid).
(830) Characterization data for (2S,2S)-4,4-[butane-1,4-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid): LCMS (C.sub.32H.sub.34O.sub.8S.sub.2Na) (ES, m/z): 633 [M+Na].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.20 (br, 2H), 8.21 (s, 2H), 7.72 (s, 2H), 7.57 (s, 2H), 3.87 (s, 6H), 3.39 (dd, J=17.5, 8.6 Hz, 2H), 3.07 (dd, J=17.5, 5.0 Hz, 2H), 2.94-2.84 (m, 2H), 2.69 (br, 4H), 1.62 (br, 4H), 1.18 (d, J=7.1 Hz, 6H).
(831) Characterization data for (2S,2S)-4,4-[propane-1,3-diylbis(6-methoxy-1-benzothiene-5,2-diyl)]bis(2-methyl-4-oxobutanoic acid): LCMS (C.sub.31H.sub.32O.sub.8S.sub.2Na) (ES, m/z): 619 [M+Na].sup.+. 1H NMR (500 MHz, DMSO-d.sub.6): 12.21 (br, 2H), 8.23 (s, 2H), 7.76 (s, 2H), 7.59 (s, 2H), 3.88 (s, 6H), 3.40 (dd, J=17.5, 8.6 Hz, 2H), 3.08 (dd, J=17.5, 5.0 Hz, 2H), 2.94-2.85 (m, 2H), 2.71 (t, J=7.1 Hz, 4H), 1.91 (pentet, J=7.1 Hz, 2H), 1.18 (d, J=7.1 Hz, 6H).
Example 3: (S)-4-(5-(3-(2-(3-carboxypropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoic acid
(832) ##STR00425##
(833) A 1 dram screw cap vial with a magnetic stir bar was charged with (S)-methyl 4-(5-chloro-6-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoate (60 mg, 0.18 mmol), tert-butyl 4-(5-(3-hydroxypropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (76 mg, 0.20 mmol), RockPhos Pd G3 (7.7 mg, 9.2 mol) and Cs.sub.2CO.sub.3 (89 mg, 0.28 mmol) was sealed with a septum-containing cap. The vial was evacuated and backfilled with N.sub.2 3 times. Toluene (0.61 mL) was added, and the suspension was vortexed, sonicated, and then heated to 110 C. with stirring for 2.25 h. The reaction was then allowed to cool to RT. TFA (0.60 mL, 7.8 mmol) was added, and the mixture was stirred at RT for 1.5 h. The mixture was then concentrated under reduced pressure. To the resulting residue was added THF (1.0 mL) and MeOH (0.50 mL). Aq NaOH (2.0M, 0.50 mL, 1.0 mmol) was added, and the resulting mixture was heated to 40 C. for 5 h. Upon cooling to RT, additional aq NaOH (2.0M, 0.50 mL, 1.0 mmol) was added, and the mixture was heated to 40 C. for an additional 2.5 h. The reaction was then allowed to cool to RT and concentrated under reduced pressure. DMSO (1.0 mL) was added, and the resulting mixture was filtered through a syringe filter. The filtrate was then purified by RP-HPLC (C18, MeCN/water gradient, NH.sub.4OH modifier). The product-containing fraction was concentrated under reduced pressure and then purified further by RP-HPLC (C18, MeCN/water gradient, TFA modifier) to afford (S)-4-(5-(3-(2-(3-carboxypropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propoxy)-6-methoxythieno[3,2-b]pyridin-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.29H.sub.30NO.sub.9S.sub.2) (ES, m/z): 600 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.18 (s, 2H), 8.22 (s, 1H), 8.20 (s, 1H), 7.97 (s, 1H), 7.78 (s, 1H), 7.60 (s, 1H), 4.39 (t, J=6.3 Hz, 2H), 3.90 (s, 3H), 3.87 (s, 3H), 3.43 (dd, J=17.5, 8.6 Hz, 1H), 3.29-3.22 (m, 2H), 3.15-3.06 (m, 1H), 2.91-2.80 (m, 3H), 2.63-2.56 (m, 2H), 2.18-2.06 (m, 2H), 1.17 (d, J=7.2 Hz, 3H).
(834) Examples 4 through 23 and 81-83, as shown in Table 11 below, were or may be prepared according to procedures analogous to those outlined in Example 3 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(835) TABLE-US-00011 TABLE 11 Exam- Mass ple Structure Name [M + H].sup.+ 4
Example 24: 4-(5-(3-(2-(3-cyanopropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid
(836) ##STR00449##
Step 1: tert-butyl 4-(5-(3-(2-(3-cyanopropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate
(837) ##STR00450##
(838) To a vial was added tert-butyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thio phen-2-yl)-4-oxobutanoate (45 mg, 0.10 mmol), 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile (33 mg, 0.10 mmol), NaI (7.6 mg, 0.051 mmol), nickel(II) bromide ethylene glycol dimethyl ether complex (9.4 mg, 0.031 mmol), Mn (22 mg, 0.41 mmol) and 4,4-dimethoxy-2,2-bipyridine (6.6 mg, 0.031 mmol). To the vial was added DMPU (1.0 mL) followed by the addition of 5% v/v solutions in DMPU of Py (82 l, 0.051 mmol) and TMS-Cl (78 l, 0.031 mmol). The vial was degassed with Ar for 5 min. The mixture was heated to 90 C. for 2 h. After 2 h, the mixture was allowed to cool to RT and directly purified by prep-HPLC (ACN/H.sub.2O with 0.1% TFA) to afford tert-butyl 4-(5-(3-(2-(3-cyanopropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate. LCMS (C.sub.33H.sub.35NO.sub.6S.sub.2Na) (ES, m/z): 628 [M+Na].sup.+.
Step 2: 4-(5-(3-(2-(3-cyanopropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid
(839) ##STR00451##
(840) To a mixture of tert-butyl 4-(5-(3-(2-(3-cyanopropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (8.5 mg, 0.014 mmol), MeOH (500 L) and ACN (500 L) was added NaOH (5.0M in water, 0.56 L, 0.28 mmol). The mixture was heated to 40 C. for 4 h. Upon cooling to RT, the mixture was purified by prep-HPLC (ACN/H.sub.2O with 0.1% TFA) to afford 4-(5-(3-(2-(3-cyanopropanoyl)-6-methoxybenzo [b]thiophen-5-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid. LCMS (C.sub.29H.sub.28NO.sub.6S.sub.2) (ES, m/z): 550 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.20 (s, 1H), 8.30-8.20 (m, 2H), 7.82-7.75 (m, 2H), 7.65-7.56 (m, 2H), 3.89 (s, 6H), 3.54-3.46 (m, 2H), 2.82-2.76 (m, 2H), 2.76-2.58 (m, 8H), 1.99-1.86 (m, 2H).
Example 25: 4,4-(5,5-(propane-1,3-diyl)bis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(4-oxobutanoic acid)
(841) ##STR00452##
(842) To a mixture of ethyl 4-(6-methoxy-5-(3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate (69 mg, 0.15 mmol), ethyl 4-(5-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (84 mg, 0.23 mmol), PdCl.sub.2(dppf)-CH.sub.2Cl.sub.2 (25 mg, 0.030 mmol) and Cs.sub.2CO.sub.3 (195 mg, 0.600 mmol) was added dioxane (0.80 mL) and water (0.2 mL). The reaction was heated to 100 C. for 18 h. Upon cooling to RT, the mixture was then filtered, and the residual materials were washed with dioxane. The filtrate was concentrated under reduced pressure. The resulting residue was then purified via prep-HPLC (ACN/H.sub.2O with 0.1% NH.sub.4OH) to afford 4,4-(5,5-(propane-1,3-diyl)bis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(4-oxobutanoic acid). LCMS (C.sub.29H.sub.27O.sub.8S.sub.2) (ES, m/z): 566 [MH].sup.. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.11 (s, 2H), 7.68 (s, 2H), 7.50 (s, 2H), 3.82 (s, 6H), 3.16-3.09 (m, 4H), 2.66 (t, J=6.6 Hz, 4H), 2.40 (s, 4H), 1.93-1.83 (m, 2H).
Example 26: 4-(4-(3-(2-(3-carboxypropanoyl)-5-methoxbenzo[b]thiophen-6-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid
(843) ##STR00453##
Step 1: tert-butyl 4-(5-methoxy-6-(3-(6-methoxy-2-(4-methoxy-4-oxobutanoyl)benzo[b]thiophen-4-yl)propyl) benzo[b]thiophen-2-yl)-4-oxobutanoate
(844) ##STR00454##
(845) To a vial was added tert-butyl 4-(6-(3-bromopropyl)-5-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (72 mg, 0.16 mmol), methyl 4-(4-bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (58 mg, 0.16 mmol), NaI (12 mg, 0.082 mmol), nickel(II) bromide ethylene glycol dimethyl ether complex (15 mg, 0.049 mmol), Mn (36 mg, 0.65 mmol) and 4,4-dimethoxy-2,2-bipyridine (11 mg, 0.049 mmol). To the vial was added DMPU (1.6 mL) followed by the addition of 5% v/v solutions in DMPU of Py (130 l, 0.082 mmol) and TMS-Cl (130 l, 0.049 mmol). The vial was degassed with Ar for 5 min. The mixture was heated to 90 C. for 1 h. After 1 h, the mixture was allowed to cool to RT and then diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered and concentrated under reduced pressure. The resulting mixture was used without further purification or characterization.
Step 2: 4-(4-(3-(2-(3-carboxypropanoyl)-5-methoxybenzo[b]thiophen-6-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid
(846) ##STR00455##
(847) To a mixture of tert-butyl 4-(5-methoxy-6-(3-(6-methoxy-2-(4-methoxy-4-oxobutanoyl)benzo[b]thiophen-4-yl)propyl)benzo[b]thiophen-2-yl)-4-oxobutanoate (100 mg, 0.16 mmol) and MeOH (1.6 mL) was added NaOH (5M in water, 0.65 mL, 3.3 mmol), and the mixture was heated to 50 C. for 1 h. Upon cooling to RT, the mixture was purified by prep-HPLC (ACN/H.sub.2O with 0.1% TFA) to afford 4-(4-(3-(2-(3-carboxypropanoyl)-5-methoxybenzo [b]thiophen-6-yl)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid. LCMS (C.sub.29H.sub.29O.sub.8S.sub.2) (ES, m/z): 569 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.23 (s, 2H), 8.27 (s, 1H), 8.25 (s, 1H), 7.82 (s, 1H), 7.50 (s, 1H), 7.44 (s, 1H), 6.93 (s, 1H), 3.89-3.79 (m, 6H), 3.34-3.19 (m, 4H), 3.03 (t, J=7.3 Hz, 2H), 2.82-2.74 (m, 2H), 2.66-2.55 (m, 4H), 2.06-1.96 (m, 2H).
(848) Examples 27 through 31, as shown in Table 12 below, were or may be prepared according to procedures analogous to those outlined in Example 26 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(849) TABLE-US-00012 TABLE 12 Ex- am- Mass ple Structure Name [M + H].sup.+ 27
Example 32: 4-(5-(3-((2-(3-carboxypropanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propyl)-6-methoxybenzo [b]thiophen-2-yl)-4-oxobutanoic acid
(850) ##STR00461##
(851) To a mixture of ethyl 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (83 mg, 0.20 mmol), ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (78 mg, 0.24 mmol), and K.sub.2CO.sub.3 (28 mg, 0.20 mmol) was added ACN (1 mL). The reaction was heated to 65 C. for 18 h. Upon cooling to RT, the mixture was diluted with ACN (4 mL) and filtered. The filtrate was then concentrated under reduced pressure. THF (2.0 mL), MeOH (0.50 mL), water (1.0 mL) and LiOH (48 mg, 2.0 mmol) were then added, and the mixture was allowed to stir at RT for 2 h. The mixture was then quenched with AcOH (0.40 mL), and the mixture was concentrated under reduced pressure. The resulting residue was then purified via prep-HPLC (ACN/H.sub.2O with 0.1% TFA) to afford 4-(5-(3-((2-(3-carboxypropanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoic acid. LCMS (C.sub.29H.sub.28FO.sub.9S2) (ES, m/z): 603 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.28 (s, 1H), 8.20 (s, 1H), 7.73 (d, J=13.7 Hz, 1H), 7.55 (d, J=11.4 Hz, 2H), 4.06-4.00 (m, 2H), 3.90-3.81 (m, 6H), 3.28 (t, J=6.1 Hz, 2H), 3.23 (t, J=6.2 Hz, 2H), 2.82 (s, 2H), 2.58-2.56 (m, 4H), 1.95-193 (m, 2H).
(852) Examples 33 through 40 and 84 through 157, as shown in Table 13 below, were or may be prepared according to procedures analogous to those outlined in Example 32 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(853) TABLE-US-00013 TABLE 13 Ex- am- Mass ple Structure Name [M + H].sup.+ 33
Example 41: (2S)-4-{5-[3-({2-[(3S)-3-carboxybutanoyl]-6-methoxy-1-benzothiophen-5-yl}oxy)propyl]-6-methoxy-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoic acid
(854) ##STR00544##
(855) To a mixture of methyl (2S)-4-(5-bromo-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (107 mg, 0.287 mmol), RockPhos Pd G3 (11 mg, 0.013 mmol), and Cs.sub.2CO.sub.3 (128 mg, 0.392 mmol) under N.sub.2 was added a mixture of methyl (2S)-4-[5-(3-hydroxy-propyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate (92 mg, 0.26 mmol) in toluene (870 L). The reaction mixture was sparged with N.sub.2 for 5 min and then heated to 110 C. for 2 h. Upon cooling to RT, THF (1.0 mL), MeOH (1.0 mL) and water (0.25 mL) were added followed by LiOH.H.sub.2O (157 mg, 3.75 mmol) in one portion at RT. The reaction mixture was stirred at RT for 4 h, then quenched with aq HCl (2.0N, 1.35 mL). DMSO was added, and the resulting mixture was filtered. The filtrate was purified by RP-HPLC [C18 column, water (0.1% TFA)-CH.sub.3CN] to afford (2S)-4-{5-[3-({2-[(3S)-3-carboxybutanoyl]-6-methoxy-1-benzothiophen-5-yl}oxy)propyl]-6-methoxy-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoic acid. LCMS (C.sub.31H.sub.32O.sub.9S.sub.2Na) (ES, m/z): 635 [M+Na]. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.19 (br, 2H), 8.23 (s, 1H), 8.16 (s, 1H), 7.77 (s, 1H), 7.61 (s, 1H), 7.60 (s, 1H), 7.44 (s, 1H), 4.05 (d, J=6.2 Hz, 2H), 3.88 (s, 3H), 3.88 (s, 3H), 3.06 (dt, J=17.5, 4.3 Hz, 2H), 2.94-2.80 (m, 4H), 2.10 (pentet, J=6.9 Hz, 2H), 1.17 (d, J=7.1 Hz, 6H).
(856) Examples 42, 158 and 159, as shown in Table 14 below, were or may be prepared according to procedures analogous to those outlined in Example 41 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(857) TABLE-US-00014 TABLE 14 Mass Example Structure Name [M + H].sup.+ 42
Example 43: (S)-4-(5-(3-((2-(3-carboxypropanoyl)benzo[b]thiophen-6-yl)oxy)propoxy)-6-methoxybenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(858) ##STR00548##
Step 1: Methyl (S)-4-(6-methoxy-5-(3-((2-(4-methoxy-4-oxobutanoyl)benzo[b]thiophen-6-yl) oxy)propoxy) benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(859) ##STR00549##
(860) A mixture of (S)-methyl 4-(5-(3-hydroxypropoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (16 mg, 0.044 mmol), methyl 4-(6-hydroxybenzo[b]thiophen-2-yl)-4-oxobutanoate (14 mg, 0.052 mmol), (E)-diazene-1,2-diylbis(piperidin-1-ylmethanone) (28 mg, 0.11 mmol), and Ph.sub.3P (29 mg, 0.11 mmol) in THF (1.0 mL) was degassed with Ar and was then stirred at 20 C. for 18 h. The reaction mixture was then diluted with DMSO (1.0 mL) and filtered. The mixture was then directly purified by reverse phase HPLC (ACN in water, 0.1% TFA modifier, C-18 stationary phase) to afford methyl (S)-4-(6-methoxy-5-(3-((2-(4-methoxy-4-oxobutanoyl)benzo[b]thiophen-6-yl)oxy)propoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.31H.sub.33O.sub.9S.sub.2) (ES, m/z): 613 [M+H].sup.+.
Step 2: (S)-4-(5-(3-((2-(3-carboxypropanoyl)benzo[b]thiophen-6-yl)oxy)propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(861) ##STR00550##
(862) NaOH (5.0M in water, 21 L, 0.11 mmol) was added to a mixture of methyl (S)-4-(6-methoxy-5-(3-((2-(4-methoxy-4-oxobutanoyl)benzo[b]thiophen-6-yl)oxy)propoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (6.3 mg, 10 mol) in MeOH (1.0 mL) at RT. The reaction mixture was stirred and heated to 50 C. for 2 h. The crude reaction mixture was cooled to RT, quenched with TFA (16 L, 0.21 mmol), diluted with DMSO (1.0 mL), and then filtered. The filtrate was then purified directly by reverse phase HPLC (ACN in water, 0.1% TFA modifier, C-18 stationary phase) to afford (S)-4-(5-(3-((2-(3-carboxypropanoyl)benzo[b]thiophen-6-yl)oxy) propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.29H.sub.29O.sub.9S.sub.2) (ES, m/z): 585 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.22 (s, 2H), 8.33 (s, 1H), 8.19 (s, 1H), 7.94 (d, J=7.8 Hz, 1H), 7.69 (s, 1H), 7.63 (s, 1H), 7.55 (s, 1H), 7.15 (d, J=7.6 Hz, 1H), 4.34-4.18 (m, 4H), 3.89 (s, 3H), 3.44-3.25 (m, 3H), 3.13-3.05 (m, 1H), 2.95-2.87 (m, 1H), 2.66-2.60 (m, 2H), 2.34-2.27 (m, 2H), 1.25-1.14 (m, 3H).
(863) Examples 44 through 59, and 160, as shown in Table 15 below, were or may be prepared according to procedures analogous to those outlined in Example 43 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(864) TABLE-US-00015 TABLE 15 Mass Example Structure Name [M + H].sup.+ 44
Example 60: (2S)-4-{5-[2-({2-[(3S)-3-carboxybutanoyl]-6-methoxy-1-benzothiophen-5-yl}amino)ethyl]-6-methoxy-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoic acid
(865) ##STR00568##
Step 1: methyl (2S)-4-{6-methoxy-5-[2-({6-methoxy-2-[(3S)-4-methoxy-3-methyl-4-oxobutanoyl]-1-benzothiophen-5-yl}amino)ethyl]-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoate
(866) ##STR00569##
(867) To a mixture of methyl (2S)-4-(5-bromo-6-methoxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (54 mg, 0.14 mmol), Rac BINAP Pd G3 (12 mg, 0.012 mmol), and Cs.sub.2CO.sub.3 (117 mg, 0.360 mmol) under N.sub.2 was added a suspension of methyl (2S)-4-[5-(2-aminoethyl)-6-methoxy-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate (54 mg, 0.120 mmol) in toluene (1.6 mL). The reaction mixture was sparged with N.sub.2 for 45 min, then heated to 110 C. for 12 h. Upon cooling to RT, the mixture was purified by silica gel column chromatography (EtOAc in Hex) to afford methyl (2S)-4-{6-methoxy-5-[2-({6-methoxy-2-[(3S)-4-methoxy-3-methyl-4-oxobutanoyl]-1-benzothiophen-5-yl}amino)ethyl]-1-benzothio-phen-2-yl}-2-methyl-4-oxobutanoate. LCMS (C.sub.32H.sub.35NO.sub.8S.sub.2Na) (ES, m/z): 648 [M+Na].sup.+.
Step 2: (2S)-4-{5-[2-({2-[(3S)-3-carboxybutanoyl]-6-methoxy-1-benzothiophen-5-yl}amino) ethyl]-6-methoxy-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoic acid
(868) ##STR00570##
(869) To a mixture of methyl (2S)-4-{6-methoxy-5-[2-({6-methoxy-2-[(3S)-4-methoxy-3-methyl-4-oxobutanoyl]-1-benzothiophen-5-yl}amino)ethyl]-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoate (20 mg, 0.03 mmol) in THF (280 L), MeOH (280 L) and water (70 L) was added LiOH.H.sub.2O (13 mg, 0.32 mmol) in one portion at RT. The reaction mixture was stirred at RT for 2 h, then quenched with aq HCl (2N, 170 uL). The mixture was diluted with DMSO, and the resulting mixture was filtered. The filtrate was purified by RP-HPLC [C18 column, water (0.1% TFA)-CH.sub.3CN] to afford (2S)-4-{5-[2-({2-[(3S)-3-carboxybutanoyl]-6-methoxy-1-benzothiophen-5-yl}amino)ethyl]-6-methoxy-1-benzothiophen-2-yl}-2-methyl-4-oxobutanoic acid. LCMS (C.sub.30H.sub.32NO.sub.8S.sub.2) (ES, m/z): 598 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.12 (br, 2H), 8.27 (s, 1H), 8.11 (s, 1H), 7.82 (s, 1H), 7.66 (s, 1H), 7.44 (s, 1H), 7.07 (s, 1H), 3.98 (s, 3H), 3.90 (s, 3H), 3.41 (dd, J=17.5, 8.6 Hz, 2H), 3.36 (t, J=6.5 Hz, 2H), 3.14-2.96 (m, 4H), 2.94-2.84 (m, 2H), 1.18 (d, J=7.1 Hz, 6H).
(870) Example 61, as shown in Table 16 below, was or may be prepared according to procedures analogous to those outlined in Example 60 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(871) TABLE-US-00016 TABLE 16 Mass Example Structure Name [M + H].sup.+ 61
Example 62: 4,4-((propane-1,3-diylbis(oxy))bis(4-fluoro-6-methoxybenzo[b]thiophene-5,2-diyl))bis(4-oxobutanoic acid)
(872) ##STR00572##
(873) To a mixture of ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (0.024 g, 0.073 mmol), ethyl 4-(5-(3-bromopropoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (0.025 g, 0.056 mmol) and Cs.sub.2CO.sub.3 (0.091 g, 0.28 mmol) was added ACN (1.0 mL). The reaction mixture was then heated to 65 C. for 1 h. Upon cooling to RT, the mixture was diluted with THF, filtered, and the filtrate was concentrated under reduced pressure. To the resulting residue was added THF (1.0 mL), MeOH (0.20 mL), water (0.5 mL), and LiOH (0.013 g, 0.56 mmol). The mixture was allowed to stir at RT for 2 h. The mixture was then quenched with AcOH, and the mixture was concentrated under reduced pressure. The resulting residue was purified via prep-HPLC (ACN/H.sub.2O with 0.1% TFA) to afford 4,4-((propane-1,3-diylbis(oxy))bis(4-fluoro-6-methoxybenzo[b]thiophene-5,2-diyl))bis(4-oxobutanoic acid). LCMS (C.sub.29H.sub.27F.sub.2O.sub.10S.sub.2) (ES, m/z): 637 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.26 (s, 2H), 7.55 (s, 2H), 4.31-4.24 (m, 4H), 3.99-3.80 (m, 6H), 3.34-3.32 (m, 4H), 2.60 (q, J=6.4 Hz, 4H), 2.09 (dt, J=11.5, 5.8 Hz, 2H).
(874) Examples 63 through 65 and 161 through 164, as shown in Table 17 below, were or may be prepared according to procedures analogous to those outlined in Example 62 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(875) TABLE-US-00017 TABLE 17 Mass Example Structure Name [M + H].sup.+ 63
Example 66: (R)-4-(5-(2-((2-((S)-3-carboxybutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)ethoxy)-6-methoxybenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(876) ##STR00580##
(877) (R)-methyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (0.20M in DMF, 500 L, 0.11 mmol) was added to a stirring suspension of methyl (S)-4-(5-(2-chloroethoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (0.20M in DMF, 500 L, 0.11 mmol) and K.sub.2CO.sub.3 (30 mg, 0.2 mmol). The reaction mixture was heated to 100 C. for 18 h. Upon cooling to RT, DMSO (500 L) was added, and the reaction mixture was filtered. Water (500 L) was added followed by LiOH.H.sub.2O (30 mg, 0.7 mmol), and the reaction mixture was stirred at RT for 18 h. The mixture was filtered, and the product was purified mass-directed reverse phase C-18 column chromatography (ACN/water+0.1% TFA) to afford (R)-4-(5-(2-((2-((S)-3-carboxybutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)ethoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.30H.sub.29FO.sub.10S.sub.2Na) (ES, m/z): 655 [M+Na].sup.+. .sup.1H NMR (DMSO-d.sub.6) : 12.18 (s, 2H), 8.31 (s, 1H), 8.18 (s, 1H), 7.58 (s, 2H), 7.50 (s, 1H), 4.50-4.41 (m, 2H), 4.36-4.30 (m, 2H), 3.88 (s, 3H), 3.75 (s, 3H), 3.46 (dd, J=18, 9 Hz, 1H), 3.40 (dd, J=17, 9 Hz, 1H), 3.10 (ddd, J=22, 18, 5 Hz, 2H), 2.95-2.81 (m, 2H), 1.24-1.14 (m, 6H).
(878) Examples 67 through 74 and 165 through 171, as shown in Table 18 below, were or may be prepared according to procedures analogous to those outlined in Example 66 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(879) TABLE-US-00018 TABLE 18 Mass Example Structure Name [M + H].sup.+ 67
Example 75: 4-(5-((3-(2-(3-carboxypropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl)amino)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoic acid
(880) ##STR00596##
(881) To a 4 mL vial was added tert-butyl 4-(6-methoxy-5-(3-oxopropyl)benzo[b]thiophen-2-yl)-4-oxobutanoate (10 mg, 0.03 mmol), tert-butyl 4-(5-amino-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (8.9 mg, 0.027 mmol), and THF (0.50 mL). To the slurry was added AcOH (0.015 mL, 0.27 mmol). The mixture was heated to 55 C. for 10 min. Upon cooling to RT, sodium triacetoxyborohydride (17 mg, 0.080 mmol) was added. The mixture was then heated to 55 C. for 3 h. Upon cooling to RT, TFA (1 mL) was added, and the mixture was allowed to stir at RT for 1 h. The mixture was then concentrated under reduced pressure and then diluted with DMSO (1 mL). The mixture was purified by prep-HPLC (ACN/H.sub.2O w/0.1% TFA) to afford 4-(5-((3-(2-(3-carboxypropanoyl)-6-methoxybenzo[b]thiophen-5-yl)propyl) amino)-6-methoxythieno [3,2-b]pyridin-2-yl)-4-oxobutanoic acid. LCMS (C.sub.28H.sub.29N.sub.2O.sub.8S.sub.2) (ES, m/z): 585 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.18 (br, 2H), 8.22 (s, 1H), 8.03 (s, 1H), 7.79 (s, 1H), 7.63 (s, 1H), 7.59 (s, 1H), 6.55 (br s, 1H), 3.90 (s, 3H), 3.88 (s, 3H), 3.48-3.43 (m, 2H), 3.27-3.24 (m, 4H), 2.73 (t, J=7.3 Hz, 2H), 2.61-2.56 (m, 4H), 1.98-1.91 (m, 2H).
Example 76: (2S,2S)-4,4-((ethane-1,2-diylbis(oxy))bis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(2-methyl-4-oxobutanoic acid)
(882) ##STR00597##
Step 1: dimethyl 4,4-((ethane-1,2-diylbis(oxy))bis(6-methoxybenzo[b]thiophene-5,2-diyl))(2S,2S)-bis(2-methyl-4-oxobutanoate)
(883) ##STR00598##
(884) A mixture of methyl (S)-4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (50 mg, 0.17 mmol) and K.sub.2CO.sub.3 (47 mg, 0.34 mmol) was diluted with DMF (750 L). 1-Bromo-2-chloroethane (18 L, 0.22 mmol) was added, and the reaction mixture was heated to 100 C. for 18 h. The reaction mixture was concentrated under reduced pressure and used without further purification or characterization.
Step 2: (2S,2S)-4,4-((ethane-1,2-diylbis(oxy))bis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(2-methyl-4-oxobutanoic acid)
(885) ##STR00599##
(886) LiOH (16 mg, 0.67 mmol) was added to a stirring solution of dimethyl 4,4-((ethane-1,2-diylbis(oxy))bis(6-methoxybenzo[b]thiophene-5,2-diyl))(2 S,2S)-bis(2-methyl-4-oxobutanoate) (50 mg, 0.08 mmol) in THF (340 l)/Water (80 l). The reaction mixture was allowed to stir at RT for 4 h. The reaction mixture was filtered and concentrated under reduced pressure. The residue was dissolved in DMSO (4 mL) and filtered. The product was purified by mass directed reversed-phase C18 column chromatography (ACN/water with 0.1% TFA) to afford (2S,2S)-4,4-(5,5-(ethane-1,2-diylbis(oxy))bis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(2-methyl-4-oxobutanoic acid). LCMS (C.sub.30H.sub.30O.sub.10S.sub.2Na) (ES, m/z): 637 [M+Na].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) : 12.21 (br s, 2H), 8.20 (s, 2H), 7.64 (s, 2H), 7.59 (s, 2H), 4.44 (s, 4H), 3.87 (s, 6H), 3.41 (dd, J=17, 9 Hz, 2H), 3.09 (dd, J=17, 5 Hz, 2H), 3.05-2.58 (m, 2H), 1.19 (d, J=7 Hz, 6H).
Example 77: (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:6,5-i][1,4,8,11] tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoic acid) and
Example 78: (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:5,6-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoic acid)
(887) ##STR00600##
Step 1: dimethyl (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:5,6-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:6,5-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoate)
(888) ##STR00601##
(889) A mixture of methyl (2S)-4-(5,6-dihydroxy-1-benzothiophen-2-yl)-2-methyl-4-oxobutanoate (60 mg, 0.20 mmol), methyl (2S)-4-[5,6-bis(3-hydroxypropoxy)-1-benzothiophen-2-yl]-2-methyl-4-oxobutanoate (120 mg, 0.20 mmol), Ph.sub.3P (193 mg, 0.737 mmol), and 1,1-(azodicarbonyl)dipiperidine (186 mg, 0.737 mmol) in THF (2.0 mL) was allowed to stir at RT for 18 h. The mixture was then filtered and purified by reverse phase HPLC (gradient of MeCN/water with 0.1% TFA) to afford a 1:1 mixture of dimethyl (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:5,6-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:6,5-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoate). LCMS (C.sub.34H.sub.36O.sub.10S.sub.2Na) (ES, m/z): 691 [M+Na].sup.+.
Step 2: (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:5,6-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoic acid) and (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:6,5-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoic acid)
(890) ##STR00602##
(891) To a stirred solution of a 1:1 mixture of dimethyl (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:5,6-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl) bis(2-methyl-4-oxobutanoate) and dimethyl (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:6,5-i][1,4,8,11]tetraoxacyclotetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoate) (67 mg, 0.10 mmol) in MeOH (1.0 mL), THF (1.0 mL), and water (0.2 mL) was added LiOH (24 mg, 1.0 mmol). The reaction mixture was allowed to stir for 4 h and then purified by reverse phase HPLC (gradient of MeCN/water with 0.1% TFA) to afford a 1:1 mixture of (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:5,6-i][1,4,8,11] tetraoxacyclo tetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoic acid) and (2S,2S)-4,4-(7,8,17,18-tetrahydro-6H,16H-bis[1]benzothieno[5,6-b:6,5-i][1,4,8,11]tetraoxacyclo-tetradecine-2,12-diyl)bis(2-methyl-4-oxobutanoic acid). LCMS (C.sub.32H.sub.33O.sub.10S.sub.2) (ES, m/z): 641 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.20 (brs, 2H), 8.18 (s, 2H), 7.52 (s, 2H), 7.40 (s, 2H), 4.27-4.18 (m, 8H), 3.42-3.34 (m, 2H), 3.10-3.03 (m, 2H), 2.92-2.85 (m, 2H), 2.29 (brs, 4H), 1.17 (d, J=6.8 Hz, 6H).
Example 79: (2S,2S)-4,4-(1,3-propanediylbis{oxy[6-(difluoromethoxy)-1-benzothiene-5,2-diyl]})bis(2-methyl-4-oxobutanoic acid)
(892) ##STR00603##
(893) To a stirred solution of methyl (2S)-4-[6-(difluoromethoxy)-5-hydroxy-1-benzo thiophen-2-yl]-2-methyl-4-oxobutanoate (54 mg, 0.16 mmol) and K.sub.2CO.sub.3 (109 mg, 0.788 mmol) in DMF (0.8 mL) was added 1,3-dibromopropane (8 L, 0.08 mmol). The mixture was heated to 50 C. for 4 h. Upon cooling to RT, the mixture was treated with LiOH (2M in water, 790 L, 1.58 mmol) and allowed to stir at RT for 4 h. The mixture was then concentrated under reduced pressure and purified by RP-HPLC (gradient of MeCN/water with 0.1% TFA) to afford (2S,2S)-4,4-(1,3-propanediylbis {oxy[6-(difluoromethoxy)-1-benzothiene-5,2-diyl]})bis(2-methyl-4-oxobutanoic acid). LCMS (C.sub.31H.sub.28F.sub.4O.sub.10S.sub.2Na) (ES, m/z): 723 [M+23].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6) 12.25 (s, 2H), 8.27 (s, 2H), 7.94 (s, 2H), 7.73 (s, 2H), 7.20 (t, J=74.0 Hz, 2H), 4.33-4.29 (m, 4H), 3.46-3.40 (m, 2H), 3.12 (dd, J=17.5, 4.9 Hz, 2H), 2.94-2.87 (m, 2H), 2.37-2.32 (m, 2H), 1.19 (d, J=7.1 Hz, 6H).
(894) Examples 80 and 172, as shown in Table 19 below, were or may be prepared according to procedures analogous to those outlined in Example 79 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(895) TABLE-US-00019 TABLE 19 Mass Example Structure Name [M + H].sup.+ 80
Example 173: (4-(5-(3-((2-(3-Carboxypropanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoic acid
(896) ##STR00606##
(897) tert-Butyl 4-(5-(3-hydroxypropyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoate (76 mg, 0.20 mmol) was added to a vial containing ethyl 4-(4-fluoro-5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanoate (250 mg, 0.77 mmol), PS-TPP (319 mg, 0.600 mmol), DIAD (0.117 ml, 0.600 mmol), and THF (3 ml). The reaction mixture was stirred for 3 h at RT. The reaction mixture was filtered, washed with THF (5 ml). MeOH (2 ml), water (3 ml), and LiOH (48 mg, 2.0 mmol) were added, and the reaction mixture was stirred for an additional 2 h. The reaction mixture was then quenched with HOAc and concentrated under reduced pressure. The residue was suspended in DCM (5 ml), and TFA (1 ml) was added. The reaction mixture was stirred for 1 h. The reaction mixture was then concentrated under reduced pressure, and the residue was purified by reverse phase HPLC (acetonitrile/water gradient with 0.1% TFA) to afford (4-(5-(3-((2-(3-carboxypropanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propyl)-6-methoxythieno[3,2-b]pyridin-2-yl)-4-oxobutanoic acid. LCMS (C.sub.28H.sub.27FNO.sub.9S.sub.2) (ES, m/z): 604 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 8.34 (s, 1H), 8.31 (s, 1H), 8.07 (s, 1H), 7.57 (s, 1H), 4.17 (t, J=6.3 Hz, 2H), 3.93 (s, 3H), 3.90 (s, 3H), 3.35-3.29 (m, 4H), 3.10-3.04 (m, 2H), 2.63-2.58 (m, 4H), 2.18-2.13 (m, 2H).
(898) Example 174, as shown in Table 20 below, was or may be prepared according to procedures analogous to those outlined in Example 173 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(899) TABLE-US-00020 TABLE 20 Mass Example Structure Name [M + H].sup.+ 174
Example 175: 4,4-(Propane-1,3-diylbis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(4-oxobutanenitrile)
(900) ##STR00608##
(901) 4-(5-Bromo-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile (35 mg, 0.11 mmol), nickel(II) bromide ethylene glycol dimethyl ether complex (10 mg, 0.033 mmol), manganese (24 mg, 0.44 mmol), NaI (8 mg, 0.06 mmol) and 4,4-dimethoxy-2,2-bipyridine (7 mg, 0.03 mmol) were combined in a vial. A solution of 4-(5-(3-bromopropyl)-6-methoxybenzo[b]thiophen-2-yl)-4-oxobutanenitrile (40 mg, 0.11 mmol) in DMPU (1.1 ml) was added to the vial. 5% v/v solutions in DMPU of Py (88 l, 0.055 mmol) and TMS-Cl (84 l, 0.033 mmol) were added to the reaction mixture. The reaction mixture was degassed with Ar for 5 min, and then stirred and heated at 90 C. for 2 h. The reaction mixture was cooled to RT, diluted with DMSO (2 ml), and filtered. The filtrate was purified by reverse phase HPLC (ACN/water with TFA modifier) to afford 4,4-(propane-1,3-diylbis(6-methoxybenzo[b]thiophene-5,2-diyl))bis(4-oxobutanenitrile). LCMS (C.sub.29H.sub.27N.sub.2O.sub.4S.sub.2) (ES, m/z): 531 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.26 (s, 2H), 7.78 (s, 2H), 7.61 (s, 2H), 3.89 (s, 6H), 3.55-3.45 (m, 4H), 2.81-2.76 (m, 4H), 2.74-2.69 (m, 4H), 1.95-1.90 (m, 2H).
Example 176: (S)-4-(5-((3-((2-((S)-3-Carboxybutanoyl)-4-fluoro-6-methoxybenzo [b]thiophen-5-yl)oxy)propyl)amino)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(902) ##STR00609##
(903) A mixture of (S)-methyl 4-(5-amino-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (37 mg, 0.12 mmol), (S)-methyl 4-(5-(3-bromopropoxy)-4-fluoro-6-methoxy benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (54 mg, 0.12 mmol), and potassium carbonate (67 mg, 0.48 mmol) was degassed with Ar. DMF (1.0 ml) was added to the mixture, and the reaction mixture was stirred and heated at 60 C. for 2 days. The reaction mixture was cooled to RT and then NaOH (1.0 M in water, 0.48 ml, 0.48 mmol) was added to the reaction mixture. The mixture was further diluted with DMSO (1.5 ml) and then stirred at RT for 1 h. The reaction mixture was quenched with TFA (0.056 ml, 0.72 mmol) and filtered. The filtrate was purified by reverse phase HPLC (ACN/water with 0.1% TFA) to afford (S)-4-(5-((3-((2-((S)-3-carboxy butanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propyl)amino)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.31H.sub.33FNO.sub.9S.sub.2) (ES, m/z): 646 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.32 (s, 1H), 8.11 (s, 1H), 7.60 (s, 1H), 7.45 (s, 1H), 7.04 (s, 1H), 4.17 (t, J=5.9 Hz, 2H), 3.92 (s, 3H), 3.90 (s, 3H), 3.47 (dd, J=17.6, 8.6 Hz, 1H), 3.43-3.34 (m, 3H), 3.17-3.05 (m, 2H), 2.94-2.95 (m, 2H), 2.09-2.02 (m, 2H), 1.20-1.15 (m, 6H).
(904) Example 177, as shown in Table 21 below, was or may be prepared according to procedures analogous to those outlined in Example 176 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(905) TABLE-US-00021 TABLE 21 Mass Example Structure Name [M + H].sup.+ 177
Example 178: (S)-4-(5-(3-((2-((S)-4-((N,N-Dimethylsulfamoyl)amino)-3-methyl-4-oxobutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(906) ##STR00611##
Step 1: tert-Butyl (S)-4-(5-(3-((4-fluoro-6-methoxy-2-((S)-4-methoxy-3-methyl-4-oxobutanoyl) benzo[b]thiophen-5-yl)oxy)propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(907) ##STR00612##
(908) A mixture of (S)-methyl 4-(5-(3-bromopropoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (111 mg, 0.248 mmol), (S)-tert-butyl 4-(5-hydroxy-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (87 mg, 0.25 mmol), and potassium carbonate (137 mg, 0.993 mmol) was degassed with Ar. DMF (1.Ar) was added to the mixture, and the reaction mixture was stirred and heated at 40 C. for 18 h. The reaction mixture was cooled to RT and then diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel chromatography (EtOAc/Hex) to afford tert-butyl (S)-4-(5-(3-((4-fluoro-6-methoxy-2-((S)-4-methoxy-3-methyl-4-oxobutanoyl)benzo[b]thiophen-5-yl)oxy)propoxy)-6-methoxybenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoate. LCMS (C.sub.36H.sub.42FO.sub.10S.sub.2) (ES, m/z): 739 [M+Na].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 8.30 (s, 1H), 8.21 (s, 1H), 7.59 (s, 1H), 7.57 (s, 1H), 7.51 (s, 1H), 4.26 (q, J=5.9 Hz, 4H), 3.86 (s, 3H), 3.85 (s, 3H), 3.60 (s, 3H), 3.48 (dd, J=17.7, 8.7 Hz, 1H), 3.39-3.33 (m, 1H), 3.23 (dd, J=17.7, 5.0 Hz, 1H), 3.07 (dd, J=17.1, 5.0 Hz, 1H), 3.02-2.93 (m, 1H), 2.91-2.81 (m, 1H), 2.23-2.18 (m, 2H), 1.35 (s, 9H), 1.20-1.15 (m, 6H).
Step 2: (S)-4-(5-(3-((2-((S)-4-(tert-Butoxy)-3-methyl-4-oxobutanoyl)-6-methoxybenzo[b]thio phen-5-yl)oxy)propoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(909) ##STR00613##
(910) NaOH (1.0M in water, 0.94 ml, 0.94 mmol) was added to a mixture of (S)-tert-butyl 4-(5-(3-((4-fluoro-6-methoxy-2-((S)-4-methoxy-3-methyl-4-oxobutanoyl)-benzo[b]thiophen-5-yl)oxy)propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (135 mg, 0.188 mmol) in THF (0.94 ml) and MeOH (0.94 ml). The mixture was stirred at RT for one h. The reaction mixture was quenched with HCl (2.0 M in water, 0.47 ml, 0.94 mmol) and diluted with EtOAc and water. The organic layer was separated, dried over MgSO.sub.4, filtered, and concentrated under reduced pressure to afford (S)-4-(5-(3-((2-((S)-4-(tert-butoxy)-3-methyl-4-oxobutanoyl)-6-methoxybenzo[b]thiophen-5-yl)oxy)propoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.35H.sub.40FO.sub.10S.sub.2) (ES, m/z): 725 [M+Na].sup.+.
Step 3: (S)-4-(5-(3-((2-((S)-4-((N,N-Dimethylsulfamoyl)amino)-3-methyl-4-oxobutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(911) ##STR00614##
(912) Hunig's base (0.062 ml, 0.36 mmol) and TBTU (23 mg, 0.071 mmol) were added to a mixture of (S)-4-(5-(3-((2-((S)-4-(tert-butoxy)-3-methyl-4-oxobutanoyl)-6-methoxy-benzo[b]thiophen-5-yl)oxy)propoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid (50 mg, 0.071 mmol) in DCM (0.7 ml). The mixture was stirred at RT for 30 min. N,N-dimethylsulfamide (11 mg, 0.085 mmol) was added and the mixture was stirred for an additional 4 h. TFA (0.055 ml, 0.71 mmol) was then added and the mixture was stirred and heated to 45 C. for 2 h. The mixture was cooled to RT and was concentrated under reduced pressure. The residue was purified by reverse phase HPLC (ACN/water with 0.1% TFA) to afford (S)-4-(5-(3-((2-((S)-4-((N,N-dimethyl sulfamoyl)amino)-3-methyl-4-oxobutanoyl)-4-fluoro-6-methoxy benzo[b]thiophen-5-yl)oxy)propoxy)-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.33H.sub.38FN.sub.2O.sub.11S.sub.3) (ES, m/z): 775 [M+Na].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 11.50 (s, 1H), 8.30 (s, 1H), 8.22 (s, 1H), 7.59 (s, 1H), 7.56 (s, 1H), 7.52 (s, 1H), 4.26 (q, J=5.9 Hz, 4H), 3.87 (s, 3H), 3.85 (s, 3H), 3.48 (dd, J=17.8, 9.8 Hz, 1H), 3.40 (dd, J=17.3, 8.4 Hz, 1H), 3.16 (dd, J=17.8, 4.4 Hz, 1H), 3.09 (dd, J=17.3, 5.3 Hz, 1H), 3.00-2.94 (m, 1H), 2.94-2.87 (m, 1H), 2.79 (s, 6H), 2.23-2.17 (m, 2H), 1.21-1.15 (m, 6H).
(913) Example 179, as shown in Table 22 below, was or may be prepared according to procedures analogous to those outlined in Example 178 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(914) TABLE-US-00022 TABLE 22 Mass Example Structure Name [M + H].sup.+ 179
Example 180: (S)-4-(5-(3-((2-((S)-3-Carboxybutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propoxy)-6-hydroxybenzo [b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(915) ##STR00616##
Step 1: Methyl (S)-4-(5-(3-((4-fluoro-6-methoxy-2-((S)-4-methoxy-3-methyl-4-oxobutanoyl)benzo[b]thiophen-5-yl)oxy)propoxy)-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate
(916) ##STR00617##
(917) A mixture of methyl (S)-4-(5-(3-bromopropoxy)-4-fluoro-6-methoxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (30 mg, 0.068 mmol), methyl (S)-4-(5-hydroxy-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (23 mg, 0.068 mmol), and potassium carbonate (38 mg, 0.27 mmol) was degassed with Ar. DMF (0.5 ml) was added to the mixture, and the reaction mixture was stirred and heated at 40 C. for 24 h. The reaction mixture was cooled to RT and then used without workup or purification in the subsequent reaction. LCMS (C.sub.34H.sub.38FO.sub.11S.sub.2) (ES, m/z): 705 [M+H].sup.+.
Step 2: (S)-4-(5-(3-((2-((S)-3-carboxybutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propoxy)-6-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid
(918) ##STR00618##
(919) NaOH (0.55 ml, 1.0M in water, 0.55 mmol) was added to a solution of methyl (S)-4-(5-(3-((4-fluoro-6-methoxy-2-((S)-4-methoxy-3-methyl-4-oxobutanoyl)benzo[b]thiophen-5-yl)oxy)propoxy)-6-(methoxymethoxy)benzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoate (48 mg, 0.068 mmol) in DMSO (2.5 ml) at 20 C. The reaction mixture was then stirred at 20 C. for 15 min. The reaction mixture was quenched with HCl (0.280 ml, 37% in water, 3.41 mmol). The reaction mixture was stirred at 20 C. for 20 h. The reaction mixture was filtered. The residue was purified by reverse phase HPLC (ACN/water with 0.1% TFA) to afford (S)-4-(5-(3-((2-((S)-3-carboxybutanoyl)-4-fluoro-6-methoxybenzo[b]thiophen-5-yl)oxy)propoxy)-6-hydroxybenzo[b]thiophen-2-yl)-2-methyl-4-oxobutanoic acid. LCMS (C.sub.30H.sub.30FO.sub.10S.sub.2) (ES, m/z): 633 [M+H].sup.+. .sup.1H NMR (499 MHz, DMSO-d.sub.6) 12.17 (s, 2H), 9.70 (s, 1H), 8.30 (s, 1H), 8.17 (s, 1H), 7.57 (s, 1H), 7.48 (s, 1H), 7.33 (s, 1H), 4.31-4.26 (m, 4H), 3.87 (s, 3H), 3.46 (dd, J=17.6, 8.6 Hz, 1H), 3.38 (dd, J=17.2, 8.4 Hz, 1H), 3.13 (dd, J=17.6, 5.1 Hz, 1H), 3.06 (dd, J=17.2, 5.3 Hz, 1H), 2.91-2.85 (m, 2H), 2.24-2.18 (m, 2H), 1.19 (d, J=7.2 Hz, 6H).
(920) Examples 181 through 190, as shown in Table 23 below, were or may be prepared according to procedures analogous to those outlined in Example 180 above using the appropriate starting materials, described in the Preparations or Intermediates above, or as obtained from commercial sources.
(921) TABLE-US-00023 TABLE 23 Mass Example Structure Name [M + H].sup.+ 181
Biological Evaluation
(922) The individual compounds described in the Examples herein are defined as STING agonists by (i) binding to the STING protein as evidenced by a reduction in binding of tritiated cGAMP ligand to the STING protein by at least 20% at 20 uM (concentration of compound being tested) in a STING Biochemical [3H]cGAMP Competition Assay and (ii) demonstrating interferon production with a 6% or greater induction of IFN-3 secretion at 30 uM in the THP1 cell assay (where induction caused by cGAMP at 30 uM was set at 100%).
(923) [.sup.3H]-cGAMP Synthesis
(924) 2.3 mL of buffer solution containing 80 mM TrisCl, 200 mM MgCl.sub.2, and 20 mM NaCl followed by 0.32 mL of a 10 mM aq solution of GTP was added to a plastic 50 mL AMICON tube. A solution of [.sup.3H]ATP (21 Ci/mmol, 45 mCi) in 0.5 mL H.sub.2O was then added followed by 1 mL of a 1 mg/mL solution of DNA (Herring testes activator DNA, Sigma, # D6898) and 53 uL of a 47 mM solution of cGAS enzyme. Additional H.sub.2O was added to bring the total volume to 10 mL.
(925) The reaction was stirred for 2 h at 37 C. and then added directly to an Amicon Ultra-15 10K centrifuge tube and spun for 1 h at 4,000 g. The collected solution was then purified on a semi-prep Mono Q column using the following mobile phases: A: 0.05M TrisCl pH 8.5 adjusted with 1M NaOH B: 0.05M TrisCl, 0.5M NaCl pH 8.5 adjusted with 1M NaOH
(926) Gradient: 100% A for 5 min followed by a linear gradient to 50:50 (A:B) over 25 min, 3 mL/min, 254 nm.
(927) The collected product fractions were pooled and adjusted to a total volume of 30 mL with buffer A. A total yield of 15.5 mCi of [.sup.3H]cGAMP was isolated at a radiochemical purity of 98.0% at a specific activity of 21.5 Ci/mmol.
(928) cGAS Enzyme
(929) A recombinant DNA vector was chemically synthesized to express the truncated human cGAS enzyme (residues 161-522). To aid in expression and purification, the amino terminus contains a hexahistidine tag, SUMO tag and TEV cleavage site. The recombinant enzyme was overexpressed in R
(930) .sup.3H-cGAMP Filtration Binding Assay (HAQ STING)
(931) The ability of compounds to bind STING is quantified by their ability to compete with tritiated cGAMP ligand for human STING receptor membrane using a radioactive filter-binding assay. The binding assay employs STING receptor obtained from Trichoplusia ni cell membranes (T. ni; Expression Systems, cat #94-002F, www.expressionsystems.com) overexpressing full-length HAQ STING and tritiated cGAMP ligand.
(932) The basic HAQ STING filtration assay protocol is as follows:
(933) The compounds were serially titrated by the Hamilton STARPlus CORE in a 96-well plate (Greiner, #651201) using a 1:3 ten-point dose response format. After compound preparation, a 2.2 ug/ml working concentration of STING membrane (SEQ. ID. No. 1) was prepared by diluting concentrated membrane into assay buffer (1PBS; Invitrogen # SH30028.02) and douncing 7 using a manual tissue homogenizer (Wheaton, #357546). 148 uL of prepared membrane was then manually added to each well of a 96-well deep-well polypropylene plate (Fisher Scientific, #12-566-121). Following membrane addition, 2 uL of either titrated test compound, DMSO control (Sigma #276855), or cold cGAMP control was added to the appropriate wells using a BIOMEK FX. Compound and membrane then preincubated for 60 min at RT to allow compound binding to equilibrate. Following equilibration, 8 nM of [.sup.3H]c-GAMP ligand was prepared by diluting into assay buffer, and 50 uL of this working stock was then manually added to each well of the assay plate. Plates were then incubated at RT for 60 min, and the contents of each assay plate were then filtered through a 96-well GF/B filter plate (PerkinElmer, #6005250) using a TOMTEC MACH III Cell Harvester equipped with 20 mM HEPES buffer (Fisher Scientific, # BP299500). The filter plates were then dried at 55 C. for 30 min using a pressurized oven before 30 uL of ULTIMA GOLD F scintillate was added to each well. Tritium levels for each reaction well were then measured using a PerkinElmer TopCount plate reader.
(934) After normalization to controls, the percent activity for each compound concentration was calculated by measuring the amount of remaining radioactivity. The plot of percent activity versus the log of compound concentration was fit with a 4-parameter dose response equation to calculate EC.sub.50 values.
(935) The final reaction conditions were:
(936) TABLE-US-00024 Component Volume (uL) Final Concentration STING membrane 148 1.5 ug/ml .sup.3H-cGAMP 50 2.0 nM Low Control (cold cGAMP) 2 10 uM Test compound/DMSO 2 10 uM
(937) Compound concentrations tested were 20.000, 637.00, 2.200, 0.740, 0.247, 0.082, 0.027, 0.009, 0.003, and 0.001 M with 1.0% residual DMSO.
(938) Full-Length STING (HAQ) Virus Generation
(939) STING virus was generated using an insect cell baculovirus system. Spodoptera frugiperda Sf21 cells (Kempbio, Inc.) were diluted to 5e5 cells/ml in Sf-900II SFM media (LifeTechnologies #10902088) without antibiotics. The cell suspension was added to each well of a treated 6-well plate (2 mL per well, 1e6 cells total), and the cells were allowed to adhere for at least 30 min. Meanwhile, a 1 mL co-transfection mix was assembled by combining 500 ng of HAQ STING [STING(1-379)R71H,G230A,H232R,R293Q-GG-AviTag-GS-HRV3C-HIS8/pBAC1] DNA (Genewiz custom synthesis) with 1 mL Sf-900II SFM media containing 10 L Cellfectin II Reagent (Invitrogen #10362100) and 100 ng viral backbone BestBac 2.0, v-cath/chiA Deleted Linearized Baculovirus DNA (Expression Systems #91-002). The transfection mixtures were allowed to incubate for 30 min. After incubation, media was gently removed from the adhered cells in the 6-well plate, the 1 mL transfection mixtures were added (1 mL per well), and the plate was placed in a humidified incubator at 27 C. The following day, 1 mL Sf-900II SFM media (no antibiotics) was added to each well of the 6-well plate. After media addition, the cells were allowed to incubate with DNA (SEQ. ID. No. 2) at 27 C. for 5-7 days to generate the P0 viral stock. To generate P1 viral stocks, 0.5 mL of P0 viral supernatant was added to 50 mL uninfected Sf21 cells (seeded the day prior to infection at a density of 510.sup.5 cells/mL to allow for one overnight doubling) in Sf-900II SFM media containing 5 g/mL gentamicin (Invitrogen #15710072). The infected cells were then incubated at 27 C. for 3 days while shaking at 110 rpm (ATR Biotech Multitron Infors HT # AJ118). On day 3, P1 cultures were counted using a ViCell XR (Beckman Coulter Life Sciences #383556) to confirm infection had occurred (cell size 3 m larger than uninfected cells and viability approximately 85-95%). Cultures were harvested in 50 mL conical tubes and centrifuged at 2000g for 10 min at 4 C. The P1 viral supernatants were poured off into clean 50 ml centrifuge tubes, and the remaining P1 cell pellets were used to generate Baculovirus Infected Insect Cells (BIICs). Cryopreservation media containing Sf-900II SFM media with 10% heat inactivated FBS, 10% DMSO (Sigma # D2650), and 5 g/ml gentamicin was prepared and sterilized through 0.22 M filter immediately prior to use. P1 cell pellets were resuspended to a density of 2e7 cells/ml and aliquoted into cryovials (1 mL per vial). Cryovials were placed in M
(940) Full-Length STING (HAQ) Expression
(941) To generate STING membranes, P1/P2 BIICs were amplified overnight by adding thawed BIICs to Sf21 cells seeded at a density of 1.010.sup.6 cells/mL. The volume of BIIC used to infect the culture was calculated using an assumed BIIC titer of 2e9 pfu/ml to achieve an MOI of 10 in the overnight amplification. After culturing overnight, the cells were counted on a ViCell XR to confirm infection had occurred (cell size 3 m larger than uninfected cells and viability approximately 80-90%). The volume of infected Sf21 cells from the overnight amplification used to infect the large-scale expression of Trichoplusia ni (T. ni; Expression Systems, cat #94-002F, www.expressionsystems.com) seeded at a density of 1.010.sup.6 in cell media (ESF921 SFM containing 5 g/mL gentamicin) at MOI=2.0 was calculated based on (100 pfu/infected Sf21 cell). The cells were allowed to express for 48 h at 27 C. before harvesting the cell pellet, by centrifugation at 3,400g for 10 min at 4 C. T. ni cells were counted on a ViCell XR to confirm infection had occurred (cell size 3 m larger than uninfected cells and viability approximately 80-90%) prior to harvest.
(942) Full-Length STING (HAQ) Membrane Generation
(943) Buffer Stock Reagents:
(944) 1) 1M HEPES pH 7.5, Teknova, Cat # H1035 2) 5M NaCl, Sigma Aldrich, Cat # S5150-1L 3) KCl, Sigma Aldrich, Cat #319309-500ML 4) Complete EDTA-free protease inhibitor tablets, Roche Diagnostics, Cat #11873580001 5) Benzonase, Universal Nuclease, Pierce, Cat #88702
(945) Lysis buffer [25 mM HEPES pH 7.5, 10 mM MgCl.sub.2, 20 mM KCl, (Benzonase 1:5000, Complete Protease Inhibitor tab/50 mL)] was added to the pellet of cells expressing full-length STING (HAQ) prepared above at 5 mL Lysis buffer per g of cell pellet. The pellet was resuspended and dounced twenty times using a Wheaton Dounce Homogenizer to disrupt the cell membrane. Homogenized lysate was then passed through the EMULSIFLEX-C5 microfluidizer at a pressure close to 5000 PSI. The resuspended pellet was centrifuged at 36,000 rpm (100,000g) in a 45Ti rotor ultra-high speed centrifuge for 45 min, 4 C. The supernatant was removed. The pellet then was resuspended in wash buffer [(25 mM HEPES pH7.5, 1 mM MgCl.sub.2, 20 mM KCl, 1M NaCl (Complete Protease Inhibitor tab/50 mL)] at a volume of 50 mL pellet/centrifuge tube. The pellet/wash buffer mixture was then homogenized, using a glass homogenizer on ice (20 strokes), followed by centrifugation at 36,000 rpm for 45 min at 4 C. The supernatant was removed. The wash step was repeated once more. The resulting membrane was resuspended in 20 mM HEPES pH 7.5, 500 mM NaCl, 10% glycerol, EDTA-free Protease Inhibitors (1 tablet/50 mL). The protein concentration was measured by Bradford assay (Bio-Rad Protein Assay, Cat #500-0006), and protein enrichment was determined by SDS-PAGE and confirmed by Western blot. The resuspended membranes were stored at 80 C.
(946) TABLE-US-00025 Full-LengthHAQSTING[STING(1-379)R71H,G230A,H232R,R293Q- GG-AviTag-GS-HRV3C-HIS8]AminoAcidSequence: (SEQ.ID.No.1) MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLL LNGVCSLAEELHHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFT WMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQA RIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRAGIK DRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTL EDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTST MSQEPELLISGMEKPLPLRTDFSGGGLNDIFEAQKIEWHEGSLEVLFQGPHHHHHHHH Full-lengthHAQ[STING(1-379)R71H,G230A,H232R,R293Q-GG- AviTag-GS-HRV3C-HIS8/pBAC1] PlasmidDNASequence: (SEQ.ID.No.2) GGAACGGCTCCGCCCACTATTAATGAAATTAAAAATTCCAATTTTAAAAAACGCAG CAAGAGAAACATTTGTATGAAAGAATGCGTAGAAGGAAAGAAAAATGTCGTCGAC ATGCTGAACAACAAGATTAATATGCCTCCGTGTATAAAAAAAATATTGAACGATTTG AAAGAAAACAATGTACCGCGCGGCGGTATGTACAGGAAGAGGTTTATACTAAACTG TTACATTGCAAACGTGGTTTCGTGTGCCAAGTGTGAAAACCGATGTTTAATCAAGGC TCTGACGCATTTCTACAACCACGACTCCAAGTGTGTGGGTGAAGTCATGCATCTTTT AATCAAATCCCAAGATGTGTATAAACCACCAAACTGCCAAAAAATGAAAACTGTCG ACAAGCTCTGTCCGTTTGCTGGCAACTGCAAGGGTCTCAATCCTATTTGTAATTATTG AATAATAAAACAATTATAAATGCTAAATTTGTTTTTTATTAACGATACAAACCAAAC GCAACAAGAACATTTGTAGTATTATCTATAATTGAAAACGCGTAGTTATAATCGCTG AGGTAATATTTAAAATCATTTTCAAATGATTCACAGTTAATTTGCGACAATATAATT TTATTTTCACATAAACTAGACGCCTTGTCGTCTTCTTCTTCGTATTCCTTCTCTTTTTC ATTTTTCTCTTCATAAAAATTAACATAGTTATTATCGTATCCATATATGTATCTATCG TATAGAGTAAATTTTTTGTTGTCATAAATATATATGTCTTTTTTAATGGGGTGTATAG TACCGCTGCGCATAGTTTTTCTGTAATTTACAACAGTGCTATTTTCTGGTAGTTCTTC GGAGTGTGTTGCTTTAATTATTAAATTTATATAATCAATGAATTTGGGATCGTCGGTT TTGTACAATATGTTGCCGGCATAGTACGCAGCTTCTTCTAGTTCAATTACACCATTTT TTAGCAGCACCGGATTAACATAACTTTCCAAAATGTTGTACGAACCGTTAAACAAAA ACAGTTCACCTCCCTTTTCTATACTATTGTCTGCGAGCAGTTGTTTGTTGTTAAAAAT AACAGCCATTGTAATGAGACGCACAAACTAATATCACAAACTGGAAATGTCTATCA ATATATAGTTGCTGATCAGATCTGATCATGGAGATAATTAAAATGATAACCATCTCG CAAATAAATAAGTATTTTACTGTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAA ATATAGGATCCATGCCCCACTCCAGCCTGCATCCATCCATCCCGTGTCCCAGGGGTC ACGGGGCCCAGAAGGCAGCCTTGGTTCTGCTGAGTGCCTGCCTGGTGACCCTTTGGG GGCTAGGAGAGCCACCAGAGCACACTCTCCGGTACCTGGTGCTCCACCTAGCCTCCC TGCAGCTGGGACTGCTGTTAAACGGGGTCTGCAGCCTGGCTGAGGAGCTGCACCAC ATCCACTCCAGGTACCGGGGCAGCTACTGGAGGACTGTGCGGGCCTGCCTGGGCTG CCCCCTCCGCCGTGGGGCCCTGTTGCTGCTGTCCATCTATTTCTACTACTCCCTCCCA AATGCGGTCGGCCCGCCCTTCACTTGGATGCTTGCCCTCCTGGGCCTCTCGCAGGCA CTGAACATCCTCCTGGGCCTCAAGGGCCTGGCCCCAGCTGAGATCTCTGCAGTGTGT GAAAAAGGGAATTTCAACGTGGCCCATGGGCTGGCATGGTCATATTACATCGGATA TCTGCGGCTGATCCTGCCAGAGCTCCAGGCCCGGATTCGAACTTACAATCAGCATTA CAACAACCTGCTACGGGGTGCAGTGAGCCAGCGGCTGTATATTCTCCTCCCATTGGA CTGTGGGGTGCCTGATAACCTGAGTATGGCTGACCCCAACATTCGCTTCCTGGATAA ACTGCCCCAGCAGACCGCTGACCGTGCTGGCATCAAGGATCGGGTTTACAGCAACA GCATCTATGAGCTTCTGGAGAACGGGCAGCGGGCGGGCACCTGTGTCCTGGAGTAC GCCACCCCCTTGCAGACTTTGTTTGCCATGTCACAATACAGTCAAGCTGGCTTTAGC CGGGAGGATAGGCTTGAGCAGGCCAAACTCTTCTGCCAGACACTTGAGGACATCCT GGCAGATGCCCCTGAGTCTCAGAACAACTGCCGCCTCATTGCCTACCAGGAACCTGC AGATGACAGCAGCTTCTCGCTGTCCCAGGAGGTTCTCCGGCACCTGCGGCAGGAGG AAAAGGAAGAGGTTACTGTGGGCAGCTTGAAGACCTCAGCGGTGCCCAGTACCTCC ACGATGTCCCAAGAGCCTGAGCTCCTCATCAGTGGAATGGAAAAGCCCCTCCCTCTC CGCACGGATTTCTCTGGCGGTGGCCTGAACGACATCTTCGAAGCCCAGAAAATCGA ATGGCATGAAGGCAGCCTGGAAGTGCTGTTCCAGGGCCCACACCACCATCATCACC ATCACCATTAATGAGCGGCCGCACTCGAGCACCACCACCACCACCACTAACCTAGG TAGCTGAGCGCATGCAAGCTGATCCGGGTTATTAGTACATTTATTAAGCGCTAGATT CTGTGCGTTGTTGATTTACAGACAATTGTTGTACGTATTTTAATAATTCATTAAATTT ATAATCTTTAGGGTGGTATGTTAGAGCGAAAATCAAATGATTTTCAGCGTCTTTATA TCTGAATTTAAATATTAAATCCTCAATAGATTTGTAAAATAGGTTTCGATTAGTTTCA AACAAGGGTTGTTTTTCCGAACCGATGGCTGGACTATCTAATGGATTTTCGCTCAAC GCCACAAAACTTGCCAAATCTTGTAGCAGCAATCTAGCTTTGTCGATATTCGTTTGT GTTTTGTTTTGTAATAAAGGTTCGACGTCGTTCAAAATATTATGCGCTTTTGTATTTC TTTCATCACTGTCGTTAGTGTACAATTGACTCGACGTAAACACGTTAAATAGAGCTT GGACATATTTAACATCGGGCGTGTTAGCTTTATTAGGCCGATTATCGTCGTCGTCCC AACCCTCGTCGTTAGAAGTTGCTTCCGAAGACGATTTTGCCATAGCCACACGACGCC TATTAATTGTGTCGGCTAACACGTCCGCGATCAAATTTGTAGTTGAGCTTTTTGGAAT TATTTCTGATTGCGGGCGTTTTTGGGCGGGTTTCAATCTAACTGTGCCCGATTTTAAT TCAGACAACACGTTAGAAAGCGATGGTGCAGGCGGTGGTAACATTTCAGACGGCAA ATCTACTAATGGCGGCGGTGGTGGAGCTGATGATAAATCTACCATCGGTGGAGGCG CAGGCGGGGCTGGCGGCGGAGGCGGAGGCGGAGGTGGTGGCGGTGATGCAGACGG CGGTTTAGGCTCAAATGTCTCTTTAGGCAACACAGTCGGCACCTCAACTATTGTACT GGTTTCGGGCGCCGTTTTTGGTTTGACCGGTCTGAGACGAGTGCGATTTTTTTCGTTT CTAATAGCTTCCAACAATTGTTGTCTGTCGTCTAAAGGTGCAGCGGGTTGAGGTTCC GTCGGCATTGGTGGAGCGGGCGGCAATTCAGACATCGATGGTGGTGGTGGTGGTGG AGGCGCTGGAATGTTAGGCACGGGAGAAGGTGGTGGCGGCGGTGCCGCCGGTATAA TTTGTTCTGGTTTAGTTTGTTCGCGCACGATTGTGGGCACCGGCGCAGGCGCCGCTG GCTGCACAACGGAAGGTCGTCTGCTTCGAGGCAGCGCTTGGGGTGGTGGCAATTCA ATATTATAATTGGAATACAAATCGTAAAAATCTGCTATAAGCATTGTAATTTCGCTA TCGTTTACCGTGCCGATATTTAACAACCGCTCAATGTAAGCAATTGTATTGTAAAGA GATTGTCTCAAGCTCGGATCGATCCCGCACGCCGATAACAAGCCTTTTCATTTTTACT ACAGCATTGTAGTGGCGAGACACTTCGCTGTCGTCGAGGTTTAAACGCTTCCTCGCT CACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAA GGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAG CAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTC CATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTG GCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCG TGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTC GGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGT CGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGC CTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACT GGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAG AGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCT GCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCA AACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCA GAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGT GGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTC ACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAG TAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATC TGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATAC GGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCA CCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAG TGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAG AGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCAT CGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCA AGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCT CCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCA CTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGT ACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGG CGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTG GAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTT CGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGT TTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCG ACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATC AGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAA TAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGCGCCCTGTAGCGGCG CATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGC GCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTT TCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACG GCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCC CTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTC TTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAG GGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTA ACGCGAATTTTAACAAAATATTAACGTTTACAATTTCCCATTCGCCATTCAGGCTGC GCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCA
(947) Certain compounds of the disclosure were evaluated in HAQ STING in vitro binding assay as described above. The following table tabulates the biological data for these compounds as EC.sub.50 values.
(948) TABLE-US-00026 TABLE 24 .sup.3H-cGAMP filtration binding assay for HAQ STING Example EC.sub.50 (nM) 1 6 2 7 3 114 4 6 5 84 6 53 7 17 8 12 9 116 10 123 11 1762 12 2 13 158 14 3 15 107 16 22 17 52 18 2 19 2 20 7 21 1 22 1 23 1 24 17760 25 6 26 9 27 89 28 46 29 8 30 1001 31 3319 32 4 33 1 34 3 35 2 36 4 37 1 38 695 39 1 40 86 41 16 42 6 43 49 44 14 45 4328 46 133 47 14 48 12790 49 44% inhibition at 20,000 nM 50 1 51 3 52 2 53 146 54 804 55 14 56 1068 57 92 58 1 59 1 60 19 61 33 62 2 63 1 64 2 65 1 66 4 67 40 68 50 69 1 70 1 71 3 72 1 73 1 74 4 75 139 76 22 77/78 44 (mixture) 79 5 80 1305 81 2 82 1 83 2 84 50 85 360 86 1 87 167 88 3 89 2 90 58 91 7 92 3 93 1 94 6 95 237 96 18 97 20 98 1 99 1 100 277 101 1 102 15 103 22 104 467 105 39 106 10 107 1 108 35 109 10 110 18580 111 861 112 15540 113 2 114 21 115 20 116 623 117 340 118 60 119 1796 120 38 121 1551 122 1 123 1 124 263 125 1 126 2 127 16 128 1082 129 3496 130 3 131 25 132 3 133 15 134 22 135 1 136 314 137 40 138 2 139 3 140 2146 141 24 142 1 143 75 144 15 145 143 146 55% inhibition at 2,000 nM 147 18 148 395 149 4 150 213 151 77 152 35% inhibition at 2,000 nM 153 3 154 694 155 3 156 1 157 1 158 2 159 3 160 1 161 1 162 1 163 1 164 1 165 2 166 8 167 4 168 13 169 1 170 1 171 9 172 454 173 1 174 1 175 4016 176 1 177 68 178 4 179 1 180 1 181 5 182 1 183 1 184 353 185 1 186 133 187 4 188 1 189 1 190 1
.sup.3H-cGAMP Filtration Binding Assay (WT STING)
(949) The ability of compounds to bind STING is quantified by their ability to compete with tritiated cGAMP ligand for human STING receptor membrane using a radioactive filter-binding assay. The binding assay employs STING receptor obtained from Trichoplusia ni cell membranes (T. ni; Expression Systems, cat #94-002F, www.expressionsystems.com) overexpressing full-length WT STING and tritiated cGAMP ligand.
(950) The basic WT STING filtration assay protocol is as follows:
(951) 16 nM of [.sup.3H] c-GAMP ligand was prepared by diluting into assay buffer, and 50 uL of this working stock was manually added to each well of the assay plate. After ligand addition, 2 uL of either titrated test compound, DMSO control (Sigma #276855), or cold cGAMP control was added to the appropriate wells using a B
(952) After normalization to controls, the percent activity for each compound concentration was calculated by measuring the amount of remaining radioactivity. The plot of percent activity versus the log of compound concentration was fit with a 4-parameter dose response equation to calculate EC.sub.50 values.
(953) The final reaction conditions were:
(954) TABLE-US-00027 Component Volume (uL) Final Concentration STING membrane 148 1.5 ug/ml .sup.3H-cGAMP 50 4.0 nM Low Control (cold cGAMP) 2 10 uM Test compound/DMSO 2 10 uM
(955) Compound concentrations tested were 20.000, 637.00, 2.200, 0.740, 0.247, 0.082, 0.027, 0.009, 0.003, and 0.001 M with 1.0% residual DMSO.
(956) Full-Length STING (WT) Virus Generation
(957) STING virus was generated using an insect cell baculovirus system. Spodoptera frugiperda Sf21 cells (Kempbio, Inc.) were diluted to 5e5 cells/ml in Sf-900II SFM media (LifeTechnologies #10902088) without antibiotics. The cell suspension was added to each well of a treated 6-well plate (2 mL per well, 1e6 cells total), and the cells were allowed to adhere for at least 30 min. Meanwhile, a 1 mL co-transfection mix was assembled by combining 500 ng of WT STING[STING(1-379)H232R-gg-AviTag-gs-HRV3C-HIS8/pBAC1] (Genewiz custom synthesis) with 1 mL Sf-900II SFM media containing 10 L C
(958) Full-Length STING (WT) Expression
(959) To generate STING membranes, P1/P2 BIICs were amplified overnight by adding thawed BIICs to Sf21 cells seeded at a density of 1.010.sup.6 cells/mL. The volume of BIIC used to infect the culture was calculated using an assumed BIIC titer of 2e9 pfu/ml to achieve an MOI of 10 in the overnight amplification. After culturing overnight, the cells were counted on a ViCell XR to confirm infection had occurred (cell size 3 m larger than uninfected cells and viability approximately 80-90%). The volume of infected Sf21 cells from the overnight amplification used to infect the large-scale expression of Trichoplusia ni (T. ni; Expression Systems, cat #94-002F, www.expressionsystems.com) seeded at a density of 1.010.sup.6 in cell media (ESF921 SFM containing 5 g/mL gentamicin) at MOI=2.0 was calculated based on (100 pfu/infected Sf21 cell). The cells were allowed to express for 48 h at 27 C. before harvesting the cell pellet, by centrifugation at 3,400g for 10 min at 4 C. T. ni cells were counted on a ViCell XR to confirm infection had occurred (cell size 3 m larger than uninfected cells and viability approximately 80-90%) prior to harvest.
(960) Full-Length STING (WT) Membrane Generation
(961) Buffer Stock Reagents:
(962) 1) 1 M HEPES pH 7.5, Teknova, Cat # H1035 2) 5 M NaCl, Sigma Aldrich, Cat # S5150-1L 3) KCl, Sigma Aldrich, Cat #319309-500ML 4) Complete EDTA-free protease inhibitor tablets, Roche Diagnostics, Cat #11873580001 5) Benzonase, Universal Nuclease, Pierce, Cat #88702
(963) Lysis buffer [25 mM HEPES pH 7.5, 10 mM MgCl.sub.2, 20 mM KCl, (Benzonase 1:5000, Complete Protease Inhibitor tab/50 mL)] was added to the pellet of cells expressing full-length STING (WT) prepared above at 5 mL Lysis buffer per g of cell pellet. The pellet was resuspended and dounced twenty times using a Wheaton Dounce Homogenizer to disrupt the cell membrane. Homogenized lysate was then passed through the emulsiflex-C5 microfluidizer at a pressure close to 5000 PSI. The resuspended pellet was centrifuged at 36,000 rpm (100,000g) in a 45Ti rotor ultra-high speed centrifuge for 45 min, 4 C. The supernatant was removed. The pellet then was resuspended in wash buffer [(25 mM HEPES pH 7.5, 1 mM MgCl.sub.2, 20 mM KCl, 1M NaCl (Complete Protease Inhibitor tab/50 mL)] at a volume of 50 mL/pellet/centrifuge tube. The pellet/wash buffer mixture was then homogenized, using a glass homogenizer on ice (20 strokes), followed by centrifugation at 36,000 rpm for 45 min at 4 C. The supernatant was removed. The wash step was repeated once more. The resulting membrane was resuspended in 20 mM HEPES pH 7.5, 500 mM NaCl, 10% glycerol, EDTA-free Protease Inhibitors (1 tablet/50 mL). The protein concentration was measured by Bradford assay (Bio-Rad Protein Assay, Cat #500-0006), and protein enrichment was determined by SDS-PAGE and confirmed by Western blot. The resuspended membranes were stored at 80 C.
(964) TABLE-US-00028 Full-LengthSTINGWT[STING(1-379)H232R-gg-AviTag-gs-HRV3C-HIS8] AminoAcidSequence: (SEQ.ID.No.3) MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLL LNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFT WMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQA RIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIK DRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTL EDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTST MSQEPELLISGMEKPLPLRTDFSGGGLNDIFEAQKIEWHEGSLEVLFQGPHHHHHHHH Full-lengthWTSTING[STING(1-379)H232R-gg-AviTag-gs-HRV3C-HIS8/pBAC1] plasmidsequence: (SEQ.ID.No.4) GGAACGGCTCCGCCCACTATTAATGAAATTAAAAATTCCAATTTTAAAAAACGCAG CAAGAGAAACATTTGTATGAAAGAATGCGTAGAAGGAAAGAAAAATGTCGTCGAC ATGCTGAACAACAAGATTAATATGCCTCCGTGTATAAAAAAAATATTGAACGATTTG AAAGAAAACAATGTACCGCGCGGCGGTATGTACAGGAAGAGGTTTATACTAAACTG TTACATTGCAAACGTGGTTTCGTGTGCCAAGTGTGAAAACCGATGTTTAATCAAGGC TCTGACGCATTTCTACAACCACGACTCCAAGTGTGTGGGTGAAGTCATGCATCTTTT AATCAAATCCCAAGATGTGTATAAACCACCAAACTGCCAAAAAATGAAAACTGTCG ACAAGCTCTGTCCGTTTGCTGGCAACTGCAAGGGTCTCAATCCTATTTGTAATTATTG AATAATAAAACAATTATAAATGTCAAATTTGTTTTTTATTAACGATACAAACCAAAC GCAACAAGAACATTTGTAGTATTATCTATAATTGAAAACGCGTAGTTATAATCGCTG AGGTAATATTTAAAATCATTTTCAAATGATTCACAGTTAATTTGCGACAATATAATT TTATTTTCACATAAACTAGACGCCTTGTCGTCTTCTTCTTCGTATTCCTTCTCTTTTTC ATTTTTCTCTTCATAAAAATTAACATAGTTATTATCGTATCCATATATGTATCTATCG TATAGAGTAAATTTTTTGTTGTCATAAATATATATGTCTTTTTTAATGGGGTGTATAG TACCGCTGCGCATAGTTTTTCTGTAATTTACAACAGTGCTATTTTCTGGTAGTTCTTC GGAGTGTGTTGCTTTAATTATTAAATTTATATAATCAATGAATTTGGGATCGTCGGTT TTGTACAATATGTTGCCGGCATAGTACGCAGCTTCTTCTAGTTCAATTACACCATTTT TTAGCAGCACCGGATTAACATAACTTTCCAAAATGTTGTACGAACCGTTAAACAAAA ACAGTTCACCTCCCTTTTCTATACTATTGTCTGCGAGCAGTTGTTTGTTGTTAAAAAT AACAGCCATTGTAATGAGACGCACAAACTAATATCACAAACTGGAAATGTCTATCA ATATATAGTTGCTGATCAGATCTGATCATGGAGATAATTAAAATGATAACCATCTCG CAAATAAATAAGTATTTTACTGTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAA ATATAGGATCCATGCCCCACTCCAGCCTGCATCCATCCATCCCGTGTCCCAGGGGTC ACGGGGCCCAGAAGGCAGCCTTGGTTCTGCTGAGTGCCTGCCTGGTGACCCTTTGGG GGCTAGGAGAGCCACCAGAGCACACTCTCCGGTACCTGGTGCTCCACCTAGCCTCCC TGCAGCTGGGACTGCTGTTAAACGGGGTCTGCAGCCTGGCTGAGGAGCTGCGCCAC ATCCACTCCAGGTACCGGGGCAGCTACTGGAGGACTGTGCGGGCCTGCCTGGGCTG CCCCCTCCGCCGTGGGGCCCTGTTGCTGCTGTCCATCTATTTCTACTACTCCCTCCCA AATGCGGTCGGCCCGCCCTTCACTTGGATGCTTGCCCTCCTGGGCCTCTCGCAGGCA CTGAACATCCTCCTGGGCCTCAAGGGCCTGGCCCCAGCTGAGATCTCTGCAGTGTGT GAAAAAGGGAATTTCAACGTGGCCCATGGGCTGGCATGGTCATATTACATCGGATA TCTGCGGCTGATCCTGCCAGAGCTCCAGGCCCGGATTCGAACTTACAATCAGCATTA CAACAACCTGCTACGGGGTGCAGTGAGCCAGCGGCTGTATATTCTCCTCCCATTGGA CTGTGGGGTGCCTGATAACCTGAGTATGGCTGACCCCAACATTCGCTTCCTGGATAA ACTGCCCCAGCAGACCGGTGACCGTGCTGGCATCAAGGATCGGGTTTACAGCAACA GCATCTATGAGCTTCTGGAGAACGGGCAGCGGGCGGGCACCTGTGTCCTGGAGTAC GCCACCCCCTTGCAGACTTTGTTTGCCATGTCACAATACAGTCAAGCTGGCTTTAGC CGGGAGGATAGGCTTGAGCAGGCCAAACTCTTCTGCCGGACACTTGAGGACATCCT GGCAGATGCCCCTGAGTCTCAGAACAACTGCCGCCTCATTGCCTACCAGGAACCTGC AGATGACAGCAGCTTCTCGCTGTCCCAGGAGGTTCTCCGGCACCTGCGGCAGGAGG AAAAGGAAGAGGTTACTGTGGGCAGCTTGAAGACCTCAGCGGTGCCCAGTACCTCC ACGATGTCCCAAGAGCCTGAGCTCCTCATCAGTGGAATGGAAAAGCCCCTCCCTCTC CGCACGGATTTCTCTGGCGGTGGCCTGAACGACATCTTCGAAGCCCAGAAAATCGA ATGGCATGAAGGCAGCCTGGAAGTGCTGTTCCAGGGCCCACACCACCATCATCACC ATCACCATTAATGAGCGGCCGCACTCGAGCACCACCACCACCACCACTAACCTAGG TAGCTGAGCGCATGCAAGCTGATCCGGGTTATTAGTACATTTATTAAGCGCTAGATT CTGTGCGTTGTTGATTTACAGACAATTGTTGTACGTATTTTAATAATTCATTAAATTT ATAATCTTTAGGGTGGTATGTTAGAGCGAAAATCAAATGATTTTCAGCGTCTTTATA TCTGAATTTAAATATTAAATCCTCAATAGATTTGTAAAATAGGTTTCGATTAGTTTCA AACAAGGGTTGTTTTTCCGAACCGATGGCTGGACTATCTAATGGATTTTCGCTCAAC GCCACAAAACTTGCCAAATCTTGTAGCAGCAATCTAGCTTTGTCGATATTCGTTTGT GTTTTGTTTTGTAATAAAGGTTCGACGTCGTTCAAAATATTATGCGCTTTTGTATTTC TTTCATCACTGTCGTTAGTGTACAATTGACTCGACGTAAACACGTTAAATAGAGCTT GGACATATTTAACATCGGGCGTGTTAGCTTTATTAGGCCGATTATCGTCGTCGTCCC AACCCTCGTCGTTAGAAGTTGCTTCCGAAGACGATTTTGCCATAGCCACACGACGCC TATTAATTGTGTCGGCTAACACGTCCGCGATCAAATTTGTAGTTGAGCTTTTTGGAAT TATTTCTGATTGCGGGCGTTTTTGGGCGGGTTTCAATCTAACTGTGCCCGATTTTAAT TCAGACAACACGTTAGAAAGCGATGGTGCAGGCGGTGGTAACATTTCAGACGGCAA ATCTACTAATGGCGGCGGTGGTGGAGCTGATGATAAATCTACCATCGGTGGAGGCG CAGGCGGGGCTGGCGGCGGAGGCGGAGGCGGAGGTGGTGGCGGTGATGCAGACGG CGGTTTAGGCTCAAATGTCTCTTTAGGCAACACAGTCGGCACCTCAACTATTGTACT GGTTTCGGGCGCCGTTTTTGGTTTGACCGGTCTGAGACGAGTGCGATTTTTTTCGTTT CTAATAGCTTCCAACAATTGTTGTCTGTCGTCTAAAGGTGCAGCGGGTTGAGGTTCC GTCGGCATTGGTGGAGCGGGCGGCAATTCAGACATCGATGGTGGTGGTGGTGGTGG AGGCGCTGGAATGTTAGGCACGGGAGAAGGTGGTGGCGGCGGTGCCGCCGGTATAA TTTGTTCTGGTTTAGTTTGTTCGCGCACGATTGTGGGCACCGGCGCAGGCGCCGCTG GCTGCACAACGGAAGGTCGTCTGCTTCGAGGCAGCGCTTGGGGTGGTGGCAATTCA ATATTATAATTGGAATACAAATCGTAAAAATCTGCTATAAGCATTGTAATTTCGCTA TCGTTTACCGTGCCGATATTTAACAACCGCTCAATGTAAGCAATTGTATTGTAAAGA GATTGTCTCAAGCTCGGATCGATCCCGCACGCCGATAACAAGCCTTTTCATTTTTACT ACAGCATTGTAGTGGCGAGACACTTCGCTGTCGTCGAGGTTTAAACGCTTCCTCGCT CACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAA GGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAG CAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTC CATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTG GCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCG TGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTC GGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGT CGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGC CTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACT GGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAG AGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCT GCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCA AACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCA GAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGT GGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTC ACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAG TAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATC TGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATAC GGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCA CCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAG TGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAG AGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCAT CGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCA AGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCT CCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCA CTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGT ACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGG CGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTG GAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTT CGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGT TTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCG ACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATC AGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAA TAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGCGCCCTGTAGCGGCG CATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGC GCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTT TCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACG GCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCC CTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTC TTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAG GGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTA ACGCGAATTTTAACAAAATATTAACGTTTACAATTTCCCATTCGCCATTCAGGCTGC GCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCA
(965) Certain compounds of the disclosure were evaluated in WT STING in vitro binding assay as described above. The following table tabulates the biological data for these compounds as EC.sub.50 values.
(966) TABLE-US-00029 TABLE 25 .sup.3H-cGAMP filtration binding assay for WT STING Example EC.sub.50 (nM) 1 117 2 14 3 273 4 33 5 381 6 206 7 71 8 76 9 322 10 421 11 4560 12 3 13 625 14 21 15 615 16 51 17 299 18 8 19 9 20 24 21 5 22 1 23 2 24 39% inhibition at 20,000 nM 25 23 26 19 27 362 28 112 29 44 30 7520 31 9482 32 9 33 4 34 4 35 4 36 10 37 2 38 1039 39 2 40 1365 41 50 42 12 43 151 44 64 45 14760 46 394 47 81 48 43% inhibition at 20,000 nM 49 34% inhibition at 20,000 nM 50 1 51 8 52 4 53 713 54 3084 55 48 56 3127 57 398 58 1 59 2 60 67 61 327 62 2 63 4 64 4 65 1 66 20 67 45 68 443 69 2 70 1 71 2 72 2 73 4 74 6 75 691 76 56 77/78 224 (mixture) 79 12 80 12650 81 23 82 2 83 9 84 1058 85 9008 86 9 87 1921 88 109 89 94 90 978 91 30 92 7 93 3 94 131 95 813 96 628 97 69 98 1 99 3 100 2240 101 2 102 213 103 371 104 8900 105 311 106 251 107 2 108 244 109 39 110 15% inhibition at 20,000 nM 111 50% inhibition at 20,000 nM 112 11% inhibition at 20,000 nM 113 23 114 264 115 295 116 4241 117 2640 118 4996 119 32% inhibition at 20,000 nM 120 698 121 43% inhibition at 20,000 nM 122 1 123 2 124 3060 125 5 126 19 127 270 128 6314 129 17080 130 25 131 242 132 10 133 147 134 233 135 5 136 10310 137 319 138 2 139 12 140 28% inhibition at 7,000 nM 141 219 142 1 143 1452 144 93 145 47% inhibition at 2,000 nM 146 18% inhibition at 2,000 nM 147 207 148 411 149 46 150 1035 151 1039 152 3% inhibition at 2,000 nM 153 10 154 30% inhibition at 2,000 nM 155 5 156 1 157 1 158 32 159 3 160 6 161 4 162 4 163 1 164 1 165 3 166 117 167 19 168 199 169 18 170 3 171 59 172 15060 173 3 174 1 175 46% inhibition at 20,000 nM 176 2 177 720 178 31 179 1 180 1 181 177 182 2 183 3 184 29% inhibition at 2,000 nM 185 1 186 756 187 46 188 1 189 2 190 2
IFN- Secretion in THP1 Cell Culture (5 h)
(967) The ability of compounds to stimulate the secretion of interferon-beta from THP1 cells was measured using a human IFN- AlphaLISA kit (Perkin Elmer, Cat. No. AL265F). The basic protocol is as follows:
(968) A Labcyte Echo 550 acoustic dispenser was used to transfer 120 nL of compound dissolved in DMSO into the wells of an empty, sterile 384-well microplate, (Corning, Cat. No. 3712). THP1 cells (American Type Culture Collection, Cat. No. TIB202) previously frozen in Recovery Medium (Life Technologies, Cat. No. 12648-010) were thawed and immediately diluted 10-fold into 37 C. assay medium (RPMI 1640+L-Glutamine & phenol red, Life Technologies, Cat. No. 11875-085; 0.5% heat inactivated fetal bovine serum, Sigma Aldrich, Cat. No. F4135; 1 mM Sodium Pyruvate, Life Technologies, Cat. No. 11360-070; 1 non-essential amino acids; Life Technologies, Cat. No. 11140-050). The cell viability and count was ascertained using a Beckman Coulter V-Cell XR cell counter. The cells suspension was centrifuged at 200g for 5 min at RT. Cells were resuspended to a density of 0.810.sup.6/mL in 37 C. assay medium. Subsequent liquid transfers were performed using either a Matrix electronic multichannel pipette or an Agilent Bravo Automated Liquid Handling Platform.
(969) The assay was started by dispensing 40 L of the previously prepared cell suspension into the wells of the plate containing compounds. After 5 h incubation at 37 C., 5% CO.sub.2 in a humidified atmosphere, the plate of cells and compounds was centrifuged at 200g for 5 min at RT. From each well, 5 L of supernatant was transferred into corresponding wells of a white 384-well plate (Perkin Elmer, Cat. No. 6005620). To these supernatant-containing wells was added 10 L of 5 Anti-Analyte Acceptor beads (50 g/mL of AlphaLISA HiBlock Buffer) and incubated for 30 min at RT while shaking on an orbital plate shaker. To each well was added 10 L of 5 Biotinylated Antibody Anti-analyte (5 nM in AlphaLISA HiBlock Buffer) and incubated on an orbital plate shaker for 60 min at RT or overnight at 4 C. To each well was added 25 L of 2 SA-Donor beads (80 g/mL in AlphaLISA HiBlock Buffer) and incubated for 30-45 min at RT in the dark while shaking on an orbital plate shaker. The plate was then read on a Perkin Elmer Envision (.sub.ex=680 nm, .sub.em=570 nm). The percent effect of the AlphaLISA signal at each compound concentration was calculated based on 30 uM cGAMP positive controls and 0.3% DMSO negative controls. The plot of percent effect versus the log of compound concentration was fit with a 4-parameter concentration response equation to calculate EC.sub.50 values. The test compounds were tested at concentrations 30000, 10000, 3333, 1111, 370.4, 123.4, 41.2, 13.7, 4.6, and 1.5 nM with 0.3% residual DMSO. The control compound, cGAMP was tested at concentrations 100000, 33333, 11111, 3704, 1235, 412, 137, 46, and 15 nM with 0.3% residual DMSO.
(970) Compounds of the disclosure were evaluated for IFN- secretion in THP1 cell culture as described above. The following table tabulates the biological data for these compounds as percent activation relative to 23-cGAMP at the 30 M concentration.
(971) TABLE-US-00030 TABLE 26 IFN- secretion in THP1 cell culture (5 h) % Effect at 30 M relative to Example 23-cGAMP 1 26 2 192 3 151 4 93 5 96 6 106 7 97 8 99 9 48 10 134 11 7 12 74 13 67 14 77 15 114 16 70 17 38 18 62 19 30 20 63 21 59 22 48 23 83 24 150 25 136 26 129 27 113 28 116 29 107 30 103 31 117 32 117 33 104 34 72 35 80 36 102 37 76 38 17 39 75 40 27 41 117 42 67 43 69 44 108 45 8 46 60 47 62 48 22 49 17 50 44 51 43 52 53 53 23 54 9 55 53 56 30 57 15 58 46 59 18 60 106 61 62 62 106 63 62 64 58 65 105 66 103 67 92 68 24 69 46 70 47 71 15 72 77 73 67 74 16 75 63 76 44 77/78 43 mixture 79 49 80 12 81 120 82 158 83 107 84 148 85 145 86 131 87 120 88 152 89 112 90 125 91 109 92 62 93 87 94 100 95 72 96 43 97 54 98 92 99 82 100 33 (@ 3 uM) 101 85 102 69 103 79 104 35 105 130 106 74 107 108 108 86 109 96 110 6 111 45 (@ 3 uM) 112 23 113 93 114 57 115 110 116 8 117 123 118 117 119 13 120 45 (@ 3 uM) 121 26 122 79 123 105 124 45 (@ 3 uM) 125 156 126 91 127 120 128 83 129 50 130 61 131 38 (@ 3 uM) 132 131 133 80 134 89 135 100 136 37 137 155 138 89 139 57 140 31 (@ 3 uM) 141 143 142 81 143 26 (@ 3 uM) 144 8 145 59 (@ 3 uM) 146 27 (@ 3 uM) 147 71 (@ 3 uM) 148 41 (@ 3 uM) 149 70 (@ 3 uM) 150 52 (@ 3 uM) 151 63 (@ 3 uM) 152 7 (@ 3 uM) 153 137 (@ 3 uM) 154 76 (@ 3 uM) 155 129 (@ 3 uM) 156 118 (@ 3 uM) 157 63% @ 3 uM 158 43 159 99 160 18 161 106 162 98 163 135 164 131 165 21 166 34 167 66 168 102 169 64 170 86 171 97 172 16 (@ 3 uM) 173 127 174 88 175 13 176 44 177 80 178 107 179 79 180 121 (@ 3 uM) 181 104 (@ 3 uM) 182 147 (@ 3 uM) 183 127 (@ 3 uM) 184 10 (@ 3 uM) 185 122 (@ 3 uM) 186 56 (@ 3 uM) 187 128 (@ 3 uM) 188 104 (@ 3 uM) 189 111 (@ 3 uM) 190 126 (@ 3 uM)
(972) It will be appreciated that various of the above-discussed and other features and functions, or alternatives thereof, may be desirably combined into many other different systems or applications. It also will be appreciated that various presently unforeseen or unanticipated alternatives, modifications, variations or improvements therein may be subsequently made by those skilled in the art and are also intended to be encompassed by the following claims.